Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8026
Gene name
LocationContig_94:48939..49770
Strand-
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00929 RNase_T Exonuclease 6.2E-10 3 158
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 2.7E-05 61 141

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 2 156 2.0E-11
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 11 160 3.0E-11
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 7 195 1.0E-10
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 4 159 2.0E-10
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 4 159 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 2 156 2.0E-11
sp|Q12090|REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX3 PE=1 SV=1 11 160 3.0E-11
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 7 195 1.0E-10
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 4 159 2.0E-10
sp|B2GUW6|AEN_RAT Apoptosis-enhancing nuclease OS=Rattus norvegicus GN=Aen PE=2 SV=1 4 159 3.0E-10
sp|Q6CFE7|REXO3_YARLI RNA exonuclease 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX3 PE=3 SV=1 11 165 4.0E-10
sp|Q5AL29|REXO3_CANAL RNA exonuclease 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX3 PE=3 SV=1 11 165 4.0E-10
sp|Q8L7M4|SDN5_ARATH Small RNA degrading nuclease 5 OS=Arabidopsis thaliana GN=SDN5 PE=2 SV=2 11 168 5.0E-10
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 23 164 8.0E-10
sp|Q10124|PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans GN=pqe-1 PE=3 SV=2 58 170 2.0E-09
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 3 177 3.0E-09
sp|Q4WYA1|REXO3_ASPFU RNA exonuclease 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex3 PE=3 SV=1 11 156 3.0E-09
sp|Q6FIU7|REXO3_CANGA RNA exonuclease 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX3 PE=3 SV=1 11 159 6.0E-09
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 10 160 2.0E-08
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 15 159 2.0E-08
sp|Q9FFG1|SDN2_ARATH Small RNA degrading nuclease 2 OS=Arabidopsis thaliana GN=SDN2 PE=2 SV=1 7 149 3.0E-08
sp|O94375|REXO4_SCHPO RNA exonuclease 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rex4 PE=3 SV=1 1 178 4.0E-08
sp|Q5B367|REXO3_EMENI RNA exonuclease 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rex3 PE=3 SV=2 11 156 6.0E-08
sp|Q750A5|REXO3_ASHGO RNA exonuclease 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX3 PE=3 SV=1 11 173 2.0E-07
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 3 156 3.0E-07
sp|Q4WHF8|REXO4_ASPFU RNA exonuclease 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rex4 PE=3 SV=1 11 156 3.0E-07
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 2 156 4.0E-07
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 15 159 7.0E-07
sp|Q6CJB5|REXO3_KLULA RNA exonuclease 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX3 PE=3 SV=1 1 173 9.0E-07
sp|Q8N1G1|REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens GN=REXO1 PE=1 SV=3 28 172 1.0E-06
sp|Q8IX06|GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens GN=REXO1L1P PE=5 SV=2 28 166 2.0E-06
sp|P48778|GOR_PANTR Exonuclease GOR OS=Pan troglodytes GN=REXO1L1 PE=2 SV=3 28 162 3.0E-06
sp|Q7TT28|REXO1_MOUSE RNA exonuclease 1 homolog OS=Mus musculus GN=Rexo1 PE=1 SV=1 23 172 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901360 organic cyclic compound metabolic process No
GO:0004518 nuclease activity No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0004527 exonuclease activity No
GO:0016787 hydrolase activity No
GO:0046483 heterocycle metabolic process No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8026
MAGGNGGQNLLIHVCAIDFLTGETLVQSLVYPRQMIRKWRTRCHGITRADMQEALAQNKALDGWQEARAELWKHM
DATTIVVGHAAHNDLEVLRIKHTRIVDTCILTSEAVCGEEEKLRHKYGLKDLCSSLCGVKIRGDELTGSDVHDSM
EDALATREVALWCLKHPDKLERWALYESEKHEPGFIAKLREQERRDCLEALGRCDSNRFMGWDDDSDDDWHDDWG
GDEYLGWQDFVLGEILGSRNESLREFLGSQDDPLGLFCGMSDSEVGWEEVG*
Coding >OphauB2|8026
ATGGCAGGAGGCAATGGCGGGCAAAATTTGCTGATACATGTGTGTGCCATTGACTTTCTGACGGGAGAGACGCTT
GTGCAATCACTCGTCTATCCGCGGCAGATGATCCGCAAGTGGCGTACAAGGTGCCATGGCATCACACGGGCGGAC
ATGCAGGAAGCTCTTGCGCAGAACAAGGCCTTGGATGGTTGGCAGGAGGCGCGAGCCGAGCTATGGAAGCACATG
GATGCAACGACGATTGTGGTGGGACATGCAGCACATAATGATCTTGAGGTGCTTCGCATCAAGCATACGAGGATA
GTGGACACATGTATCCTCACGTCGGAGGCCGTCTGTGGGGAGGAAGAGAAGCTGCGTCACAAGTACGGGCTCAAG
GACTTGTGCAGCAGTCTTTGCGGTGTCAAGATTCGAGGCGATGAGCTGACGGGCTCCGATGTGCACGACAGCATG
GAGGATGCTCTGGCAACGCGCGAGGTGGCGCTGTGGTGTTTGAAGCACCCTGATAAACTAGAGAGGTGGGCGTTA
TACGAAAGCGAGAAGCACGAGCCTGGGTTTATTGCCAAATTGAGAGAGCAAGAGCGGCGAGACTGTCTTGAAGCT
TTGGGCAGATGTGACAGCAACAGGTTTATGGGCTGGGATGACGACTCGGATGACGACTGGCATGACGACTGGGGG
GGTGACGAATACTTGGGATGGCAAGACTTTGTTCTCGGGGAGATTTTGGGATCGCGAAACGAAAGTCTGCGGGAA
TTTCTGGGCTCGCAAGATGACCCTCTGGGCCTATTTTGCGGAATGTCAGACAGCGAGGTTGGATGGGAGGAGGTG
GGTTGA
Transcript >OphauB2|8026
ATGGCAGGAGGCAATGGCGGGCAAAATTTGCTGATACATGTGTGTGCCATTGACTTTCTGACGGGAGAGACGCTT
GTGCAATCACTCGTCTATCCGCGGCAGATGATCCGCAAGTGGCGTACAAGGTGCCATGGCATCACACGGGCGGAC
ATGCAGGAAGCTCTTGCGCAGAACAAGGCCTTGGATGGTTGGCAGGAGGCGCGAGCCGAGCTATGGAAGCACATG
GATGCAACGACGATTGTGGTGGGACATGCAGCACATAATGATCTTGAGGTGCTTCGCATCAAGCATACGAGGATA
GTGGACACATGTATCCTCACGTCGGAGGCCGTCTGTGGGGAGGAAGAGAAGCTGCGTCACAAGTACGGGCTCAAG
GACTTGTGCAGCAGTCTTTGCGGTGTCAAGATTCGAGGCGATGAGCTGACGGGCTCCGATGTGCACGACAGCATG
GAGGATGCTCTGGCAACGCGCGAGGTGGCGCTGTGGTGTTTGAAGCACCCTGATAAACTAGAGAGGTGGGCGTTA
TACGAAAGCGAGAAGCACGAGCCTGGGTTTATTGCCAAATTGAGAGAGCAAGAGCGGCGAGACTGTCTTGAAGCT
TTGGGCAGATGTGACAGCAACAGGTTTATGGGCTGGGATGACGACTCGGATGACGACTGGCATGACGACTGGGGG
GGTGACGAATACTTGGGATGGCAAGACTTTGTTCTCGGGGAGATTTTGGGATCGCGAAACGAAAGTCTGCGGGAA
TTTCTGGGCTCGCAAGATGACCCTCTGGGCCTATTTTGCGGAATGTCAGACAGCGAGGTTGGATGGGAGGAGGTG
GGTTGA
Gene >OphauB2|8026
ATGGCAGGAGGCAATGGCGGGCAAAATTTGCTGATACATGTGTGTGCCATTGACTTTCTGACGGGAGAGACGCTT
GTGCAATCACTCGTCTATCCGCGGCAGATGATCCGCAAGTGGCGTACAAGGTGCCATGGCATCACACGGGCGGAC
ATGCAGGAAGCTCTTGCGCAGAACAAGGCCTTGGATGGTTGGCAGGAGGCGCGAGCCGAGCTATGGAAGCACATG
GATGCAACGACGATTGTGGTGGGACATGCAGCACATAATGATCTTGAGGTGCTTCGCATCAAGCATACGAGGATA
GTGGACACATGTATCCTCACGTCGGAGGCCGTCTGTGGGGAGGAAGAGAAGCTGCGTCACAAGTACGGGCTCAAG
GACTTGTGCAGCAGTCTTTGCGGTGTCAAGATTCGAGGCGATGAGCTGACGGGCTCCGATGTGCACGACAGCATG
GAGGATGCTCTGGCAACGCGCGAGGTGGCGCTGTGGTGTTTGAAGCACCCTGATAAACTAGAGAGGTGGGCGTTA
TACGAAAGCGAGAAGCACGAGCCTGGGTTTATTGCCAAATTGAGAGAGCAAGAGCGGCGAGACTGTCTTGAAGCT
TTGGGCAGATGTGACAGCAACAGGTTTATGGGCTGGGATGACGACTCGGATGACGACTGGCATGACGACTGGGGG
GGTGACGAATACTTGGGATGGCAAGACTTTGTTCTCGGGGAGATTTTGGGATCGCGAAACGAAAGTCTGCGGGAA
TTTCTGGGCTCGCAAGATGACCCTCTGGGCCTATTTTGCGGAATGTCAGACAGCGAGGTTGGATGGGAGGAGGTG
GGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail