Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8024
Gene name
LocationContig_94:37248..43781
Strand-
Gene length (bp)6533
Transcript length (bp)5541
Coding sequence length (bp)5541
Protein length (aa) 1847

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00698 Acyl_transf_1 Acyl transferase domain 9.3E-46 617 932
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 8.2E-26 8 148
PF00975 Thioesterase Thioesterase domain 9.1E-25 1602 1839
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 5.7E-13 250 338
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 6.7E-07 342 382
PF14765 PS-DH Polyketide synthase dehydratase 1.3E-19 1030 1306
PF00550 PP-binding Phosphopantetheine attachment site 1.1E-11 1373 1436
PF00550 PP-binding Phosphopantetheine attachment site 1.2E-05 1493 1554
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 6.7E-16 390 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 237 1845 0.0E+00
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 259 1845 0.0E+00
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 221 1450 0.0E+00
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 233 975 3.0E-69
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 257 1053 2.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 237 1845 0.0E+00
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 259 1845 0.0E+00
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 221 1450 0.0E+00
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 233 975 3.0E-69
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 257 1053 2.0E-64
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 257 1053 2.0E-64
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 257 1053 2.0E-64
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 257 1053 2.0E-64
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 261 1054 2.0E-64
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 257 1053 3.0E-64
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 257 893 8.0E-63
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 257 893 8.0E-63
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 227 1054 1.0E-62
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 233 979 8.0E-62
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 261 1054 3.0E-61
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 237 971 4.0E-60
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 261 1224 2.0E-59
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 229 1125 3.0E-59
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 229 1125 3.0E-59
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 229 1125 3.0E-59
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 260 1269 7.0E-59
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 255 968 2.0E-58
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 228 1130 1.0E-56
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 237 983 2.0E-56
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 228 1130 3.0E-56
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 260 915 1.0E-55
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 260 915 2.0E-55
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 261 1109 3.0E-55
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 260 915 9.0E-55
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 260 969 2.0E-52
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 260 967 4.0E-52
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 261 1109 1.0E-51
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 255 1224 2.0E-51
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 227 969 3.0E-51
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 237 893 3.0E-51
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 237 893 3.0E-51
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 260 1239 4.0E-51
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 237 893 4.0E-51
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 260 1239 4.0E-51
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 259 968 2.0E-50
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 260 967 2.0E-50
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 261 974 3.0E-50
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 260 1323 3.0E-50
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 260 967 2.0E-49
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 242 968 4.0E-49
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 260 967 5.0E-49
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 227 893 3.0E-47
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 260 1271 3.0E-47
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 261 1239 1.0E-46
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1475 1845 4.0E-46
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 261 1095 5.0E-46
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 227 1105 7.0E-46
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 260 1271 8.0E-46
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 260 1065 9.0E-46
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 260 978 4.0E-45
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 261 969 3.0E-44
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 261 969 3.0E-44
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 261 969 3.0E-44
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 260 967 9.0E-44
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 260 967 1.0E-43
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 261 1315 4.0E-43
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 261 940 2.0E-41
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 260 973 6.0E-41
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 260 1052 4.0E-40
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 261 967 6.0E-40
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 260 973 9.0E-40
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 261 1002 2.0E-39
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 261 967 2.0E-39
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 260 967 4.0E-39
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 260 1065 1.0E-38
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 247 941 2.0E-37
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 261 893 4.0E-37
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 261 967 6.0E-37
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 261 893 5.0E-36
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 261 967 8.0E-36
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 261 893 1.0E-35
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 261 974 3.0E-35
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 261 893 5.0E-35
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 247 941 2.0E-34
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 247 941 8.0E-33
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 247 921 3.0E-32
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 237 605 7.0E-32
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 247 941 4.0E-31
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 238 595 1.0E-30
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 261 620 1.0E-30
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 142 596 3.0E-30
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 258 613 1.0E-29
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 260 514 1.0E-28
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 536 1054 5.0E-28
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 261 590 1.0E-27
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 261 595 4.0E-27
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 261 590 6.0E-26
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 261 610 8.0E-26
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 242 699 3.0E-25
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 615 921 5.0E-25
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 259 590 1.0E-23
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 617 904 3.0E-22
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 570 941 7.0E-22
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 247 475 2.0E-21
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 261 596 3.0E-20
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 595 1047 1.0E-19
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 237 464 2.0E-18
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 613 901 2.0E-18
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 261 595 1.0E-16
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 615 919 4.0E-15
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 613 901 6.0E-14
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 613 901 6.0E-14
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 613 901 1.0E-13
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 613 901 1.0E-13
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 613 901 1.0E-13
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 613 901 2.0E-13
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 613 901 2.0E-13
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 615 856 2.0E-12
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 617 914 2.0E-11
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 617 914 2.0E-11
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 617 914 5.0E-11
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 617 914 9.0E-11
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1583 1699 1.0E-10
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 355 514 7.0E-10
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 615 969 7.0E-10
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 615 899 1.0E-09
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 237 465 1.0E-08
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1517 1700 1.0E-08
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 615 841 1.0E-08
sp|O13698|FABD_SCHPO Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mct1 PE=3 SV=1 618 828 2.0E-08
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 617 901 2.0E-08
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 615 854 3.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 237 465 6.0E-08
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 617 783 7.0E-08
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 355 458 1.0E-07
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 355 458 1.0E-07
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 355 458 1.0E-07
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 355 458 2.0E-07
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 355 458 2.0E-07
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 355 458 2.0E-07
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 355 458 2.0E-07
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1482 1700 2.0E-07
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 613 841 3.0E-07
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 355 466 4.0E-07
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 355 466 4.0E-07
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1506 1701 9.0E-07
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1504 1685 1.0E-06
sp|Q89AH0|FABD_BUCBP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabD PE=3 SV=1 676 808 2.0E-06
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1504 1685 4.0E-06
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1504 1685 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8024
MPLNVFTNRLSDTHAFFAHFCREDKPGVLAANFIQQASLALQDEILAASRAQHGPLPPCFRSLKQLSDQHRAAPI
KHVGVESALTCAAQLCHYIDRVEKEAPDADRHLVGFGIGLLAATAAASASSPAALLSQAIDAVVMAFRVGSLYSF
PWLAVDEAEQRLASFHESRGVPVASQAHRLGSEGEPILRCEEDARLAWPVVSSDGPMMLSSATMLAKELNPVLGS
HGATGKAKLAILLTQGRDVHRGVPSDRFSMAHPGAFDPRFFNMSPREALQTDPMQRLALVTAYEALETAGFTSDD
WREINAAQDIDTYYITGGIRAFGPGRINYFFGFSGPSVNAGECDTALFLSRKGPCATFDDAADGYCRADACASVV
VKRLDDALADGDAVLAVVLGSATNHSAEAVSITHPHGPTQSALSSAILDDAGVDALDVDYVEMHGTGTQAGDSTE
MLSDRPLFLGSVKSNHNMIPPHIGIKPGSAINSGARPLARSDGKPRRIFINNFSAAGGNTGLLLQDAPARPSAAL
HDARQHHVVSVTAKSKAALVRNAQRLAAFMAQNPDTPLAHIAYTTTARRMQHNWRIAVSASSLEEARQAIETRAA
DANGLVAASSKPSAIPFLFTGQGSVYAGMGKQLYSQHSVFRDALADFERIAKIHSLPSFIAHVIDDSSQETSPVV
TQLALCCFQMALVRLWASWGVKPSLVMGHSLGEYAALNAAGVLSASDTIYLVGERARLVVAKCEPGTHAMLAVRS
PVVSVVDVLAKAALSAKVTVTCINSPQETVLGGKIDHVSAAADKLGEACIKSTQLRVPFAFHSDQVDPILHHLEA
KAGVVTWSTAQVPIVSPLLGRQVEQGELNASYLRDHARKPVNFLGALLSAQTVASVDERAQWIEIGPHAVCVNMA
KAALGSSTLAVPSARRNESTHKVLSNTLAVLHERGISFDWNEFHRESASASSLVDLPAYSFDEKNYWIEYKGDWT
LTRKANGIAKAPVAEKPKLSTTSVHGITSEEIRGDVAVVETHTNLSRPDTTPLAMGHLCNGAPLCPASVYADMAM
TVADYAYRQLRPEAPRPGLDVANLQIPHALVFDETLDAHVLRCSVEANASAGEAHVTFFSIQPHGKRVDHATCMV
YYGNLDHWTAEFDRMSFLVKARMDALLAPEMASQVSRLGRKLTYKLFSNLVEYESRYQGMSQVYLNSGSCEAAAD
LVFQTSPEDGDFLFSPYWIDSCAHLSGFILNGTDAVDSRNQVFVSHGWESLKFLESLKQTKKYQAYTRMQPIKDT
KLMQGNVYVFDGDRLVGVASGVRFQAIPRKVLDLLLPPRNASASSRKQSSALASSSRPPRPILAPRSVSFKESKE
IPVRGRNVTNRDNPQGSLVTNFVNLIQVETGCDIDDLTDNADFASLGCDSLMILTVTGKMREELELDISSRAFAD
HPTLGQFKAYLDTLDKGVGRALASPVSALSRSPSLVDCTGALSDDSASVSTPASSVNGDKSFDLRSIVRSTIASE
MEIDLDEIIAAPDLQSLGLDSLMGLNILGCLREVTGMTIPNDLFTSCASLQGVERSLGLDLDKKPSAPVPAAAQQ
PVLSSYLPHRKATSVLLQGNQRTATRNLFMVPDGSGSATSYSAMDQIAPDWAVWGLFCPFLKTPSEYTCGIPGAA
VKFIEEMKRRQPVGPYALAGWSVGGAIAFEIATQLVRGGDEVTHLVLIDAPCPLIMDPLPTNLPAWFAQQGLLGD
DANNAAGKNMPSWLLPHFDASTQALADYQPTPLAQEKCPNVMAIWCEDGVCKTPSDPRPDPYPTGHALFLLDNRS
DFGPNQWDTLLDGSRFQTRHMPGNHFTMMRGDLAKKLTTFVREALV*
Coding >OphauB2|8024
ATGCCTCTCAACGTCTTCACCAACCGTCTATCAGACACACACGCCTTCTTTGCCCACTTTTGCCGAGAGGACAAG
CCCGGTGTCTTGGCTGCCAACTTTATTCAGCAGGCAAGCCTCGCTCTTCAGGATGAAATCCTCGCCGCCTCGAGG
GCACAACACGGGCCCCTGCCACCCTGTTTTCGAAGCCTCAAACAGCTCAGCGACCAACACCGTGCCGCGCCCATT
AAGCATGTCGGGGTTGAGAGTGCGCTGACGTGCGCCGCTCAGCTGTGCCATTATATTGACCGCGTGGAAAAAGAA
GCACCAGATGCCGACCGACACCTCGTTGGCTTCGGCATCGGCCTCTTGGCCGCCACGGCCGCCGCCTCTGCATCC
TCTCCAGCAGCCCTGCTCAGCCAGGCCATTGACGCCGTGGTCATGGCCTTTCGTGTGGGCTCTCTTTATTCTTTC
CCATGGCTTGCCGTCGACGAGGCCGAGCAGCGTCTGGCCTCGTTCCACGAGTCAAGGGGCGTGCCAGTGGCAAGC
CAGGCCCATAGGCTGGGTAGCGAGGGTGAGCCGATTTTGCGGTGCGAGGAAGACGCTCGCCTGGCTTGGCCCGTG
GTGTCATCGGATGGGCCCATGATGCTGAGCAGCGCAACAATGCTGGCCAAGGAGCTCAATCCCGTGCTGGGCAGC
CACGGGGCCACGGGCAAGGCCAAGCTGGCCATTCTCCTCACCCAGGGCCGAGACGTGCACCGGGGCGTGCCCTCG
GACCGCTTCTCCATGGCGCACCCCGGAGCGTTTGACCCGCGCTTCTTCAACATGTCGCCGCGCGAGGCGCTGCAG
ACGGATCCCATGCAGCGGCTGGCGCTGGTGACGGCATATGAGGCGCTCGAGACGGCCGGCTTCACGTCGGACGAT
TGGCGCGAGATCAACGCGGCGCAGGACATTGACACCTACTACATCACGGGCGGCATCCGTGCCTTTGGGCCTGGG
CGCATCAACTACTTCTTTGGCTTCAGTGGGCCCAGCGTCAACGCAGGCGAGTGCGATACGGCGCTGTTTCTGTCG
CGCAAGGGGCCCTGTGCCACCTTTGACGATGCCGCCGACGGCTACTGCCGCGCCGATGCCTGTGCCTCCGTCGTC
GTCAAGCGCCTCGACGATGCCCTGGCCGATGGCGATGCCGTGCTGGCCGTGGTGCTCGGCTCTGCCACCAACCAC
TCCGCCGAGGCCGTGTCCATTACCCATCCGCACGGCCCCACCCAGTCGGCTCTGTCGTCCGCCATTCTCGACGAT
GCCGGCGTCGATGCGCTCGATGTTGACTATGTCGAGATGCACGGCACTGGCACCCAGGCCGGCGACAGCACCGAA
ATGCTGTCCGACCGGCCCCTGTTCCTCGGCTCCGTCAAATCAAACCACAACATGATTCCGCCTCACATTGGCATC
AAGCCCGGCTCTGCCATCAACTCTGGCGCCCGGCCCCTTGCGCGCTCCGATGGCAAGCCGCGGCGCATCTTCATC
AACAACTTTAGCGCAGCCGGCGGCAACACGGGCCTGTTGCTCCAAGACGCACCTGCGCGCCCCTCTGCTGCCCTC
CACGACGCCCGCCAGCACCATGTCGTCAGCGTCACCGCCAAGTCAAAGGCGGCTCTTGTCCGCAATGCCCAGAGG
CTGGCGGCCTTTATGGCTCAGAACCCAGACACGCCCCTGGCCCACATCGCCTACACCACCACTGCACGCCGTATG
CAACACAACTGGCGCATTGCCGTGTCGGCCTCGAGCCTCGAGGAAGCAAGACAGGCCATTGAGACGAGAGCAGCC
GACGCCAATGGCCTCGTCGCGGCGTCGTCCAAGCCCTCAGCCATCCCCTTTCTCTTCACCGGCCAGGGCTCTGTT
TATGCTGGAATGGGCAAGCAGCTCTATTCCCAGCACTCCGTCTTCCGTGACGCCCTGGCCGACTTTGAACGCATT
GCCAAAATCCACAGTCTGCCCTCCTTCATCGCCCACGTCATTGACGACAGCAGCCAGGAGACGTCTCCCGTCGTC
ACTCAGCTTGCCCTCTGCTGCTTCCAAATGGCCCTTGTCCGGCTCTGGGCATCTTGGGGCGTCAAGCCCAGTCTA
GTCATGGGACACTCTCTTGGCGAGTATGCTGCCCTCAATGCTGCCGGCGTCCTCTCAGCCAGCGACACCATCTAC
CTGGTGGGTGAGCGTGCCCGCCTCGTCGTTGCCAAGTGTGAGCCCGGCACCCATGCCATGCTCGCTGTCAGGAGT
CCCGTCGTGTCTGTCGTCGATGTGCTGGCCAAGGCTGCCTTGAGTGCCAAGGTGACCGTCACATGCATCAACAGC
CCTCAGGAGACAGTCCTTGGAGGTAAAATTGACCATGTTTCTGCCGCTGCCGACAAGCTAGGCGAGGCGTGTATC
AAGTCTACGCAGCTGCGCGTGCCATTTGCCTTTCACTCTGACCAAGTTGATCCCATCCTCCACCACCTCGAGGCC
AAGGCTGGAGTCGTCACCTGGTCGACTGCCCAGGTCCCCATCGTCTCTCCGCTTTTGGGACGCCAGGTGGAACAA
GGCGAACTCAACGCCTCCTACCTGCGAGACCACGCCCGCAAGCCCGTTAACTTTCTGGGCGCCCTCCTCTCGGCC
CAGACAGTTGCCAGTGTTGACGAGCGCGCCCAGTGGATCGAGATTGGCCCCCACGCCGTCTGTGTCAACATGGCA
AAGGCTGCTCTTGGCTCCTCGACCCTCGCTGTGCCCTCGGCTCGCCGCAACGAGTCCACCCACAAGGTGCTGAGC
AACACCTTGGCCGTCTTGCACGAGCGAGGCATCAGCTTTGACTGGAACGAGTTTCACCGCGAGTCTGCCAGCGCC
AGTAGCCTCGTTGACCTTCCCGCCTACTCGTTCGATGAAAAGAACTATTGGATTGAGTACAAGGGCGACTGGACG
CTGACAAGAAAGGCCAATGGTATTGCCAAAGCCCCCGTTGCCGAGAAGCCCAAGCTTTCCACCACATCGGTTCAC
GGCATCACCTCTGAGGAGATTCGAGGAGACGTCGCCGTCGTTGAGACTCACACCAATCTCTCTCGACCCGACACG
ACGCCTCTGGCCATGGGCCACTTGTGCAACGGAGCCCCCCTCTGTCCCGCATCCGTCTACGCCGACATGGCAATG
ACAGTGGCCGACTATGCCTATCGCCAGCTGAGGCCCGAAGCCCCCCGCCCCGGTCTCGACGTGGCCAATCTGCAA
ATTCCTCATGCCCTCGTCTTTGATGAGACGCTCGACGCCCACGTCTTGCGCTGCTCGGTCGAGGCCAATGCCTCT
GCTGGCGAAGCTCACGTCACCTTCTTCAGCATCCAGCCCCATGGCAAGAGAGTCGATCACGCCACCTGTATGGTC
TACTATGGCAATCTTGACCACTGGACTGCCGAGTTTGACCGCATGAGCTTCCTTGTCAAGGCGCGCATGGACGCC
CTCTTGGCCCCCGAAATGGCCAGCCAAGTCTCCCGACTCGGCCGCAAGCTGACTTATAAGCTGTTTTCCAACCTC
GTCGAGTACGAGAGCCGCTACCAAGGCATGAGCCAAGTCTATCTGAATAGCGGCTCCTGTGAGGCTGCCGCAGAC
CTCGTCTTCCAAACCAGCCCAGAGGACGGCGACTTTCTCTTCAGCCCCTACTGGATCGACAGCTGTGCCCATCTT
TCTGGCTTCATCCTCAATGGAACCGACGCCGTCGATTCCCGGAACCAAGTCTTTGTCTCGCACGGCTGGGAGTCG
CTCAAATTCCTCGAATCCTTGAAGCAAACGAAAAAGTACCAAGCATACACGAGAATGCAACCCATCAAGGACACC
AAGTTGATGCAGGGCAACGTCTACGTCTTTGATGGCGATCGTCTAGTCGGTGTTGCTAGTGGTGTCAGGTTCCAG
GCAATCCCTCGCAAGGTGCTTGATTTGTTGCTGCCGCCACGCAACGCTAGCGCCAGTTCTCGCAAGCAAAGCTCA
GCCCTGGCTTCATCGTCTCGGCCGCCCCGACCAATCTTGGCACCTCGAAGCGTAAGCTTCAAGGAGAGCAAGGAG
ATTCCAGTGCGCGGACGCAATGTCACCAATAGAGACAACCCCCAAGGCTCTCTCGTCACCAACTTTGTCAACTTG
ATTCAAGTGGAGACTGGGTGCGACATTGATGACCTGACAGACAATGCCGACTTTGCCAGCCTTGGCTGCGATTCC
CTCATGATCCTGACCGTCACTGGCAAGATGCGCGAAGAGCTGGAGCTGGACATCAGCTCTCGAGCTTTCGCCGAT
CATCCTACTCTGGGACAGTTCAAGGCCTATCTAGACACCCTTGACAAGGGAGTCGGCCGTGCCCTGGCTTCGCCC
GTCTCGGCCCTTTCTCGCAGTCCCTCCTTGGTTGACTGCACCGGGGCTCTGTCTGACGACTCGGCAAGCGTCTCG
ACTCCCGCGTCTTCTGTGAATGGGGACAAGTCGTTTGACTTGCGCTCCATTGTTCGCTCAACCATTGCCTCTGAG
ATGGAGATTGATCTTGATGAGATTATTGCCGCTCCTGACCTGCAGTCGCTGGGGCTTGACTCGCTCATGGGACTC
AACATCCTCGGCTGCCTTCGAGAGGTCACTGGCATGACCATCCCAAACGACCTCTTCACCTCTTGTGCTTCGCTG
CAGGGCGTTGAGCGGTCTCTGGGTCTTGACCTGGACAAGAAGCCGTCTGCCCCCGTGCCCGCCGCCGCACAGCAG
CCAGTCTTGTCCAGTTATCTGCCTCACCGCAAAGCAACATCAGTTCTGCTGCAAGGCAACCAGCGCACGGCGACG
AGAAATCTCTTCATGGTGCCCGATGGCAGCGGCAGCGCCACGTCGTATTCCGCCATGGATCAGATTGCTCCCGAC
TGGGCAGTCTGGGGCTTGTTCTGCCCCTTCTTGAAGACCCCTAGCGAGTATACATGCGGCATTCCTGGCGCGGCT
GTCAAGTTCATTGAGGAGATGAAGCGTCGTCAGCCAGTTGGCCCTTATGCCTTGGCTGGGTGGTCCGTCGGAGGC
GCCATTGCCTTTGAAATTGCCACGCAATTGGTGCGAGGCGGCGACGAGGTGACTCACCTCGTTCTTATTGATGCG
CCCTGCCCTCTCATCATGGACCCTTTGCCCACCAACTTGCCCGCCTGGTTCGCCCAGCAGGGCCTCTTGGGCGAT
GACGCAAACAATGCGGCTGGCAAAAACATGCCCAGCTGGCTGCTGCCGCACTTTGACGCCAGTACACAGGCTCTG
GCCGACTACCAGCCCACGCCGCTTGCTCAGGAAAAGTGTCCCAACGTCATGGCTATTTGGTGCGAGGACGGTGTT
TGCAAGACGCCCTCCGACCCTCGGCCCGATCCCTACCCTACAGGCCACGCCCTCTTTCTCTTGGACAACCGCTCC
GACTTTGGCCCTAACCAATGGGACACACTGCTTGACGGTTCTCGCTTCCAGACGAGACACATGCCTGGCAATCAT
TTCACCATGATGCGCGGAGATTTGGCCAAAAAATTGACTACTTTTGTCCGTGAAGCTCTTGTATAA
Transcript >OphauB2|8024
ATGCCTCTCAACGTCTTCACCAACCGTCTATCAGACACACACGCCTTCTTTGCCCACTTTTGCCGAGAGGACAAG
CCCGGTGTCTTGGCTGCCAACTTTATTCAGCAGGCAAGCCTCGCTCTTCAGGATGAAATCCTCGCCGCCTCGAGG
GCACAACACGGGCCCCTGCCACCCTGTTTTCGAAGCCTCAAACAGCTCAGCGACCAACACCGTGCCGCGCCCATT
AAGCATGTCGGGGTTGAGAGTGCGCTGACGTGCGCCGCTCAGCTGTGCCATTATATTGACCGCGTGGAAAAAGAA
GCACCAGATGCCGACCGACACCTCGTTGGCTTCGGCATCGGCCTCTTGGCCGCCACGGCCGCCGCCTCTGCATCC
TCTCCAGCAGCCCTGCTCAGCCAGGCCATTGACGCCGTGGTCATGGCCTTTCGTGTGGGCTCTCTTTATTCTTTC
CCATGGCTTGCCGTCGACGAGGCCGAGCAGCGTCTGGCCTCGTTCCACGAGTCAAGGGGCGTGCCAGTGGCAAGC
CAGGCCCATAGGCTGGGTAGCGAGGGTGAGCCGATTTTGCGGTGCGAGGAAGACGCTCGCCTGGCTTGGCCCGTG
GTGTCATCGGATGGGCCCATGATGCTGAGCAGCGCAACAATGCTGGCCAAGGAGCTCAATCCCGTGCTGGGCAGC
CACGGGGCCACGGGCAAGGCCAAGCTGGCCATTCTCCTCACCCAGGGCCGAGACGTGCACCGGGGCGTGCCCTCG
GACCGCTTCTCCATGGCGCACCCCGGAGCGTTTGACCCGCGCTTCTTCAACATGTCGCCGCGCGAGGCGCTGCAG
ACGGATCCCATGCAGCGGCTGGCGCTGGTGACGGCATATGAGGCGCTCGAGACGGCCGGCTTCACGTCGGACGAT
TGGCGCGAGATCAACGCGGCGCAGGACATTGACACCTACTACATCACGGGCGGCATCCGTGCCTTTGGGCCTGGG
CGCATCAACTACTTCTTTGGCTTCAGTGGGCCCAGCGTCAACGCAGGCGAGTGCGATACGGCGCTGTTTCTGTCG
CGCAAGGGGCCCTGTGCCACCTTTGACGATGCCGCCGACGGCTACTGCCGCGCCGATGCCTGTGCCTCCGTCGTC
GTCAAGCGCCTCGACGATGCCCTGGCCGATGGCGATGCCGTGCTGGCCGTGGTGCTCGGCTCTGCCACCAACCAC
TCCGCCGAGGCCGTGTCCATTACCCATCCGCACGGCCCCACCCAGTCGGCTCTGTCGTCCGCCATTCTCGACGAT
GCCGGCGTCGATGCGCTCGATGTTGACTATGTCGAGATGCACGGCACTGGCACCCAGGCCGGCGACAGCACCGAA
ATGCTGTCCGACCGGCCCCTGTTCCTCGGCTCCGTCAAATCAAACCACAACATGATTCCGCCTCACATTGGCATC
AAGCCCGGCTCTGCCATCAACTCTGGCGCCCGGCCCCTTGCGCGCTCCGATGGCAAGCCGCGGCGCATCTTCATC
AACAACTTTAGCGCAGCCGGCGGCAACACGGGCCTGTTGCTCCAAGACGCACCTGCGCGCCCCTCTGCTGCCCTC
CACGACGCCCGCCAGCACCATGTCGTCAGCGTCACCGCCAAGTCAAAGGCGGCTCTTGTCCGCAATGCCCAGAGG
CTGGCGGCCTTTATGGCTCAGAACCCAGACACGCCCCTGGCCCACATCGCCTACACCACCACTGCACGCCGTATG
CAACACAACTGGCGCATTGCCGTGTCGGCCTCGAGCCTCGAGGAAGCAAGACAGGCCATTGAGACGAGAGCAGCC
GACGCCAATGGCCTCGTCGCGGCGTCGTCCAAGCCCTCAGCCATCCCCTTTCTCTTCACCGGCCAGGGCTCTGTT
TATGCTGGAATGGGCAAGCAGCTCTATTCCCAGCACTCCGTCTTCCGTGACGCCCTGGCCGACTTTGAACGCATT
GCCAAAATCCACAGTCTGCCCTCCTTCATCGCCCACGTCATTGACGACAGCAGCCAGGAGACGTCTCCCGTCGTC
ACTCAGCTTGCCCTCTGCTGCTTCCAAATGGCCCTTGTCCGGCTCTGGGCATCTTGGGGCGTCAAGCCCAGTCTA
GTCATGGGACACTCTCTTGGCGAGTATGCTGCCCTCAATGCTGCCGGCGTCCTCTCAGCCAGCGACACCATCTAC
CTGGTGGGTGAGCGTGCCCGCCTCGTCGTTGCCAAGTGTGAGCCCGGCACCCATGCCATGCTCGCTGTCAGGAGT
CCCGTCGTGTCTGTCGTCGATGTGCTGGCCAAGGCTGCCTTGAGTGCCAAGGTGACCGTCACATGCATCAACAGC
CCTCAGGAGACAGTCCTTGGAGGTAAAATTGACCATGTTTCTGCCGCTGCCGACAAGCTAGGCGAGGCGTGTATC
AAGTCTACGCAGCTGCGCGTGCCATTTGCCTTTCACTCTGACCAAGTTGATCCCATCCTCCACCACCTCGAGGCC
AAGGCTGGAGTCGTCACCTGGTCGACTGCCCAGGTCCCCATCGTCTCTCCGCTTTTGGGACGCCAGGTGGAACAA
GGCGAACTCAACGCCTCCTACCTGCGAGACCACGCCCGCAAGCCCGTTAACTTTCTGGGCGCCCTCCTCTCGGCC
CAGACAGTTGCCAGTGTTGACGAGCGCGCCCAGTGGATCGAGATTGGCCCCCACGCCGTCTGTGTCAACATGGCA
AAGGCTGCTCTTGGCTCCTCGACCCTCGCTGTGCCCTCGGCTCGCCGCAACGAGTCCACCCACAAGGTGCTGAGC
AACACCTTGGCCGTCTTGCACGAGCGAGGCATCAGCTTTGACTGGAACGAGTTTCACCGCGAGTCTGCCAGCGCC
AGTAGCCTCGTTGACCTTCCCGCCTACTCGTTCGATGAAAAGAACTATTGGATTGAGTACAAGGGCGACTGGACG
CTGACAAGAAAGGCCAATGGTATTGCCAAAGCCCCCGTTGCCGAGAAGCCCAAGCTTTCCACCACATCGGTTCAC
GGCATCACCTCTGAGGAGATTCGAGGAGACGTCGCCGTCGTTGAGACTCACACCAATCTCTCTCGACCCGACACG
ACGCCTCTGGCCATGGGCCACTTGTGCAACGGAGCCCCCCTCTGTCCCGCATCCGTCTACGCCGACATGGCAATG
ACAGTGGCCGACTATGCCTATCGCCAGCTGAGGCCCGAAGCCCCCCGCCCCGGTCTCGACGTGGCCAATCTGCAA
ATTCCTCATGCCCTCGTCTTTGATGAGACGCTCGACGCCCACGTCTTGCGCTGCTCGGTCGAGGCCAATGCCTCT
GCTGGCGAAGCTCACGTCACCTTCTTCAGCATCCAGCCCCATGGCAAGAGAGTCGATCACGCCACCTGTATGGTC
TACTATGGCAATCTTGACCACTGGACTGCCGAGTTTGACCGCATGAGCTTCCTTGTCAAGGCGCGCATGGACGCC
CTCTTGGCCCCCGAAATGGCCAGCCAAGTCTCCCGACTCGGCCGCAAGCTGACTTATAAGCTGTTTTCCAACCTC
GTCGAGTACGAGAGCCGCTACCAAGGCATGAGCCAAGTCTATCTGAATAGCGGCTCCTGTGAGGCTGCCGCAGAC
CTCGTCTTCCAAACCAGCCCAGAGGACGGCGACTTTCTCTTCAGCCCCTACTGGATCGACAGCTGTGCCCATCTT
TCTGGCTTCATCCTCAATGGAACCGACGCCGTCGATTCCCGGAACCAAGTCTTTGTCTCGCACGGCTGGGAGTCG
CTCAAATTCCTCGAATCCTTGAAGCAAACGAAAAAGTACCAAGCATACACGAGAATGCAACCCATCAAGGACACC
AAGTTGATGCAGGGCAACGTCTACGTCTTTGATGGCGATCGTCTAGTCGGTGTTGCTAGTGGTGTCAGGTTCCAG
GCAATCCCTCGCAAGGTGCTTGATTTGTTGCTGCCGCCACGCAACGCTAGCGCCAGTTCTCGCAAGCAAAGCTCA
GCCCTGGCTTCATCGTCTCGGCCGCCCCGACCAATCTTGGCACCTCGAAGCGTAAGCTTCAAGGAGAGCAAGGAG
ATTCCAGTGCGCGGACGCAATGTCACCAATAGAGACAACCCCCAAGGCTCTCTCGTCACCAACTTTGTCAACTTG
ATTCAAGTGGAGACTGGGTGCGACATTGATGACCTGACAGACAATGCCGACTTTGCCAGCCTTGGCTGCGATTCC
CTCATGATCCTGACCGTCACTGGCAAGATGCGCGAAGAGCTGGAGCTGGACATCAGCTCTCGAGCTTTCGCCGAT
CATCCTACTCTGGGACAGTTCAAGGCCTATCTAGACACCCTTGACAAGGGAGTCGGCCGTGCCCTGGCTTCGCCC
GTCTCGGCCCTTTCTCGCAGTCCCTCCTTGGTTGACTGCACCGGGGCTCTGTCTGACGACTCGGCAAGCGTCTCG
ACTCCCGCGTCTTCTGTGAATGGGGACAAGTCGTTTGACTTGCGCTCCATTGTTCGCTCAACCATTGCCTCTGAG
ATGGAGATTGATCTTGATGAGATTATTGCCGCTCCTGACCTGCAGTCGCTGGGGCTTGACTCGCTCATGGGACTC
AACATCCTCGGCTGCCTTCGAGAGGTCACTGGCATGACCATCCCAAACGACCTCTTCACCTCTTGTGCTTCGCTG
CAGGGCGTTGAGCGGTCTCTGGGTCTTGACCTGGACAAGAAGCCGTCTGCCCCCGTGCCCGCCGCCGCACAGCAG
CCAGTCTTGTCCAGTTATCTGCCTCACCGCAAAGCAACATCAGTTCTGCTGCAAGGCAACCAGCGCACGGCGACG
AGAAATCTCTTCATGGTGCCCGATGGCAGCGGCAGCGCCACGTCGTATTCCGCCATGGATCAGATTGCTCCCGAC
TGGGCAGTCTGGGGCTTGTTCTGCCCCTTCTTGAAGACCCCTAGCGAGTATACATGCGGCATTCCTGGCGCGGCT
GTCAAGTTCATTGAGGAGATGAAGCGTCGTCAGCCAGTTGGCCCTTATGCCTTGGCTGGGTGGTCCGTCGGAGGC
GCCATTGCCTTTGAAATTGCCACGCAATTGGTGCGAGGCGGCGACGAGGTGACTCACCTCGTTCTTATTGATGCG
CCCTGCCCTCTCATCATGGACCCTTTGCCCACCAACTTGCCCGCCTGGTTCGCCCAGCAGGGCCTCTTGGGCGAT
GACGCAAACAATGCGGCTGGCAAAAACATGCCCAGCTGGCTGCTGCCGCACTTTGACGCCAGTACACAGGCTCTG
GCCGACTACCAGCCCACGCCGCTTGCTCAGGAAAAGTGTCCCAACGTCATGGCTATTTGGTGCGAGGACGGTGTT
TGCAAGACGCCCTCCGACCCTCGGCCCGATCCCTACCCTACAGGCCACGCCCTCTTTCTCTTGGACAACCGCTCC
GACTTTGGCCCTAACCAATGGGACACACTGCTTGACGGTTCTCGCTTCCAGACGAGACACATGCCTGGCAATCAT
TTCACCATGATGCGCGGAGATTTGGCCAAAAAATTGACTACTTTTGTCCGTGAAGCTCTTGTATAA
Gene >OphauB2|8024
ATGCCTCTCAACGTCTTCACCAACCGTCTATCAGACACACACGCCTTCTTTGCCCACTTTTGCCGAGAGGACAAG
CCCGGTGTCTTGGCTGCCAACTTTATTCAGCAGGCAAGCCTCGCTCTTCAGGATGAAATCCTCGCCGCCTCGAGG
GCACAACACGGGCCCCTGCCACCCTGTTTTCGAAGCCTCAAACAGCTCAGCGACCAACACCGTGCCGCGCCCATT
AAGCATGTCGGGGTTGAGAGTGCGCTGACGTGCGCCGCTCAGCTGTGCCATTATATTGAGTGAGTCTCTGCAAGC
CCTTGTTGTTTTCTTTTGCCCCCTTTTTTTTTCCTTGTCCTAGAAAACATTTCCTCTTGCTAACCAAATTTTTTT
TTTCCAACAGCCGCGTGGAAAAAGAAGCACCAGATGCCGACCGACACCTCGTTGGCTTCGGCATCGGCCTCTTGG
CCGCCACGGCCGCCGCCTCTGCATCCTCTCCAGCAGCCCTGCTCAGCCAGGCCATTGACGCCGTGGTCATGGCCT
TTCGTGTGGGCTCTCTTGTCGGCGCCTCTGCCAGCCAGCTTTGGGCCCCCGAGGGCGCCTCAGAGAGCTGGCAGT
ATTCTTTCCCATGGCTTGCCGTCGACGAGGCCGAGCAGCGTCTGGCCTCGTTCCACGAGTCAAGGGGCGTGCCAG
TGGCAAGCCAGGCCCATGTCAGCTGCGTACTACCTCGTGGCGTCGAGGTCTCGGGTCCGCCGCCTGTGATGCGCC
GCTTGGTGGCAGAGCAGAGGCTGGGTAGCGAGGGTGAGCCGGTTGGTGTATACGGCCCGTTCCATGCTGGCCATT
TGCACGCCGACGCGGCTTTGGACAAGATTTTGCGGTGCGAGGAAGACGCTCGCCTGGCTTGGCCCGTGGTGTCAT
CGGATGGGGTGTGGGCGGCGGGAAGCCAAGCACGCGTGGTGTTTGAGGCTGCTGTCGTTGAGTGTTTGCAAAAGC
CCATGATGCTGAGCAGTATTGTGGAAAGGTGCCGTCAAGAGGCCCCTGGGCAGCCCATTGTTGCCCACGGCGCGA
GCTCAGGCGCAACAATGCTGGCCAAGGAGCTCAATGTGGCCCTCAAGCAGCCAGTGGCCCCTCTTGCTCTGCCGC
ACTCTCAGCCCGTGCTGGGCAGCCACGGGGCCACGGGCAAGGCCAAGCTGGCCATTGTGGGCATGGCAGGCCGCT
TCCCCGACGCCGACGACACCAATGAGCTCTGGCAGCTCCTCACCCAGGGCCGAGACGTGCACCGGGGCGTGCCCT
CGGACCGCTTCTCCATGGCGCACGTCGACGCCACGGCAAAGGCCACCAACACGACTTACACGCCCTACGGCTGCT
GGATGCGGCAGCCCGGAGCGTTTGACCCGCGCTTCTTCAACATGTCGCCGCGCGAGGCGCTGCAGACGGATCCCA
TGCAGCGGCTGGCGCTGGTGACGGCATATGAGGCGCTCGAGACGGCCGGCTTCGTGCCCGGGCGCACGCCATCGT
CCATGCCGGACCGCGTGGGCACCTTTTACGGCCAGACGTCGGACGATTGGCGCGAGATCAACGCGGCGCAGGACA
TTGACACCTACTACATCACGGGCGGCATCCGTGCCTTTGGGCCTGGGCGCATCAACTACTTCTTTGGCTTCAGTG
GGCCCAGCGTCAACGTCGACACGGCCTGCTCCTCGAGCGGCGCCGCTCTGCAGCTGGCCTGTTCTGCGCTTCAGG
CAGGCGAGTGCGATACGGCGCTGGTGGGCGGCCTGTCGGTGCTGTCCAACCCCGACCTGTTTAGCGGACTGAGCC
GCGGCCAGTTTCTGTCGCGCAAGGGGCCCTGTGCCACCTTTGACGATGCCGCCGACGGCTACTGCCGCGCCGATG
CCTGTGCCTCCGTCGTCGTCAAGCGCCTCGACGATGCCCTGGCCGATGGCGATGCCGTGCTGGCCGTGGTGCTCG
GCTCTGCCACCAACCACTCCGCCGAGGCCGTGTCCATTACCCATCCGCACGGCCCCACCCAGTCGGCTCTGTCGT
CCGCCATTCTCGACGATGCCGGCGTCGATGCGCTCGATGTTGACTATGTCGAGATGCACGGCACTGGCACCCAGG
CCGGCGACAGCACCGAAATGCTGTCCGTCACCAATGTCTTTGCCCCGGCTGACCCTCATCGCCGGCGGCCTCAGG
ACCGGCCCCTGTTCCTCGGCTCCGTCAAATCAAACGTCGGCCACGGCGAGGCCGCCTCGGGCGTCACAGCCCTCG
TCAAGGTGCTCCTGATGATGCAGCACAACATGATTCCGCCTCACATTGGCATCAAGCCCGGCTCTGCCATCAACT
CGTCCTTCCCCAAGGATCTGGCCGCGCGCAACGTCCACATTGCCTCCAGTGGCGCCCGGCCCCTTGCGCGCTCCG
ATGGCAAGCCGCGGCGCATCTTCATCAACAACTTTAGCGCAGCCGGCGGCAACACGGGCCTGTTGCTCCAAGACG
CACCTGCGCGCCCCTCTGCTGCCCTCCACGACGCCCGCCAGCACCATGTCGTCAGCGTCACCGCCAAGTCAAAGG
CGGCTCTTGTCCGCAATGCCCAGAGGCTGGCGGCCTTTATGGCTCAGAACCCAGACACGCCCCTGGCCCACATCG
CCTACACCACCACTGCACGCCGTATGCAACACAACTGGCGCATTGCCGTGTCGGCCTCGAGCCTCGAGGAAGCAA
GACAGGCCATTGAGACGAGAGCAGCCGACGCCAATGGCCTCGTCGCGGCGTCGTCCAAGCCCTCAGCCATCCCCT
TTCTCTTCACCGGCCAGGGCTCTGTTTATGCTGGAATGGGCAAGCAGCTCTATTCCCAGCACTCCGTCTTCCGTG
ACGCCCTGGCCGACTTTGAACGCATTGCCAAAATCCACAGTCTGCCCTCCTTCATCGCCCACGTCATTGACGACA
GCAGCCAGGAGACGTCTCCCGTCGTCACTCAGCTTGCCCTCTGCTGCTTCCAAATGGCCCTTGTCCGGCTCTGGG
CATCTTGGGGCGTCAAGCCCAGTCTAGTCATGGGACACTCTCTTGGCGAGTATGCTGCCCTCAATGCTGCCGGCG
TCCTCTCAGCCAGCGACACCATCTACCTGGTGGGTGAGCGTGCCCGCCTCGTCGTTGCCAAGTGTGAGCCCGGCA
CCCATGCCATGCTCGCTGTCAGGAGTCCCGTCGTGTCTGTCGTCGATGTGCTGGCCAAGGCTGCCTTGAGTGCCA
AGGTGACCGTCACATGCATCAACAGCCCTCAGGAGACAGTCCTTGGAGGTAAAATTGACCATGTTTCTGCCGCTG
CCGACAAGCTAGGCGAGGCGTGTATCAAGTCTACGCAGCTGCGCGTGCCATTTGCCTTTCACTCTGACCAAGTTG
ATCCCATCCTCCACCACCTCGAGGCCAAGGCTGGAGTCGTCACCTGGTCGACTGCCCAGGTCCCCATCGTCTCTC
CGCTTTTGGGACGCCAGGTGGAACAAGGCGAACTCAACGCCTCCTACCTGCGAGACCACGCCCGCAAGCCCGTTA
ACTTTCTGGGCGCCCTCCTCTCGGCCCAGACAGTTGCCAGTGTTGACGAGCGCGCCCAGTGGATCGAGATTGGCC
CCCACGCCGTCTGTGTCAACATGGCAAAGGCTGCTCTTGGCTCCTCGACCCTCGCTGTGCCCTCGGCTCGCCGCA
ACGAGTCCACCCACAAGGTGCTGAGCAACACCTTGGCCGTCTTGCACGAGCGAGGCATCAGCTTTGACTGGAACG
AGTTTCACCGCGAGTCTGCCAGCGCCAGTAGCCTCGTTGACCTTCCCGCCTACTCGTTCGATGAAAAGAACTATT
GGATTGAGTACAAGGGCGACTGGACGCTGACAAGAAAGGCCAATGGTATTGCCAAAGCCCCCGTTGCCGAGAAGC
CCAAGCTTTCCACCACATCGGTTCACGGCATCACCTCTGAGGAGATTCGAGGAGACGTCGCCGTCGTTGAGACTC
ACACCAATCTCTCTCGACCCGACACGACGCCTCTGGCCATGGGCCACTTGTGCAACGGAGCCCCCCTCTGTCCCG
CATCCGTCTACGCCGACATGGCAATGACAGTGGCCGACTATGCCTATCGCCAGCTGAGGCCCGAAGCCCCCCGCC
CCGGTCTCGACGTGGCCAATCTGCAAATTCCTCATGCCCTCGTCTTTGATGAGACGCTCGACGCCCACGTCTTGC
GCTGCTCGGTCGAGGCCAATGCCTCTGCTGGCGAAGCTCACGTCACCTTCTTCAGCATCCAGCCCCATGGCAAGA
GAGTCGATCACGCCACCTGTATGGTCTACTATGGCAATCTTGACCACTGGACTGCCGAGTTTGACCGCATGAGCT
TCCTTGTCAAGGCGCGCATGGACGCCCTCTTGGCCCCCGAAATGGCCAGCCAAGTCTCCCGACTCGGCCGCAAGC
TGACTTATAAGCTGTTTTCCAACCTCGTCGAGTACGAGAGCCGCTACCAAGGCATGAGCCAAGTCTATCTGAATA
GCGGCTCCTGTGAGGCTGCCGCAGACCTCGTCTTCCAAACCAGCCCAGAGGACGGCGACTTTCTCTTCAGCCCCT
ACTGGATCGACAGCTGTGCCCATCTTTCTGGCTTCATCCTCAATGGAACCGACGCCGTCGATTCCCGGAACCAAG
TCTTTGTCTCGCACGGCTGGGAGTCGCTCAAATTCCTCGAATCCTTGAAGCAAACGAAAAAGTACCAAGCATACA
CGAGAATGCAACCCATCAAGGACACCAAGTTGATGCAGGGCAACGTCTACGTCTTTGATGGCGATCGTCTAGTCG
GTGTTGCTAGTGGTGTCAGGTTCCAGGCAATCCCTCGCAAGGTGCTTGATTTGTTGCTGCCGCCACGCAACGCTA
GCGCCAGTTCTCGCAAGCAAAGCTCAGCCCTGGCTTCATCGTCTCGGCCGCCCCGACCAATCTTGGCACCTCGAA
GCGTAAGCTTCAAGGAGAGCAAGGAGATTCCAGTGCGCGGACGCAATGTCACCAATAGAGACAACCCCCAAGGCT
CTCTCGTCACCAACTTTGTCAACTTGATTCAAGTGGAGACTGGGTGCGACATTGATGACCTGACAGACAATGCCG
ACTTTGCCAGCCTTGGCTGCGATTCCCTCATGATCCTGACCGTCACTGGCAAGATGCGCGAAGAGCTGGAGCTGG
ACATCAGCTCTCGAGCTTTCGCCGATCATCCTACTCTGGGACAGTTCAAGGCCTATCTAGACACCCTTGACAAGG
GAGTCGGCCGTGCCCTGGCTTCGCCCGTCTCGGCCCTTTCTCGCAGTCCCTCCTTGGTTGACTGCACCGGGGCTC
TGTCTGACGACTCGGCAAGCGTCTCGACTCCCGCGTCTTCTGTGAATGGGGACAAGTCGTTTGACTTGCGCTCCA
TTGTTCGCTCAACCATTGCCTCTGAGATGGAGATTGATCTTGATGAGATTATTGCCGCTCCTGACCTGCAGTCGC
TGGGGCTTGACTCGCTCATGGGACTCAACATCCTCGGCTGCCTTCGAGAGGTCACTGGCATGACCATCCCAAACG
ACCTCTTCACCTCTTGTGCTTCGCTGCAGGGCGTTGAGCGGTCTCTGGGTCTTGACCTGGACAAGAAGCCGTCTG
CCCCCGTGCCCGCCGCCGCACAGCAGCCAGTCTTGTCCAGTTATCTGCCTCACCGCAAAGCAACATCAGTTCTGC
TGCAAGGCAACCAGCGCACGGCGACGAGAAATCTCTTCATGGTGCCCGATGGCAGCGGCAGCGCCACGTCGTATT
CCGCCATGGATCAGATTGCTCCCGACTGGGCAGTCTGGGGCTTGTTCTGCCCCTTCTTGAAGACCCCTAGCGAGT
ATACATGCGGCATTCCTGGCGCGGCTGTCAAGTTCATTGAGGAGATGAAGCGTCGTCAGCCAGTTGGCCCTTATG
CCTTGGCTGGGTGGTCCGTCGGAGGCGCCATTGCCTTTGAAATTGCCACGCAATTGGTGCGAGGCGGCGACGAGG
TGACTCACCTCGTTCTTATTGATGCGCCCTGCCCTCTCATCATGGACCCTTTGCCCACCAACTTGCCCGCCTGGT
TCGCCCAGCAGGGCCTCTTGGGCGATGACGCAAACAATGCGGCTGGCAAAAACATGCCCAGCTGGCTGCTGCCGC
ACTTTGACGCCAGTACACAGGCTCTGGCCGACTACCAGCCCACGCCGCTTGCTCAGGAAAAGTGTCCCAACGTCA
TGGCTATTTGGTGCGAGGACGGTGTTTGCAAGACGCCCTCCGACCCTCGGCCCGATCCCTACCCTACAGGCCACG
CCCTCTTTCTCTTGGACAACCGCTCCGACTTTGGCCCTAACCAATGGGACACACTGCTTGACGGTTCTCGCTTCC
AGACGAGACACATGCCTGGCAATCATTTCACCATGATGCGCGGAGATTTGGTAAGCAGCTCTATCCAATACTTGT
TTCCTCTTAGCTTTGAGCCTTGGCTAACCTTTTCATGTCAGGCCAAAAAATTGACTACTTTTGTCCGTGAAGCTC
TTGTATAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail