Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8027
Gene name
LocationContig_94:52701..54553
Strand+
Gene length (bp)1852
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.1E-18 76 230
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.0E-13 106 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 107 230 1.0E-13
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 122 242 2.0E-13
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 122 242 3.0E-13
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 72 230 8.0E-12
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 107 230 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 107 230 1.0E-13
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 122 242 2.0E-13
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 122 242 3.0E-13
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 72 230 8.0E-12
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 107 230 2.0E-11
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 101 246 3.0E-11
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 101 246 4.0E-11
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 112 231 5.0E-11
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 125 230 1.0E-10
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 125 230 1.0E-10
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 113 245 2.0E-10
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 122 246 2.0E-10
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 122 246 2.0E-10
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 112 231 4.0E-10
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 113 229 8.0E-10
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 112 231 8.0E-10
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 121 230 1.0E-09
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 113 230 2.0E-09
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 113 230 2.0E-09
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 107 252 4.0E-09
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 109 230 4.0E-09
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 114 230 7.0E-09
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 113 231 1.0E-08
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 33 231 1.0E-08
sp|A6NNS2|DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C OS=Homo sapiens GN=DHRS7C PE=2 SV=3 109 230 3.0E-08
sp|Q1RMJ5|DRS7C_BOVIN Dehydrogenase/reductase SDR family member 7C OS=Bos taurus GN=DHRS7C PE=2 SV=2 109 230 4.0E-08
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 107 228 4.0E-08
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 114 230 4.0E-08
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 110 239 1.0E-07
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 60 230 1.0E-07
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 109 230 1.0E-07
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 114 230 2.0E-07
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 114 227 4.0E-07
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 132 231 4.0E-07
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 132 231 4.0E-07
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 114 230 5.0E-07
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 110 257 7.0E-07
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 122 230 1.0E-06
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 73 227 1.0E-06
sp|Q5BL28|DS7CB_DANRE Dehydrogenase/reductase SDR family member 7C-B OS=Danio rerio GN=dhrs7cb PE=2 SV=1 107 229 1.0E-06
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 105 230 2.0E-06
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 114 227 2.0E-06
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 107 230 2.0E-06
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 128 230 2.0E-06
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 128 230 2.0E-06
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 114 243 5.0E-06
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 36 230 5.0E-06
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 114 243 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8027
MSAGTAVSPSTATHPSTRQSLPPLVFPTHNSPRTWLLTAALSPLAVRLIRRLLSHGDYVVACLPPHEIEHDERSA
EFRELIAECKSSRKDREGWKDRIRGIRCDGRMSSCGAAVAEAVQLFGAIDILLCCRSEAVVGTVEELSTTPVTQN
LVREQFEAIFFTQVNFIKAALPVLRSQHTGHIIILTSIGGHIGTPGMSMYTAATWALEGFCDSLAYEVAPFNIKL
TIVQPNKEIQSLTNRLIFAPQIPTYADIFNNAPSIRDMLINVLNTDSNTAVPQFPLPDPDATPSTPESTSLEPEK
GYGEIFSRYPKLPPGAADKLVNETVHALTAIGGHENPPSRHIVGTEGAIAVKEKLKTVTEEMEDFVDASLAVDIS
DSALREEARSSRKGDTTSPAAGISSGLG*
Coding >OphauB2|8027
ATGAGTGCAGGCACGGCAGTTTCGCCTTCCACGGCGACGCACCCGTCGACACGGCAGTCGTTGCCGCCTCTGGTA
TTCCCGACGCACAATTCGCCTCGAACATGGCTCCTCACGGCCGCCCTCTCGCCGCTGGCAGTGCGCCTCATTCGC
CGTCTGCTATCGCATGGAGACTACGTCGTCGCCTGCTTGCCACCACACGAGATTGAGCACGACGAGCGCAGTGCC
GAGTTTCGCGAGCTGATTGCCGAATGCAAGAGCTCGCGCAAGGATCGCGAGGGCTGGAAGGACCGTATCCGCGGC
ATTCGCTGCGATGGCCGCATGAGCTCATGCGGCGCCGCCGTGGCCGAGGCTGTCCAGCTCTTTGGAGCCATTGAC
ATTTTGCTGTGCTGCAGATCAGAAGCCGTGGTGGGGACCGTCGAGGAGCTCTCGACTACTCCTGTGACACAGAAC
CTAGTACGCGAGCAGTTCGAGGCCATCTTCTTTACCCAAGTCAACTTCATCAAGGCCGCGCTTCCCGTTCTTCGC
TCCCAGCACACGGGCCACATCATCATCCTCACCAGCATCGGCGGCCACATCGGCACCCCCGGCATGTCCATGTAC
ACGGCTGCCACGTGGGCTCTCGAGGGCTTTTGCGACTCTCTGGCTTACGAAGTTGCTCCCTTCAACATCAAACTC
ACCATTGTCCAGCCCAATAAAGAAATACAGTCCCTCACCAACCGCCTCATCTTTGCGCCCCAGATACCCACCTAT
GCCGACATCTTTAATAACGCGCCCAGCATTCGTGATATGCTCATAAACGTCTTGAACACGGATTCTAACACGGCT
GTACCTCAATTTCCTCTTCCTGACCCCGACGCCACGCCATCGACCCCTGAAAGCACCTCGCTCGAGCCTGAAAAG
GGCTACGGCGAGATCTTTTCCCGCTACCCGAAGCTTCCCCCAGGAGCGGCCGATAAACTGGTAAATGAGACGGTT
CACGCGCTCACGGCAATTGGTGGACACGAGAATCCTCCCTCGCGGCACATTGTCGGAACCGAAGGCGCCATTGCC
GTCAAGGAAAAGCTCAAGACGGTCACTGAAGAGATGGAGGATTTTGTTGATGCCAGCTTGGCAGTCGACATCTCT
GACAGCGCGCTTAGAGAAGAGGCGAGGAGTAGCAGAAAAGGAGACACCACGTCTCCAGCAGCTGGGATTTCGTCG
GGTCTTGGGTAG
Transcript >OphauB2|8027
ATGAGTGCAGGCACGGCAGTTTCGCCTTCCACGGCGACGCACCCGTCGACACGGCAGTCGTTGCCGCCTCTGGTA
TTCCCGACGCACAATTCGCCTCGAACATGGCTCCTCACGGCCGCCCTCTCGCCGCTGGCAGTGCGCCTCATTCGC
CGTCTGCTATCGCATGGAGACTACGTCGTCGCCTGCTTGCCACCACACGAGATTGAGCACGACGAGCGCAGTGCC
GAGTTTCGCGAGCTGATTGCCGAATGCAAGAGCTCGCGCAAGGATCGCGAGGGCTGGAAGGACCGTATCCGCGGC
ATTCGCTGCGATGGCCGCATGAGCTCATGCGGCGCCGCCGTGGCCGAGGCTGTCCAGCTCTTTGGAGCCATTGAC
ATTTTGCTGTGCTGCAGATCAGAAGCCGTGGTGGGGACCGTCGAGGAGCTCTCGACTACTCCTGTGACACAGAAC
CTAGTACGCGAGCAGTTCGAGGCCATCTTCTTTACCCAAGTCAACTTCATCAAGGCCGCGCTTCCCGTTCTTCGC
TCCCAGCACACGGGCCACATCATCATCCTCACCAGCATCGGCGGCCACATCGGCACCCCCGGCATGTCCATGTAC
ACGGCTGCCACGTGGGCTCTCGAGGGCTTTTGCGACTCTCTGGCTTACGAAGTTGCTCCCTTCAACATCAAACTC
ACCATTGTCCAGCCCAATAAAGAAATACAGTCCCTCACCAACCGCCTCATCTTTGCGCCCCAGATACCCACCTAT
GCCGACATCTTTAATAACGCGCCCAGCATTCGTGATATGCTCATAAACGTCTTGAACACGGATTCTAACACGGCT
GTACCTCAATTTCCTCTTCCTGACCCCGACGCCACGCCATCGACCCCTGAAAGCACCTCGCTCGAGCCTGAAAAG
GGCTACGGCGAGATCTTTTCCCGCTACCCGAAGCTTCCCCCAGGAGCGGCCGATAAACTGGTAAATGAGACGGTT
CACGCGCTCACGGCAATTGGTGGACACGAGAATCCTCCCTCGCGGCACATTGTCGGAACCGAAGGCGCCATTGCC
GTCAAGGAAAAGCTCAAGACGGTCACTGAAGAGATGGAGGATTTTGTTGATGCCAGCTTGGCAGTCGACATCTCT
GACAGCGCGCTTAGAGAAGAGGCGAGGAGTAGCAGAAAAGGAGACACCACGTCTCCAGCAGCTGGGATTTCGTCG
GGTCTTGGGTAG
Gene >OphauB2|8027
ATGAGGTGAGCAGCTCTTGTCATGGACACGCAATAGCGGAAAAAGCGCGAAACGACGTGAATGATGAACAAGACA
AGAAACGACAACGCCCCTCGAGCTCTAACAATTGCTACTAATTGCTAATGATTGCTTGCATGCGGCGGCAAGTGC
AGGCACGGCAGTTTCGCCTTCCACGGCGACGCACCCGTCGACACGGCAGTCGTTGCCGCCTCTGGTATTCCGTAT
GTTTCTCCCATTGCCCTGTTGCGCCTGGCCTGCTGCATTGCCCAAAACACAACCAGTCTTGTCCTGTTTAATGCC
TGTTTTTTGTCCTTGATCATGTCGATACGAAATTGGCCTTTTTGGTGTCTACTTCTACTTGGGCAGTAGCTCCAG
CGTCATTGGCCAGATCCTAAGGGATTGCTACATGGCGAGAAAAAAAAATGACGACTTGTGTCGCCCCTTTGAAAC
CTTGTTTCGCCCGGTCGCTACGCCAACTCTCGGCCGTTCCTCTTTTTGTCAGACCCTCTCTGCATCCGCCTTGCT
ACTCTTGCCCTTGCTAGAGATCCGTGGACAGCATGCCTAGGATGGCGATGGGCGCCGATTCATGACCCTCTGCGC
CAAACACTAGACGTCGTCATGGCAGATGCTGACAGTGCCTCTCAACCAAATGATAAAGCGACGCACAATTCGCCT
CGAACATGGCTCCTCACGGCCGCCCTCTCGCCGCTGGCAGTGCGCCTCATTCGCCGTCTGCTATCGCATGGAGAC
TACGTCGTCGCCTGCTTGCCACCACACGAGATTGAGCACGACGAGCGCAGTGCCGAGTTTCGCGAGCTGATTGCC
GAATGCAAGAGCTCGCGCAAGGATCGCGAGGGCTGGAAGGACCGTATCCGCGGCATTCGCTGCGATGGCCGCATG
AGCTCATGCGGCGCCGCCGTGGCCGAGGCTGTCCAGCTCTTTGGAGCCATTGACATTTTGCTGTGCTGCAGATCA
GAAGGTGGGCTTAGACACATGTTGGCGCTCGAGTTGCGCTCCAAGCTGATGGTGAAGCGACACAGCCGTGGTGGG
GACCGTCGAGGAGCTCTCGACTACTCCTGTGACACAGAACCTAGTACGCGAGCAGTTCGAGGCCATCTTCTTTAC
CCAAGTCAACTTCATCAAGGCCGCGCTTCCCGTTCTTCGCTCCCAGCACACGGGCCACATCATCATCCTCACCAG
CATCGGCGGCCACATCGGCACCCCCGGCATGTCCATGTACACGGCTGCCACGTGGGCTCTCGAGGGCTTTTGCGA
CTCTCTGGCTTACGAAGTTGCTCCCTTCAACATCAAACTCACCATTGTCCAGCCCAATAAAGAAATACAGTCCCT
CACCAACCGCCTCATCTTTGCGCCCCAGATACCCACCTATGCCGACATCTTTAATAACGCGCCCAGCATTCGTGA
TATGCTCATAAACGTCTTGAACACGGATTCTAACACGGCTGTACCTCAATTTCCTCTTCCTGACCCCGACGCCAC
GCCATCGACCCCTGAAAGCACCTCGCTCGAGCCTGAAAAGGGCTACGGCGAGATCTTTTCCCGCTACCCGAAGCT
TCCCCCAGGAGCGGCCGATAAACTGGTAAATGAGACGGTTCACGCGCTCACGGCAATTGGTGGACACGAGAATCC
TCCCTCGCGGCACATTGTCGGAACCGAAGGCGCCATTGCCGTCAAGGAAAAGCTCAAGACGGTCACTGAAGAGAT
GGAGGATTTTGTTGATGCCAGCTTGGCAGTCGACATCTCTGACAGCGCGCTTAGAGAAGAGGCGAGGAGTAGCAG
AAAAGGAGACACCACGTCTCCAGCAGCTGGGATTTCGTCGGGTCTTGGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail