Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8025
Gene name
LocationContig_94:46618..48359
Strand-
Gene length (bp)1741
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.3E-07 147 361
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.9E-06 6 34
PF00890 FAD_binding_2 FAD binding domain 6.9E-05 4 31

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 24 368 1.0E-30
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 3 407 3.0E-30
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 24 368 4.0E-26
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 16 405 6.0E-25
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 2 364 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 24 368 1.0E-30
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 3 407 3.0E-30
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 24 368 4.0E-26
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 16 405 6.0E-25
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 2 364 3.0E-22
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 22 405 9.0E-20
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 17 367 2.0E-19
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 2 359 3.0E-18
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 2 359 6.0E-18
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 103 405 4.0E-16
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 2 391 2.0E-13
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 2 391 5.0E-13
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 3 402 7.0E-13
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 2 369 3.0E-10
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 142 385 1.0E-09
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 27 328 2.0E-09
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 2 364 7.0E-09
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 1 326 7.0E-06
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 1 326 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0048037 cofactor binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8025
MVQVVIVGAGIAGLCSAISLRRAGHQVEVYESSWMKNEVGAAINVPPNAARFLMAWGLDPVEWSFVRSRRMTLLD
PFSLQFKMAITEEETARRVGGAELWYAHRVDLHTALRNMATRPDGPGTPVVMHLGMRVVGYDASTPSVTLKDGQQ
VRADLVIGADGLHSTASQEVLGYSNRPVAPIEANCCYRFLIPAETLQQDAETRFWNDDCQGWARLLPHNDSKRRL
VAYTCRNDTIHNFVGIFYDDNVHADMREDWQANIAVSDVLDRFSDYNPRLLKVIAKAKEAKKWPLLYRPPIPIWY
RSRLGLVGDAAHPMLPHLGQGGAQGLEDGLVMGIVMHGASSPQDIEERLAVYDKLRRNRASVVQILSNVGMDQAK
QVAQQLLPYLDSDKVPSDPLQVMRFTYGYNAVHDATQAMKEYDAAFELPQDFFQSEVVGVPSAD*
Coding >OphauB2|8025
ATGGTGCAAGTGGTGATTGTGGGCGCGGGCATTGCTGGGCTTTGCTCAGCCATTTCGCTTCGGCGAGCGGGCCAC
CAGGTCGAGGTGTATGAGAGCTCGTGGATGAAGAACGAAGTGGGCGCCGCCATCAATGTGCCGCCCAATGCTGCA
CGCTTCCTCATGGCCTGGGGCCTGGATCCGGTGGAGTGGAGTTTTGTGCGGTCGAGGCGCATGACGCTGCTTGAT
CCCTTTTCGCTGCAATTCAAAATGGCCATTACGGAGGAGGAGACGGCGCGTCGAGTTGGCGGCGCCGAGCTGTGG
TATGCGCATCGCGTCGACCTGCACACGGCGCTGAGAAACATGGCGACACGGCCAGACGGGCCTGGGACGCCCGTG
GTGATGCATCTTGGCATGCGAGTGGTGGGCTATGACGCCTCAACTCCATCAGTGACGCTCAAGGACGGCCAACAG
GTGCGAGCCGACTTGGTGATTGGAGCCGACGGATTGCACTCGACGGCCTCGCAAGAGGTGCTGGGCTACAGCAAC
AGGCCCGTGGCGCCCATTGAGGCCAACTGCTGCTACCGCTTCCTCATCCCCGCCGAGACGCTGCAGCAGGATGCC
GAGACGCGCTTCTGGAACGACGACTGCCAGGGCTGGGCGCGCCTGCTGCCGCACAATGACAGCAAGCGCAGGCTT
GTGGCCTATACATGCCGCAACGACACCATTCACAACTTTGTCGGCATCTTTTACGACGACAATGTCCATGCCGAC
ATGCGTGAAGACTGGCAGGCCAACATTGCCGTCTCGGACGTGCTTGACAGATTTTCCGACTACAATCCACGCCTG
CTCAAGGTGATTGCCAAGGCAAAGGAAGCCAAGAAATGGCCGCTCCTCTACCGTCCTCCAATTCCCATTTGGTAC
CGCAGCCGCCTGGGCCTGGTTGGCGACGCCGCTCACCCCATGCTGCCCCACCTGGGCCAAGGCGGCGCCCAGGGC
CTCGAGGACGGCCTCGTCATGGGCATCGTCATGCACGGCGCCTCGTCGCCCCAAGACATTGAGGAGCGCCTGGCA
GTCTATGACAAGCTTCGGCGCAATCGAGCTAGCGTAGTGCAGATCCTGAGCAACGTGGGCATGGACCAGGCCAAA
CAAGTCGCCCAACAGCTGCTGCCCTATCTAGACTCGGACAAGGTTCCGTCTGATCCACTCCAAGTCATGCGCTTC
ACCTATGGCTACAATGCTGTGCATGATGCCACCCAGGCCATGAAGGAATACGACGCTGCCTTTGAGCTGCCCCAA
GACTTTTTCCAGAGCGAGGTGGTGGGCGTCCCGTCTGCAGACTGA
Transcript >OphauB2|8025
ATGGTGCAAGTGGTGATTGTGGGCGCGGGCATTGCTGGGCTTTGCTCAGCCATTTCGCTTCGGCGAGCGGGCCAC
CAGGTCGAGGTGTATGAGAGCTCGTGGATGAAGAACGAAGTGGGCGCCGCCATCAATGTGCCGCCCAATGCTGCA
CGCTTCCTCATGGCCTGGGGCCTGGATCCGGTGGAGTGGAGTTTTGTGCGGTCGAGGCGCATGACGCTGCTTGAT
CCCTTTTCGCTGCAATTCAAAATGGCCATTACGGAGGAGGAGACGGCGCGTCGAGTTGGCGGCGCCGAGCTGTGG
TATGCGCATCGCGTCGACCTGCACACGGCGCTGAGAAACATGGCGACACGGCCAGACGGGCCTGGGACGCCCGTG
GTGATGCATCTTGGCATGCGAGTGGTGGGCTATGACGCCTCAACTCCATCAGTGACGCTCAAGGACGGCCAACAG
GTGCGAGCCGACTTGGTGATTGGAGCCGACGGATTGCACTCGACGGCCTCGCAAGAGGTGCTGGGCTACAGCAAC
AGGCCCGTGGCGCCCATTGAGGCCAACTGCTGCTACCGCTTCCTCATCCCCGCCGAGACGCTGCAGCAGGATGCC
GAGACGCGCTTCTGGAACGACGACTGCCAGGGCTGGGCGCGCCTGCTGCCGCACAATGACAGCAAGCGCAGGCTT
GTGGCCTATACATGCCGCAACGACACCATTCACAACTTTGTCGGCATCTTTTACGACGACAATGTCCATGCCGAC
ATGCGTGAAGACTGGCAGGCCAACATTGCCGTCTCGGACGTGCTTGACAGATTTTCCGACTACAATCCACGCCTG
CTCAAGGTGATTGCCAAGGCAAAGGAAGCCAAGAAATGGCCGCTCCTCTACCGTCCTCCAATTCCCATTTGGTAC
CGCAGCCGCCTGGGCCTGGTTGGCGACGCCGCTCACCCCATGCTGCCCCACCTGGGCCAAGGCGGCGCCCAGGGC
CTCGAGGACGGCCTCGTCATGGGCATCGTCATGCACGGCGCCTCGTCGCCCCAAGACATTGAGGAGCGCCTGGCA
GTCTATGACAAGCTTCGGCGCAATCGAGCTAGCGTAGTGCAGATCCTGAGCAACGTGGGCATGGACCAGGCCAAA
CAAGTCGCCCAACAGCTGCTGCCCTATCTAGACTCGGACAAGGTTCCGTCTGATCCACTCCAAGTCATGCGCTTC
ACCTATGGCTACAATGCTGTGCATGATGCCACCCAGGCCATGAAGGAATACGACGCTGCCTTTGAGCTGCCCCAA
GACTTTTTCCAGAGCGAGGTGGTGGGCGTCCCGTCTGCAGACTGA
Gene >OphauB2|8025
ATGGTGCAAGTGGTGATTGTGGGCGCGGGCATTGCTGGGCTTTGCTCAGCCATTTCGCTTCGGCGAGCGGGCCAC
CAGGTCGAGGTGTATGAGAGCTCGTGGATGAAGAACGAAGTGGGCGCCGCCATCAATGTGCCGCCCAATGCTGCA
CGCTTCCTCATGGCCTGGGGCCTGGATCCGGTGGAGTGGAGTTTTGTGCGGTCGAGGCGCATGACGCTGCTTGAT
CCCTTTTCGCTGCAATTCAAAATGGCCATTACGGAGGAGGAGACGGCGCGTCGAGTTGGCGGCGCCGAGCTGTGG
TATGCGCATCGCGTCGACCTGCACACGGCGCTGAGAAACATGGCGACACGGCCAGACGGGCCTGGGACGCCCGTG
GTGATGCATCTTGGCATGCGAGTGGTGGGCTATGTGGGTAGTCTTTTTCTCGGGCTGGTCTAGACGGCAGCTGGT
CTAGACGGCAGCTGGTCTAGACGGCAGCTGACATGACGACGGCTTTTTACAGGACGCCTCAACTCCATCAGTGAC
GCTCAAGGACGGCCAACAGGTGCGAGCCGACTTGGTGATTGGAGCCGACGGATTGCACTCGACGGCCTCGCAAGA
GGTGCTGGGCTACAGCAACAGGCCCGTGGCGCCCATTGAGGCCAACTGCTGCTACCGCTTCCTCATCCCCGCCGA
GACGCTGCAGCAGGATGCCGAGACGCGCTTCTGGAACGACGACTGCCAGGGCTGGGCGCGCCTGCTGCCGCACAA
TGACAGCAAGCGCAGGCTTGTGGCCTATACATGCCGCAAGTGGGTTGAATCTGGCCCTGAGCAGCCGCCCGTCTG
TGCCTGGGCTGACGCGGCGTAGCGACACCATTCACAACTTTGTCGGCATCTTTTACGACGACAATGTCCATGCCG
ACATGCGTGAAGGTGAGCTCCAAGTCCCTCTCTGCTATCCCTCTCTGCTCCCTCTCTGCTATCCCTCAGCTGACC
CGGCCTCTAGACTGGCAGGCCAACATTGCCGTCTCGGACGTGCTTGACAGATTTTCCGACTACAATCCACGCCTG
CTCAAGGTGATTGCGTATGCCGCTGCTCCCCTCTTGCTCTTGTGCCACCCGCTCCATGGCGCGGCTGACGTGCCG
CCCACAGCAAGGCAAAGGAAGCCAAGAAATGGCCGCTCCTCTACCGTCCTCCAATTCCCATTTGGTACCGCAGCC
GCCTGGGCCTGGTTGGCGACGCCGCTCACCCCATGCTGCCCCGTTTGTCCCTCGCCCAGCCCCTGTCCTCGCCGC
CCCCAAAACTGACTTGTGCAATGCAGACCTGGGCCAAGGCGGCGCCCAGGGCCTCGAGGACGGCCTCGTCATGGG
CATCGTCATGCACGGCGCCTCGTCGCCCCAAGACATTGAGGAGCGCCTGGCAGTCTATGACAAGCTTCGGCGCAA
TCGAGCTAGCGTAGTGCAGATCCTGAGCAACGTGGGCATGGACCAGGCCAAACAAGTCGCCCAACAGCTGCTGCC
CTATCTAGACTCGGACAAGGTTCCGTGTAAGTTTTGCACACGTCTTTGTCACGCCCTGAGACTAATCAGACTTGC
TTTGTCTCTCTTTTTGCTAGCTGATCCACTCCAAGTCATGCGCTTCACCTATGGCTACAATGCTGTGCATGATGC
CACCCAGGCCATGAAGGAATACGACGCTGCCTTTGAGCTGCCCCAAGACTTTTTCCAGAGCGAGGTGGTGGGCGT
CCCGTCTGCAGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail