Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8031
Gene name
LocationContig_94:62937..63927
Strand+
Gene length (bp)990
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 9.1E-15 11 239

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8031
MPPLPPISLPRLILYYQTLHDQNGHHISLLPLLTQPSIAVTHVIVAAIHINHSPSELTLNDHPPNHARYHAVWAE
LRLLQASGIKVLAMLGGAAKGTYQRLDFPRPTDTHEPSIDRFQDFYPPLRDLLRHRGLDGIDLDVEEPMSLPGIM
RLIDRLRTDFGPDFIITMAPVATALVDVEKNLSGFDYEALEVMRGAQIAWYNTQFYCGWGDLHTGSTALYHLMLR
KGWPASKIVIGLVTNPDNGSGFVPWSLLHLLLTSINRSHAGAFGGVMGWEYFNSMPGGKAEPWQWAHHMSMLLRR
HALKSPHHSQSPDAPLPHDFDYYSDTCHQ*
Coding >OphauB2|8031
ATGCCTCCCCTCCCGCCCATCAGCCTGCCCCGTCTCATCCTCTACTACCAGACCCTCCACGACCAAAACGGCCAC
CACATTTCTCTGCTCCCGCTCCTCACCCAGCCCTCCATTGCCGTCACCCACGTCATCGTCGCCGCCATTCACATC
AACCACTCGCCCTCAGAACTCACCCTCAATGACCATCCGCCCAACCATGCCCGCTACCACGCCGTCTGGGCCGAG
CTCCGCCTCCTCCAGGCCTCGGGCATCAAGGTCCTGGCCATGCTGGGCGGCGCTGCCAAGGGCACCTACCAGCGC
CTCGACTTTCCCCGCCCGACAGACACCCACGAGCCCTCTATTGACCGCTTTCAAGACTTTTATCCTCCCCTGCGC
GATTTGCTGCGTCACCGCGGCCTCGATGGCATCGATCTCGACGTCGAGGAGCCCATGAGCCTCCCGGGCATCATG
CGCCTCATTGACCGCCTGCGCACTGATTTTGGCCCCGACTTCATCATCACAATGGCCCCCGTGGCCACAGCTCTT
GTCGATGTGGAAAAGAACCTGAGTGGCTTTGACTACGAGGCCCTCGAGGTAATGCGTGGTGCCCAAATAGCCTGG
TATAACACTCAGTTTTACTGCGGATGGGGAGATCTCCATACTGGCAGCACCGCATTGTACCACTTGATGCTTCGC
AAGGGCTGGCCCGCCTCCAAAATCGTCATTGGCCTCGTTACAAATCCAGACAATGGATCCGGCTTCGTTCCCTGG
TCTCTCCTCCACCTCCTCCTAACCTCCATCAACCGTTCTCATGCTGGCGCCTTTGGCGGTGTCATGGGCTGGGAG
TACTTCAACAGCATGCCCGGCGGCAAAGCCGAGCCCTGGCAATGGGCCCACCACATGTCCATGCTCTTGAGGAGA
CATGCCCTCAAGTCTCCCCATCATTCTCAATCTCCCGATGCTCCTCTCCCACATGACTTTGACTATTATTCTGAC
ACATGCCACCAGTGA
Transcript >OphauB2|8031
ATGCCTCCCCTCCCGCCCATCAGCCTGCCCCGTCTCATCCTCTACTACCAGACCCTCCACGACCAAAACGGCCAC
CACATTTCTCTGCTCCCGCTCCTCACCCAGCCCTCCATTGCCGTCACCCACGTCATCGTCGCCGCCATTCACATC
AACCACTCGCCCTCAGAACTCACCCTCAATGACCATCCGCCCAACCATGCCCGCTACCACGCCGTCTGGGCCGAG
CTCCGCCTCCTCCAGGCCTCGGGCATCAAGGTCCTGGCCATGCTGGGCGGCGCTGCCAAGGGCACCTACCAGCGC
CTCGACTTTCCCCGCCCGACAGACACCCACGAGCCCTCTATTGACCGCTTTCAAGACTTTTATCCTCCCCTGCGC
GATTTGCTGCGTCACCGCGGCCTCGATGGCATCGATCTCGACGTCGAGGAGCCCATGAGCCTCCCGGGCATCATG
CGCCTCATTGACCGCCTGCGCACTGATTTTGGCCCCGACTTCATCATCACAATGGCCCCCGTGGCCACAGCTCTT
GTCGATGTGGAAAAGAACCTGAGTGGCTTTGACTACGAGGCCCTCGAGGTAATGCGTGGTGCCCAAATAGCCTGG
TATAACACTCAGTTTTACTGCGGATGGGGAGATCTCCATACTGGCAGCACCGCATTGTACCACTTGATGCTTCGC
AAGGGCTGGCCCGCCTCCAAAATCGTCATTGGCCTCGTTACAAATCCAGACAATGGATCCGGCTTCGTTCCCTGG
TCTCTCCTCCACCTCCTCCTAACCTCCATCAACCGTTCTCATGCTGGCGCCTTTGGCGGTGTCATGGGCTGGGAG
TACTTCAACAGCATGCCCGGCGGCAAAGCCGAGCCCTGGCAATGGGCCCACCACATGTCCATGCTCTTGAGGAGA
CATGCCCTCAAGTCTCCCCATCATTCTCAATCTCCCGATGCTCCTCTCCCACATGACTTTGACTATTATTCTGAC
ACATGCCACCAGTGA
Gene >OphauB2|8031
ATGCCTCCCCTCCCGCCCATCAGCCTGCCCCGTCTCATCCTCTACTACCAGACCCTCCACGACCAAAACGGCCAC
CACATTTCTCTGCTCCCGCTCCTCACCCAGCCCTCCATTGCCGTCACCCACGTCATCGTCGCCGCCATTCACATC
AACCACTCGCCCTCAGAACTCACCCTCAATGACCATCCGCCCAACCATGCCCGCTACCACGCCGTCTGGGCCGAG
CTCCGCCTCCTCCAGGCCTCGGGCATCAAGGTCCTGGCCATGCTGGGCGGCGCTGCCAAGGGCACCTACCAGCGC
CTCGACTTTCCCCGCCCGACAGACACCCACGAGCCCTCTATTGACCGCTTTCAAGACTTTTATCCTCCCCTGCGC
GATTTGCTGCGTCACCGCGGCCTCGATGGCATCGATCTCGACGTCGAGGAGCCCATGAGCCTCCCGGGCATCATG
CGCCTCATTGACCGCCTGCGCACTGATTTTGGCCCCGACTTCATCATCACAATGGCCCCCGTGGCCACAGCTCTT
GTCGATGTGGAAAAGAACCTGAGTGGCTTTGACTACGAGGCCCTCGAGGTAATGCGTGGTGCCCAAATAGCCTGG
TATAACACTCAGTTTTACTGCGGATGGGGAGATCTCCATACTGGCAGCACCGCATTGTACCACTTGATGCTTCGC
AAGGGCTGGCCCGCCTCCAAAATCGTCATTGGCCTCGTTACAAATCCAGACAATGGATCCGGCTTCGTTCCCTGG
TCTCTCCTCCACCTCCTCCTAACCTCCATCAACCGTTCTCATGCTGGCGCCTTTGGCGGTGTCATGGGCTGGGAG
TACTTCAACAGCATGCCCGGCGGCAAAGCCGAGCCCTGGCAATGGGCCCACCACATGTCCATGCTCTTGAGGAGA
CATGCCCTCAAGTCTCCCCATCATTCTCAATCTCCCGATGCTCCTCTCCCACATGACTTTGACTATTATTCTGAC
ACATGCCACCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail