Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8033
Gene name
LocationContig_94:66764..71510
Strand-
Gene length (bp)4746
Transcript length (bp)4746
Coding sequence length (bp)4746
Protein length (aa) 1582

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11864 DUF3384 Domain of unknown function (DUF3384) 1.5E-140 83 554
PF02145 Rap_GAP Rap/ran-GAP 3.5E-54 1283 1484
PF03542 Tuberin Tuberin 1.8E-30 835 1032

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 856 1488 3.0E-119
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 1218 1512 5.0E-41
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 1218 1513 4.0E-40
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 1218 1488 8.0E-36
sp|O55007|RGPA1_RAT Ral GTPase-activating protein subunit alpha-1 OS=Rattus norvegicus GN=Ralgapa1 PE=1 SV=2 1244 1457 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 856 1488 3.0E-119
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 1218 1512 5.0E-41
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 1218 1513 4.0E-40
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 1218 1488 8.0E-36
sp|O55007|RGPA1_RAT Ral GTPase-activating protein subunit alpha-1 OS=Rattus norvegicus GN=Ralgapa1 PE=1 SV=2 1244 1457 2.0E-21
sp|Q6GYP7|RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus GN=Ralgapa1 PE=1 SV=1 1244 1457 4.0E-21
sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1 1244 1457 9.0E-21
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 834 1106 2.0E-19
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 840 1106 5.0E-19
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 840 1106 7.0E-19
sp|Q9VB98|Y5521_DROME Probable Rho GTPase-activating protein CG5521 OS=Drosophila melanogaster GN=CG5521 PE=1 SV=2 1252 1457 4.0E-18
sp|P47736|RPGP1_HUMAN Rap1 GTPase-activating protein 1 OS=Homo sapiens GN=RAP1GAP PE=1 SV=2 1241 1433 4.0E-18
sp|A2ALS5|RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus GN=Rap1gap PE=1 SV=2 1241 1433 5.0E-18
sp|P86411|RGPA2_RAT Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus GN=Ralgapa2 PE=1 SV=1 1252 1457 8.0E-18
sp|A3KGS3|RGPA2_MOUSE Ral GTPase-activating protein subunit alpha-2 OS=Mus musculus GN=Ralgapa2 PE=1 SV=2 1252 1457 9.0E-18
sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2 1252 1457 2.0E-17
sp|Q55AN8|Y1806_DICDI PH and Rap-GAP domain-containing protein DDB_G0271806 OS=Dictyostelium discoideum GN=DDB_G0271806 PE=3 SV=1 1246 1461 8.0E-16
sp|Q9P2F8|SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens GN=SIPA1L2 PE=1 SV=2 1266 1394 2.0E-15
sp|Q5JCS6|SI1L2_RAT Signal-induced proliferation-associated 1-like protein 2 OS=Rattus norvegicus GN=Sipa1l2 PE=1 SV=1 1266 1394 2.0E-15
sp|Q80TE4|SI1L2_MOUSE Signal-induced proliferation-associated 1-like protein 2 OS=Mus musculus GN=Sipa1l2 PE=1 SV=3 1266 1394 2.0E-15
sp|Q8C0T5|SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus GN=Sipa1l1 PE=1 SV=2 1266 1394 1.0E-14
sp|Q96FS4|SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens GN=SIPA1 PE=1 SV=1 1267 1394 1.0E-14
sp|O60292|SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens GN=SIPA1L3 PE=1 SV=3 1266 1394 1.0E-14
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 15 714 2.0E-14
sp|Q684P5|RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens GN=RAP1GAP2 PE=1 SV=2 1241 1407 2.0E-14
sp|O35412|SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus GN=Sipa1l1 PE=1 SV=1 1266 1394 2.0E-14
sp|O43166|SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens GN=SIPA1L1 PE=1 SV=4 1266 1394 2.0E-14
sp|Q5ZJY3|GARL3_CHICK GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Gallus gallus GN=GARNL3 PE=2 SV=1 1267 1374 2.0E-14
sp|Q5VVW2|GARL3_HUMAN GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Homo sapiens GN=GARNL3 PE=2 SV=2 1267 1433 3.0E-14
sp|Q5SVL6|RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus GN=Rap1gap2 PE=1 SV=1 1241 1407 3.0E-14
sp|Q5ZMV8|RPGP2_CHICK Rap1 GTPase-activating protein 2 OS=Gallus gallus GN=RAP1GAP2 PE=2 SV=2 1241 1394 6.0E-14
sp|P46062|SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus GN=Sipa1 PE=1 SV=2 1267 1394 7.0E-14
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 107 745 1.0E-13
sp|A5PF44|GARL3_DANRE GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Danio rerio GN=garnl3 PE=3 SV=1 1267 1394 3.0E-13
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 84 600 4.0E-13
sp|Q3V0G7|GARL3_MOUSE GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Mus musculus GN=Garnl3 PE=1 SV=1 1267 1433 7.0E-13
sp|Q75J96|RGAP1_DICDI RapA guanosine triphosphatase-activating protein 1 OS=Dictyostelium discoideum GN=rapgap1 PE=2 SV=1 1267 1394 1.0E-12
sp|Q54EH3|Y1510_DICDI GTPase-activating protein DDB_G0291510 OS=Dictyostelium discoideum GN=DDB_G0291510 PE=3 SV=1 1266 1440 1.0E-12
sp|Q54TK4|Y1809_DICDI Rap-GAP domain-containing protein DDB_G0281809 OS=Dictyostelium discoideum GN=DDB_G0281809 PE=3 SV=1 1252 1457 2.0E-07
sp|Q54SS8|RGAPB_DICDI RapA guanosine triphosphatase-activating protein B OS=Dictyostelium discoideum GN=rapgapB PE=2 SV=1 1267 1396 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051056 regulation of small GTPase mediated signal transduction Yes
GO:0005096 GTPase activator activity Yes
GO:0043547 positive regulation of GTPase activity Yes
GO:0050794 regulation of cellular process No
GO:0044093 positive regulation of molecular function No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0048583 regulation of response to stimulus No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0050790 regulation of catalytic activity No
GO:0050789 regulation of biological process No
GO:0008047 enzyme activator activity No
GO:0098772 molecular function regulator activity No
GO:0009966 regulation of signal transduction No
GO:0065007 biological regulation No
GO:0030695 GTPase regulator activity No
GO:0023051 regulation of signaling No
GO:0010646 regulation of cell communication No
GO:0043085 positive regulation of catalytic activity No
GO:0030234 enzyme regulator activity No
GO:0051345 positive regulation of hydrolase activity No
GO:1902531 regulation of intracellular signal transduction No
GO:0065009 regulation of molecular function No
GO:0043087 regulation of GTPase activity No
GO:0051336 regulation of hydrolase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3412
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3266
Ophiocordyceps australis map64 (Brazil) OphauB2|8033 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04891
Ophiocordyceps camponoti-rufipedis Ophun1|5204
Ophiocordyceps kimflemingae Ophio5|5715
Ophiocordyceps subramaniannii Hirsu2|6409

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8033
MIPQSEDDSKPLESTTRPGGLANVFRSLTSSKGSNKSPTRPPLAASAAAAPKAESTYATSNSSRELSHNHMDALQ
QLKHGTSAERLSAATALRHAISEYPMSPVLDIWYAAKDLIEPNNQASLRTAGWELLTECAKHPSSTDLERKEYFQ
TLSAPANPKDFHLQLAAMIQLTNHGRVITGFDYELVPLLNRWLQKAYPAARKARKGVSSARHQESSSRSNPMICD
EDENLVQLFSFLLDIVKFSFNNASESSIIGLIDSLLAICMDTNGKDDLKNCIGMLDAVVTFASIPQERLSDCIQV
LSSIYAMIPDLEKSSWHTISNICKSHNGQAAVRILLDALRDRPTDGATAVETTRKVRGALASLKKLLSKASEKGY
PTVPYAPLVDGLSNALKTTTSLKAYVNLLQLINTLFEDGNGQIHSLVVGEDWSLCLDVAAECLRRADADADERRW
TQGKDDSPDLSIEAEIVALINRLDIVVRERSDFVPRESVINFFTDVHPLLPDSTVGTVLDYFHEFRCCFPSDLQW
EENLSLVLDAFFCNTSRSTQTRLRALKTVTDAYEIVDLVGDGSEHDLIARLSRGILRNVTEETDIATLEAIVSLM
VSVVALCNMDLFHYAITTLEEVVSNDRLRPPVALSTLAVRDGPGPSLSCQSPSNVVAKGFVRMFLRVINSHGEKS
VRLFNALVGIAKPSHCEMDARLTAMKMLFRLRADWANRIFATDDPESTFLATAMCRTDASFAKKQAEEAAQSLRL
SRGEHSLQSRPSRGMSVGQSSIPERNAAARMSTGARPPQQKYRQIWSYPDPEALPEETPQLVSPVLLSCTCHKAG
DEHSSMDTGAAPFALEMSLWFETVLAVLQGSNWEVYSFVLVHLPSQLSNHAVFTEAIAQVKELRKLICEQLRTKS
FQEPPNASGLRRADVAICLFHSLTMILSYHEHFTKSDEDEIVQTFVAGMTTWERTAKYCIHALSICCHELPLSTS
KCLIQVLNQMAAIITQPHVSIHVLEFLASLSRLHDVFVNFREDDFRIVFGICFRYLEYAREKKRSNRSSHASEAS
APTTPSSNPMEASQAGTVDDVPQYVHALAYHVIMFWFLALKLQDRARHVGWIAKKLFPDDGSNQAADEQAITSID
FMQRVTYADVDESSEDPYFNEARFGAIIKKQWLVGYSIITIKQATVSGWAQIIKRQPSGTSAYTVRETYTPPPPH
QTDTPVDVSRECQATSNAILPSHLLVQLMAPVPQYPGSVRPIALPDEDATARAIRMFDLNSSLDGHKVGVIYIGE
GQKTEAEILANVSGSSDYVEFLNNLGTLTRLKGATFNTQGLDHNMDLDGQYTFCWRDRVTEIVFHVTTQMPTNLE
RDAQCVQKKRHIGNDFVNIIFNDSGLSFDFDTFPSDFNSVYIVITPASRASFVASRDGKGQAQRRPFYRVQVMSK
PGFPEVSPASETKMISLKALPGFVRLLALNASMFSVVWHRREVGEHISSWSARLREIKRLRERHAPRMTASAATT
ASPAGGAAQGQQVDAARPSGSVRDSLNSLRRTSVATFLTSTTEQTSQRSSTQSTVATSEAEQSHLSAVNWLVEFA
DFSKWA*
Coding >OphauB2|8033
ATGATCCCACAATCCGAAGATGACTCCAAGCCGCTCGAATCGACGACGCGCCCTGGGGGCCTTGCAAATGTTTTC
CGCAGCTTGACCAGCTCTAAGGGCTCCAACAAGTCTCCCACACGGCCTCCTTTGGCCGCTTCTGCTGCTGCCGCC
CCCAAGGCCGAATCTACGTATGCCACCTCGAATAGCTCCCGCGAACTCTCACATAACCACATGGACGCTTTGCAA
CAGCTCAAACATGGAACTTCTGCTGAGCGTTTGAGTGCGGCCACCGCCTTGAGACACGCGATATCCGAGTATCCC
ATGAGCCCTGTTCTCGACATCTGGTATGCTGCCAAGGACTTAATTGAACCCAACAACCAGGCCTCTCTCCGCACT
GCTGGCTGGGAACTTCTGACAGAGTGTGCCAAGCACCCATCTTCTACCGACCTGGAACGCAAGGAATATTTCCAG
ACACTCTCAGCACCAGCAAACCCCAAAGATTTTCACCTGCAACTTGCTGCCATGATTCAGCTCACCAATCATGGG
CGCGTGATAACTGGCTTTGACTACGAGCTTGTGCCCCTCCTCAATCGCTGGCTCCAGAAAGCCTATCCAGCGGCA
AGGAAGGCGCGCAAGGGCGTGTCATCAGCTCGACACCAGGAAAGCTCCTCCAGAAGCAACCCAATGATTTGTGAC
GAAGATGAAAACTTGGTCCAGCTTTTCAGTTTCCTCTTGGATATTGTCAAGTTCAGCTTCAATAATGCAAGCGAA
TCGTCGATAATAGGACTCATCGATAGTCTCTTGGCTATTTGCATGGATACAAACGGCAAGGACGACCTCAAGAAC
TGTATTGGAATGCTCGATGCTGTGGTGACGTTTGCCTCAATCCCACAGGAAAGGCTGTCGGATTGCATCCAAGTC
CTGTCTTCAATATATGCCATGATTCCCGACCTGGAGAAGAGCTCGTGGCACACAATATCCAATATATGCAAGTCT
CACAATGGTCAGGCCGCAGTCCGCATCCTCCTCGATGCCCTTCGCGACCGTCCTACAGACGGTGCCACTGCTGTG
GAAACGACGAGAAAAGTCAGAGGGGCCCTCGCATCCCTTAAAAAGCTGCTCTCCAAGGCAAGCGAGAAGGGCTAT
CCCACTGTCCCTTACGCCCCACTTGTGGACGGCCTATCAAATGCTCTCAAAACGACAACATCGTTGAAGGCATAC
GTGAATCTTTTACAACTCATAAACACGCTCTTTGAAGACGGAAACGGCCAGATCCATAGCTTGGTTGTCGGCGAA
GATTGGTCATTGTGTCTAGACGTGGCCGCCGAGTGCCTTCGGAGAGCAGACGCAGACGCAGACGAAAGAAGATGG
ACACAGGGAAAGGATGACTCTCCAGACCTCTCCATTGAAGCAGAAATTGTTGCACTCATCAATCGGCTTGATATT
GTCGTCAGAGAAAGGTCCGACTTTGTGCCTCGGGAGTCTGTCATCAACTTCTTCACCGATGTGCACCCCCTGCTA
CCAGACAGCACAGTAGGAACAGTTTTGGACTATTTCCACGAGTTTAGATGTTGCTTCCCGTCCGACCTGCAGTGG
GAGGAAAACCTTTCTCTCGTGCTCGATGCCTTTTTCTGCAACACCAGCCGCAGCACGCAGACGCGATTACGGGCC
CTAAAAACAGTCACAGATGCCTATGAAATTGTCGACCTTGTTGGAGACGGGTCAGAACACGACCTTATCGCTCGT
CTGTCTCGAGGGATCCTGCGCAACGTGACTGAGGAGACGGACATTGCAACCTTGGAGGCCATTGTGTCGCTCATG
GTATCCGTCGTGGCCTTGTGCAACATGGATCTCTTCCACTACGCCATCACCACCCTTGAGGAAGTCGTCAGTAAC
GACAGGCTCCGACCACCAGTTGCTTTATCAACTTTGGCCGTGCGTGATGGTCCCGGGCCATCATTGTCTTGCCAG
TCGCCGTCAAACGTGGTGGCCAAGGGCTTTGTGCGCATGTTTTTGCGGGTCATCAACTCGCATGGCGAAAAGTCG
GTACGACTCTTCAACGCGCTGGTGGGCATTGCCAAGCCAAGCCACTGTGAGATGGACGCTCGTCTCACGGCAATG
AAGATGTTGTTTCGGCTCCGAGCCGACTGGGCCAACCGCATCTTTGCCACAGACGACCCCGAAAGCACCTTTCTT
GCGACCGCCATGTGCCGCACGGACGCTTCGTTTGCTAAGAAGCAAGCCGAAGAAGCTGCGCAGTCACTTCGCTTG
TCGCGGGGAGAGCACAGTCTTCAGTCACGGCCATCGCGTGGCATGTCTGTTGGCCAATCATCGATACCAGAAAGA
AACGCTGCCGCGCGCATGTCGACGGGTGCCAGGCCCCCTCAACAAAAATATCGACAGATCTGGAGTTATCCGGAC
CCAGAAGCCTTGCCCGAGGAAACACCGCAGCTAGTCAGCCCCGTCTTGCTATCATGCACATGTCACAAGGCCGGC
GACGAGCACTCATCCATGGACACAGGAGCAGCTCCATTTGCTCTCGAAATGTCACTCTGGTTCGAGACTGTCCTG
GCTGTACTGCAAGGGAGTAACTGGGAGGTTTACAGCTTCGTTTTGGTCCATCTCCCGTCGCAGCTGAGCAATCAC
GCTGTCTTTACCGAGGCTATAGCACAAGTCAAGGAGCTACGCAAGCTTATATGCGAGCAACTAAGGACCAAGTCG
TTCCAGGAGCCGCCCAATGCCTCGGGGCTCCGCCGAGCAGACGTGGCAATTTGCCTCTTTCACAGTCTGACCATG
ATTCTCAGCTACCATGAGCACTTCACCAAGAGCGACGAAGATGAGATAGTGCAAACCTTTGTCGCAGGCATGACC
ACATGGGAGCGTACTGCAAAGTACTGCATTCATGCCCTCTCGATATGTTGTCACGAGCTGCCGCTGTCCACCAGC
AAGTGTCTAATTCAGGTGCTGAATCAAATGGCTGCCATTATTACGCAGCCACATGTGTCTATTCACGTTCTCGAA
TTCCTCGCCTCTCTCAGCCGGCTGCATGATGTGTTTGTCAATTTTCGCGAGGACGACTTTAGGATTGTCTTTGGC
ATCTGCTTTCGCTATCTGGAATACGCGCGGGAAAAGAAACGCTCCAATCGCAGCAGCCATGCGAGCGAAGCTTCG
GCACCAACAACCCCGAGCTCGAATCCGATGGAAGCCTCGCAGGCAGGCACAGTTGACGATGTGCCGCAATATGTA
CACGCCTTGGCCTACCATGTCATCATGTTTTGGTTTTTGGCTCTCAAGCTGCAAGATCGTGCTCGACACGTGGGA
TGGATTGCCAAAAAACTCTTCCCCGACGATGGTAGCAATCAGGCTGCCGACGAACAGGCCATTACATCTATTGAC
TTTATGCAGCGTGTGACGTATGCTGATGTGGACGAATCGTCGGAAGATCCATACTTCAACGAAGCACGCTTCGGA
GCTATAATCAAGAAGCAGTGGCTTGTGGGCTACAGCATCATCACGATCAAACAGGCTACGGTTTCTGGTTGGGCC
CAGATCATCAAGCGACAGCCCTCGGGCACCTCGGCATACACTGTCCGTGAAACGTATACGCCGCCGCCGCCACAC
CAGACGGACACACCGGTTGATGTGAGCCGCGAGTGCCAGGCAACGTCGAATGCCATTCTACCAAGTCATCTGCTC
GTGCAGCTCATGGCCCCAGTCCCACAATACCCTGGGTCAGTAAGGCCGATTGCTCTGCCCGACGAAGATGCAACG
GCACGAGCGATTAGAATGTTTGACCTCAACTCGAGTCTGGATGGACACAAGGTGGGCGTGATATATATCGGAGAA
GGCCAAAAGACAGAGGCGGAAATCTTGGCCAATGTGTCGGGGAGCAGTGACTACGTCGAGTTCCTCAACAATCTG
GGAACTTTGACCAGACTCAAAGGGGCCACGTTTAACACGCAGGGGCTGGACCACAACATGGACTTGGATGGGCAG
TACACCTTTTGCTGGCGCGACCGAGTCACTGAGATTGTTTTCCATGTGACAACGCAGATGCCCACGAATCTGGAG
CGTGACGCACAATGTGTTCAAAAGAAGCGACACATTGGCAACGACTTTGTCAACATCATCTTCAATGACTCGGGT
CTTTCTTTTGACTTTGACACATTTCCTAGCGACTTCAACTCTGTCTATATTGTTATTACACCGGCATCGCGCGCC
TCGTTTGTGGCGTCTCGTGATGGTAAAGGTCAAGCACAGAGGCGGCCGTTCTACCGTGTCCAGGTCATGAGCAAG
CCAGGGTTTCCCGAGGTGTCGCCGGCGTCAGAGACCAAGATGATATCGCTCAAAGCATTGCCTGGCTTCGTACGG
CTTTTGGCACTCAACGCATCCATGTTTTCAGTGGTGTGGCACCGACGCGAGGTTGGCGAACACATCAGCTCATGG
AGTGCCAGACTAAGGGAGATTAAGCGGCTGCGAGAGAGACATGCTCCAAGAATGACGGCCAGCGCAGCCACGACA
GCCTCGCCTGCTGGCGGCGCTGCGCAAGGCCAGCAAGTTGATGCTGCTCGGCCCAGTGGCAGCGTCAGGGACAGT
TTGAACAGCCTTCGACGGACTAGTGTGGCTACCTTTTTGACGAGTACGACAGAACAGACGTCGCAGCGCTCGTCG
ACCCAATCAACGGTAGCAACGTCGGAAGCTGAACAGTCTCACTTGAGTGCAGTCAATTGGCTTGTCGAATTTGCC
GACTTTTCCAAATGGGCATGA
Transcript >OphauB2|8033
ATGATCCCACAATCCGAAGATGACTCCAAGCCGCTCGAATCGACGACGCGCCCTGGGGGCCTTGCAAATGTTTTC
CGCAGCTTGACCAGCTCTAAGGGCTCCAACAAGTCTCCCACACGGCCTCCTTTGGCCGCTTCTGCTGCTGCCGCC
CCCAAGGCCGAATCTACGTATGCCACCTCGAATAGCTCCCGCGAACTCTCACATAACCACATGGACGCTTTGCAA
CAGCTCAAACATGGAACTTCTGCTGAGCGTTTGAGTGCGGCCACCGCCTTGAGACACGCGATATCCGAGTATCCC
ATGAGCCCTGTTCTCGACATCTGGTATGCTGCCAAGGACTTAATTGAACCCAACAACCAGGCCTCTCTCCGCACT
GCTGGCTGGGAACTTCTGACAGAGTGTGCCAAGCACCCATCTTCTACCGACCTGGAACGCAAGGAATATTTCCAG
ACACTCTCAGCACCAGCAAACCCCAAAGATTTTCACCTGCAACTTGCTGCCATGATTCAGCTCACCAATCATGGG
CGCGTGATAACTGGCTTTGACTACGAGCTTGTGCCCCTCCTCAATCGCTGGCTCCAGAAAGCCTATCCAGCGGCA
AGGAAGGCGCGCAAGGGCGTGTCATCAGCTCGACACCAGGAAAGCTCCTCCAGAAGCAACCCAATGATTTGTGAC
GAAGATGAAAACTTGGTCCAGCTTTTCAGTTTCCTCTTGGATATTGTCAAGTTCAGCTTCAATAATGCAAGCGAA
TCGTCGATAATAGGACTCATCGATAGTCTCTTGGCTATTTGCATGGATACAAACGGCAAGGACGACCTCAAGAAC
TGTATTGGAATGCTCGATGCTGTGGTGACGTTTGCCTCAATCCCACAGGAAAGGCTGTCGGATTGCATCCAAGTC
CTGTCTTCAATATATGCCATGATTCCCGACCTGGAGAAGAGCTCGTGGCACACAATATCCAATATATGCAAGTCT
CACAATGGTCAGGCCGCAGTCCGCATCCTCCTCGATGCCCTTCGCGACCGTCCTACAGACGGTGCCACTGCTGTG
GAAACGACGAGAAAAGTCAGAGGGGCCCTCGCATCCCTTAAAAAGCTGCTCTCCAAGGCAAGCGAGAAGGGCTAT
CCCACTGTCCCTTACGCCCCACTTGTGGACGGCCTATCAAATGCTCTCAAAACGACAACATCGTTGAAGGCATAC
GTGAATCTTTTACAACTCATAAACACGCTCTTTGAAGACGGAAACGGCCAGATCCATAGCTTGGTTGTCGGCGAA
GATTGGTCATTGTGTCTAGACGTGGCCGCCGAGTGCCTTCGGAGAGCAGACGCAGACGCAGACGAAAGAAGATGG
ACACAGGGAAAGGATGACTCTCCAGACCTCTCCATTGAAGCAGAAATTGTTGCACTCATCAATCGGCTTGATATT
GTCGTCAGAGAAAGGTCCGACTTTGTGCCTCGGGAGTCTGTCATCAACTTCTTCACCGATGTGCACCCCCTGCTA
CCAGACAGCACAGTAGGAACAGTTTTGGACTATTTCCACGAGTTTAGATGTTGCTTCCCGTCCGACCTGCAGTGG
GAGGAAAACCTTTCTCTCGTGCTCGATGCCTTTTTCTGCAACACCAGCCGCAGCACGCAGACGCGATTACGGGCC
CTAAAAACAGTCACAGATGCCTATGAAATTGTCGACCTTGTTGGAGACGGGTCAGAACACGACCTTATCGCTCGT
CTGTCTCGAGGGATCCTGCGCAACGTGACTGAGGAGACGGACATTGCAACCTTGGAGGCCATTGTGTCGCTCATG
GTATCCGTCGTGGCCTTGTGCAACATGGATCTCTTCCACTACGCCATCACCACCCTTGAGGAAGTCGTCAGTAAC
GACAGGCTCCGACCACCAGTTGCTTTATCAACTTTGGCCGTGCGTGATGGTCCCGGGCCATCATTGTCTTGCCAG
TCGCCGTCAAACGTGGTGGCCAAGGGCTTTGTGCGCATGTTTTTGCGGGTCATCAACTCGCATGGCGAAAAGTCG
GTACGACTCTTCAACGCGCTGGTGGGCATTGCCAAGCCAAGCCACTGTGAGATGGACGCTCGTCTCACGGCAATG
AAGATGTTGTTTCGGCTCCGAGCCGACTGGGCCAACCGCATCTTTGCCACAGACGACCCCGAAAGCACCTTTCTT
GCGACCGCCATGTGCCGCACGGACGCTTCGTTTGCTAAGAAGCAAGCCGAAGAAGCTGCGCAGTCACTTCGCTTG
TCGCGGGGAGAGCACAGTCTTCAGTCACGGCCATCGCGTGGCATGTCTGTTGGCCAATCATCGATACCAGAAAGA
AACGCTGCCGCGCGCATGTCGACGGGTGCCAGGCCCCCTCAACAAAAATATCGACAGATCTGGAGTTATCCGGAC
CCAGAAGCCTTGCCCGAGGAAACACCGCAGCTAGTCAGCCCCGTCTTGCTATCATGCACATGTCACAAGGCCGGC
GACGAGCACTCATCCATGGACACAGGAGCAGCTCCATTTGCTCTCGAAATGTCACTCTGGTTCGAGACTGTCCTG
GCTGTACTGCAAGGGAGTAACTGGGAGGTTTACAGCTTCGTTTTGGTCCATCTCCCGTCGCAGCTGAGCAATCAC
GCTGTCTTTACCGAGGCTATAGCACAAGTCAAGGAGCTACGCAAGCTTATATGCGAGCAACTAAGGACCAAGTCG
TTCCAGGAGCCGCCCAATGCCTCGGGGCTCCGCCGAGCAGACGTGGCAATTTGCCTCTTTCACAGTCTGACCATG
ATTCTCAGCTACCATGAGCACTTCACCAAGAGCGACGAAGATGAGATAGTGCAAACCTTTGTCGCAGGCATGACC
ACATGGGAGCGTACTGCAAAGTACTGCATTCATGCCCTCTCGATATGTTGTCACGAGCTGCCGCTGTCCACCAGC
AAGTGTCTAATTCAGGTGCTGAATCAAATGGCTGCCATTATTACGCAGCCACATGTGTCTATTCACGTTCTCGAA
TTCCTCGCCTCTCTCAGCCGGCTGCATGATGTGTTTGTCAATTTTCGCGAGGACGACTTTAGGATTGTCTTTGGC
ATCTGCTTTCGCTATCTGGAATACGCGCGGGAAAAGAAACGCTCCAATCGCAGCAGCCATGCGAGCGAAGCTTCG
GCACCAACAACCCCGAGCTCGAATCCGATGGAAGCCTCGCAGGCAGGCACAGTTGACGATGTGCCGCAATATGTA
CACGCCTTGGCCTACCATGTCATCATGTTTTGGTTTTTGGCTCTCAAGCTGCAAGATCGTGCTCGACACGTGGGA
TGGATTGCCAAAAAACTCTTCCCCGACGATGGTAGCAATCAGGCTGCCGACGAACAGGCCATTACATCTATTGAC
TTTATGCAGCGTGTGACGTATGCTGATGTGGACGAATCGTCGGAAGATCCATACTTCAACGAAGCACGCTTCGGA
GCTATAATCAAGAAGCAGTGGCTTGTGGGCTACAGCATCATCACGATCAAACAGGCTACGGTTTCTGGTTGGGCC
CAGATCATCAAGCGACAGCCCTCGGGCACCTCGGCATACACTGTCCGTGAAACGTATACGCCGCCGCCGCCACAC
CAGACGGACACACCGGTTGATGTGAGCCGCGAGTGCCAGGCAACGTCGAATGCCATTCTACCAAGTCATCTGCTC
GTGCAGCTCATGGCCCCAGTCCCACAATACCCTGGGTCAGTAAGGCCGATTGCTCTGCCCGACGAAGATGCAACG
GCACGAGCGATTAGAATGTTTGACCTCAACTCGAGTCTGGATGGACACAAGGTGGGCGTGATATATATCGGAGAA
GGCCAAAAGACAGAGGCGGAAATCTTGGCCAATGTGTCGGGGAGCAGTGACTACGTCGAGTTCCTCAACAATCTG
GGAACTTTGACCAGACTCAAAGGGGCCACGTTTAACACGCAGGGGCTGGACCACAACATGGACTTGGATGGGCAG
TACACCTTTTGCTGGCGCGACCGAGTCACTGAGATTGTTTTCCATGTGACAACGCAGATGCCCACGAATCTGGAG
CGTGACGCACAATGTGTTCAAAAGAAGCGACACATTGGCAACGACTTTGTCAACATCATCTTCAATGACTCGGGT
CTTTCTTTTGACTTTGACACATTTCCTAGCGACTTCAACTCTGTCTATATTGTTATTACACCGGCATCGCGCGCC
TCGTTTGTGGCGTCTCGTGATGGTAAAGGTCAAGCACAGAGGCGGCCGTTCTACCGTGTCCAGGTCATGAGCAAG
CCAGGGTTTCCCGAGGTGTCGCCGGCGTCAGAGACCAAGATGATATCGCTCAAAGCATTGCCTGGCTTCGTACGG
CTTTTGGCACTCAACGCATCCATGTTTTCAGTGGTGTGGCACCGACGCGAGGTTGGCGAACACATCAGCTCATGG
AGTGCCAGACTAAGGGAGATTAAGCGGCTGCGAGAGAGACATGCTCCAAGAATGACGGCCAGCGCAGCCACGACA
GCCTCGCCTGCTGGCGGCGCTGCGCAAGGCCAGCAAGTTGATGCTGCTCGGCCCAGTGGCAGCGTCAGGGACAGT
TTGAACAGCCTTCGACGGACTAGTGTGGCTACCTTTTTGACGAGTACGACAGAACAGACGTCGCAGCGCTCGTCG
ACCCAATCAACGGTAGCAACGTCGGAAGCTGAACAGTCTCACTTGAGTGCAGTCAATTGGCTTGTCGAATTTGCC
GACTTTTCCAAATGGGCATGA
Gene >OphauB2|8033
ATGATCCCACAATCCGAAGATGACTCCAAGCCGCTCGAATCGACGACGCGCCCTGGGGGCCTTGCAAATGTTTTC
CGCAGCTTGACCAGCTCTAAGGGCTCCAACAAGTCTCCCACACGGCCTCCTTTGGCCGCTTCTGCTGCTGCCGCC
CCCAAGGCCGAATCTACGTATGCCACCTCGAATAGCTCCCGCGAACTCTCACATAACCACATGGACGCTTTGCAA
CAGCTCAAACATGGAACTTCTGCTGAGCGTTTGAGTGCGGCCACCGCCTTGAGACACGCGATATCCGAGTATCCC
ATGAGCCCTGTTCTCGACATCTGGTATGCTGCCAAGGACTTAATTGAACCCAACAACCAGGCCTCTCTCCGCACT
GCTGGCTGGGAACTTCTGACAGAGTGTGCCAAGCACCCATCTTCTACCGACCTGGAACGCAAGGAATATTTCCAG
ACACTCTCAGCACCAGCAAACCCCAAAGATTTTCACCTGCAACTTGCTGCCATGATTCAGCTCACCAATCATGGG
CGCGTGATAACTGGCTTTGACTACGAGCTTGTGCCCCTCCTCAATCGCTGGCTCCAGAAAGCCTATCCAGCGGCA
AGGAAGGCGCGCAAGGGCGTGTCATCAGCTCGACACCAGGAAAGCTCCTCCAGAAGCAACCCAATGATTTGTGAC
GAAGATGAAAACTTGGTCCAGCTTTTCAGTTTCCTCTTGGATATTGTCAAGTTCAGCTTCAATAATGCAAGCGAA
TCGTCGATAATAGGACTCATCGATAGTCTCTTGGCTATTTGCATGGATACAAACGGCAAGGACGACCTCAAGAAC
TGTATTGGAATGCTCGATGCTGTGGTGACGTTTGCCTCAATCCCACAGGAAAGGCTGTCGGATTGCATCCAAGTC
CTGTCTTCAATATATGCCATGATTCCCGACCTGGAGAAGAGCTCGTGGCACACAATATCCAATATATGCAAGTCT
CACAATGGTCAGGCCGCAGTCCGCATCCTCCTCGATGCCCTTCGCGACCGTCCTACAGACGGTGCCACTGCTGTG
GAAACGACGAGAAAAGTCAGAGGGGCCCTCGCATCCCTTAAAAAGCTGCTCTCCAAGGCAAGCGAGAAGGGCTAT
CCCACTGTCCCTTACGCCCCACTTGTGGACGGCCTATCAAATGCTCTCAAAACGACAACATCGTTGAAGGCATAC
GTGAATCTTTTACAACTCATAAACACGCTCTTTGAAGACGGAAACGGCCAGATCCATAGCTTGGTTGTCGGCGAA
GATTGGTCATTGTGTCTAGACGTGGCCGCCGAGTGCCTTCGGAGAGCAGACGCAGACGCAGACGAAAGAAGATGG
ACACAGGGAAAGGATGACTCTCCAGACCTCTCCATTGAAGCAGAAATTGTTGCACTCATCAATCGGCTTGATATT
GTCGTCAGAGAAAGGTCCGACTTTGTGCCTCGGGAGTCTGTCATCAACTTCTTCACCGATGTGCACCCCCTGCTA
CCAGACAGCACAGTAGGAACAGTTTTGGACTATTTCCACGAGTTTAGATGTTGCTTCCCGTCCGACCTGCAGTGG
GAGGAAAACCTTTCTCTCGTGCTCGATGCCTTTTTCTGCAACACCAGCCGCAGCACGCAGACGCGATTACGGGCC
CTAAAAACAGTCACAGATGCCTATGAAATTGTCGACCTTGTTGGAGACGGGTCAGAACACGACCTTATCGCTCGT
CTGTCTCGAGGGATCCTGCGCAACGTGACTGAGGAGACGGACATTGCAACCTTGGAGGCCATTGTGTCGCTCATG
GTATCCGTCGTGGCCTTGTGCAACATGGATCTCTTCCACTACGCCATCACCACCCTTGAGGAAGTCGTCAGTAAC
GACAGGCTCCGACCACCAGTTGCTTTATCAACTTTGGCCGTGCGTGATGGTCCCGGGCCATCATTGTCTTGCCAG
TCGCCGTCAAACGTGGTGGCCAAGGGCTTTGTGCGCATGTTTTTGCGGGTCATCAACTCGCATGGCGAAAAGTCG
GTACGACTCTTCAACGCGCTGGTGGGCATTGCCAAGCCAAGCCACTGTGAGATGGACGCTCGTCTCACGGCAATG
AAGATGTTGTTTCGGCTCCGAGCCGACTGGGCCAACCGCATCTTTGCCACAGACGACCCCGAAAGCACCTTTCTT
GCGACCGCCATGTGCCGCACGGACGCTTCGTTTGCTAAGAAGCAAGCCGAAGAAGCTGCGCAGTCACTTCGCTTG
TCGCGGGGAGAGCACAGTCTTCAGTCACGGCCATCGCGTGGCATGTCTGTTGGCCAATCATCGATACCAGAAAGA
AACGCTGCCGCGCGCATGTCGACGGGTGCCAGGCCCCCTCAACAAAAATATCGACAGATCTGGAGTTATCCGGAC
CCAGAAGCCTTGCCCGAGGAAACACCGCAGCTAGTCAGCCCCGTCTTGCTATCATGCACATGTCACAAGGCCGGC
GACGAGCACTCATCCATGGACACAGGAGCAGCTCCATTTGCTCTCGAAATGTCACTCTGGTTCGAGACTGTCCTG
GCTGTACTGCAAGGGAGTAACTGGGAGGTTTACAGCTTCGTTTTGGTCCATCTCCCGTCGCAGCTGAGCAATCAC
GCTGTCTTTACCGAGGCTATAGCACAAGTCAAGGAGCTACGCAAGCTTATATGCGAGCAACTAAGGACCAAGTCG
TTCCAGGAGCCGCCCAATGCCTCGGGGCTCCGCCGAGCAGACGTGGCAATTTGCCTCTTTCACAGTCTGACCATG
ATTCTCAGCTACCATGAGCACTTCACCAAGAGCGACGAAGATGAGATAGTGCAAACCTTTGTCGCAGGCATGACC
ACATGGGAGCGTACTGCAAAGTACTGCATTCATGCCCTCTCGATATGTTGTCACGAGCTGCCGCTGTCCACCAGC
AAGTGTCTAATTCAGGTGCTGAATCAAATGGCTGCCATTATTACGCAGCCACATGTGTCTATTCACGTTCTCGAA
TTCCTCGCCTCTCTCAGCCGGCTGCATGATGTGTTTGTCAATTTTCGCGAGGACGACTTTAGGATTGTCTTTGGC
ATCTGCTTTCGCTATCTGGAATACGCGCGGGAAAAGAAACGCTCCAATCGCAGCAGCCATGCGAGCGAAGCTTCG
GCACCAACAACCCCGAGCTCGAATCCGATGGAAGCCTCGCAGGCAGGCACAGTTGACGATGTGCCGCAATATGTA
CACGCCTTGGCCTACCATGTCATCATGTTTTGGTTTTTGGCTCTCAAGCTGCAAGATCGTGCTCGACACGTGGGA
TGGATTGCCAAAAAACTCTTCCCCGACGATGGTAGCAATCAGGCTGCCGACGAACAGGCCATTACATCTATTGAC
TTTATGCAGCGTGTGACGTATGCTGATGTGGACGAATCGTCGGAAGATCCATACTTCAACGAAGCACGCTTCGGA
GCTATAATCAAGAAGCAGTGGCTTGTGGGCTACAGCATCATCACGATCAAACAGGCTACGGTTTCTGGTTGGGCC
CAGATCATCAAGCGACAGCCCTCGGGCACCTCGGCATACACTGTCCGTGAAACGTATACGCCGCCGCCGCCACAC
CAGACGGACACACCGGTTGATGTGAGCCGCGAGTGCCAGGCAACGTCGAATGCCATTCTACCAAGTCATCTGCTC
GTGCAGCTCATGGCCCCAGTCCCACAATACCCTGGGTCAGTAAGGCCGATTGCTCTGCCCGACGAAGATGCAACG
GCACGAGCGATTAGAATGTTTGACCTCAACTCGAGTCTGGATGGACACAAGGTGGGCGTGATATATATCGGAGAA
GGCCAAAAGACAGAGGCGGAAATCTTGGCCAATGTGTCGGGGAGCAGTGACTACGTCGAGTTCCTCAACAATCTG
GGAACTTTGACCAGACTCAAAGGGGCCACGTTTAACACGCAGGGGCTGGACCACAACATGGACTTGGATGGGCAG
TACACCTTTTGCTGGCGCGACCGAGTCACTGAGATTGTTTTCCATGTGACAACGCAGATGCCCACGAATCTGGAG
CGTGACGCACAATGTGTTCAAAAGAAGCGACACATTGGCAACGACTTTGTCAACATCATCTTCAATGACTCGGGT
CTTTCTTTTGACTTTGACACATTTCCTAGCGACTTCAACTCTGTCTATATTGTTATTACACCGGCATCGCGCGCC
TCGTTTGTGGCGTCTCGTGATGGTAAAGGTCAAGCACAGAGGCGGCCGTTCTACCGTGTCCAGGTCATGAGCAAG
CCAGGGTTTCCCGAGGTGTCGCCGGCGTCAGAGACCAAGATGATATCGCTCAAAGCATTGCCTGGCTTCGTACGG
CTTTTGGCACTCAACGCATCCATGTTTTCAGTGGTGTGGCACCGACGCGAGGTTGGCGAACACATCAGCTCATGG
AGTGCCAGACTAAGGGAGATTAAGCGGCTGCGAGAGAGACATGCTCCAAGAATGACGGCCAGCGCAGCCACGACA
GCCTCGCCTGCTGGCGGCGCTGCGCAAGGCCAGCAAGTTGATGCTGCTCGGCCCAGTGGCAGCGTCAGGGACAGT
TTGAACAGCCTTCGACGGACTAGTGTGGCTACCTTTTTGACGAGTACGACAGAACAGACGTCGCAGCGCTCGTCG
ACCCAATCAACGGTAGCAACGTCGGAAGCTGAACAGTCTCACTTGAGTGCAGTCAATTGGCTTGTCGAATTTGCC
GACTTTTCCAAATGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail