Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8020
Gene name
LocationContig_94:30656..31427
Strand-
Gene length (bp)771
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13774 Longin Regulated-SNARE-like domain 1.4E-27 37 117
PF00957 Synaptobrevin Synaptobrevin 9.0E-15 133 213

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 1 216 7.0E-85
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 1 216 4.0E-77
sp|Q74ZD2|SEC22_ASHGO Protein transport protein SEC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC22 PE=3 SV=2 1 216 2.0E-69
sp|Q6CJA0|SEC22_KLULA Protein transport protein SEC22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC22 PE=3 SV=1 1 215 3.0E-66
sp|P22214|SEC22_YEAST Protein transport protein SEC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC22 PE=1 SV=1 1 215 4.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 1 216 7.0E-85
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 1 216 4.0E-77
sp|Q74ZD2|SEC22_ASHGO Protein transport protein SEC22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC22 PE=3 SV=2 1 216 2.0E-69
sp|Q6CJA0|SEC22_KLULA Protein transport protein SEC22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC22 PE=3 SV=1 1 215 3.0E-66
sp|P22214|SEC22_YEAST Protein transport protein SEC22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC22 PE=1 SV=1 1 215 4.0E-66
sp|Q6FWT0|SEC22_CANGA Protein transport protein SEC22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC22 PE=3 SV=1 1 200 7.0E-62
sp|Q6P7L4|SC22B_XENTR Vesicle-trafficking protein SEC22b OS=Xenopus tropicalis GN=sec22b PE=2 SV=1 1 216 6.0E-48
sp|Q4KM74|SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus GN=Sec22b PE=1 SV=3 1 216 3.0E-47
sp|Q5RAI9|SC22B_PONAB Vesicle-trafficking protein SEC22b OS=Pongo abelii GN=SEC22B PE=2 SV=3 1 216 3.0E-47
sp|O08547|SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus GN=Sec22b PE=1 SV=3 1 216 3.0E-47
sp|Q7SXP0|S22BB_DANRE Vesicle-trafficking protein SEC22b-B OS=Danio rerio GN=sec22bb PE=2 SV=1 1 216 6.0E-47
sp|Q5ZJW4|SC22B_CHICK Vesicle-trafficking protein SEC22b OS=Gallus gallus GN=SEC22B PE=2 SV=1 1 216 4.0E-46
sp|O08595|SC22B_CRIGR Vesicle-trafficking protein SEC22b OS=Cricetulus griseus GN=Sec22b PE=1 SV=3 1 216 4.0E-46
sp|Q94AU2|SEC22_ARATH 25.3 kDa vesicle transport protein OS=Arabidopsis thaliana GN=SEC22 PE=2 SV=1 1 210 1.0E-45
sp|Q7ZV15|S22BA_DANRE Vesicle-trafficking protein SEC22b-A OS=Danio rerio GN=sec22ba PE=2 SV=1 1 216 9.0E-45
sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens GN=SEC22B PE=1 SV=4 1 216 4.0E-44
sp|Q8BH47|SC22A_MOUSE Vesicle-trafficking protein SEC22a OS=Mus musculus GN=Sec22a PE=2 SV=1 1 141 2.0E-19
sp|Q642F4|SC22A_RAT Vesicle-trafficking protein SEC22a OS=Rattus norvegicus GN=Sec22a PE=2 SV=1 1 141 3.0E-19
sp|Q96IW7|SC22A_HUMAN Vesicle-trafficking protein SEC22a OS=Homo sapiens GN=SEC22A PE=1 SV=1 1 144 8.0E-19
sp|Q4R866|SC22A_MACFA Vesicle-trafficking protein SEC22a OS=Macaca fascicularis GN=SEC22A PE=2 SV=1 1 144 2.0E-18
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 26 212 2.0E-14
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 12 189 3.0E-14
sp|Q5ZL74|VAMP7_CHICK Vesicle-associated membrane protein 7 OS=Gallus gallus GN=VAMP7 PE=2 SV=1 36 196 1.0E-12
sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus GN=VAMP7 PE=2 SV=1 36 196 1.0E-11
sp|P70280|VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus GN=Vamp7 PE=1 SV=1 36 182 1.0E-11
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 26 187 1.0E-11
sp|P51809|VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens GN=VAMP7 PE=1 SV=3 36 196 1.0E-11
sp|Q5RF94|VAMP7_PONAB Vesicle-associated membrane protein 7 OS=Pongo abelii GN=VAMP7 PE=2 SV=3 36 196 2.0E-11
sp|Q6BSL0|YKT6_DEBHA Synaptobrevin homolog YKT6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YKT6 PE=3 SV=1 52 189 2.0E-11
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 46 189 3.0E-11
sp|Q9JHW5|VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus GN=Vamp7 PE=1 SV=1 36 182 3.0E-11
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 52 189 3.0E-11
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 2 187 3.0E-11
sp|Q8BXT9|SC22C_MOUSE Vesicle-trafficking protein SEC22c OS=Mus musculus GN=Sec22c PE=2 SV=1 1 144 2.0E-10
sp|Q54NW7|VAM7A_DICDI Vesicle-associated membrane protein 7A OS=Dictyostelium discoideum GN=vamp7A PE=1 SV=1 37 211 6.0E-10
sp|Q9M376|VA727_ARATH Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1 38 211 2.0E-09
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 52 189 3.0E-09
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 52 189 3.0E-09
sp|Q6CSA2|YKT6_KLULA Synaptobrevin homolog YKT6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YKT6 PE=3 SV=1 46 189 4.0E-09
sp|Q2YDJ2|SC22C_BOVIN Vesicle-trafficking protein SEC22c OS=Bos taurus GN=SEC22C PE=2 SV=1 1 144 4.0E-09
sp|O60073|YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ykt6 PE=3 SV=1 36 189 7.0E-09
sp|Q9BRL7|SC22C_HUMAN Vesicle-trafficking protein SEC22c OS=Homo sapiens GN=SEC22C PE=1 SV=1 11 144 8.0E-09
sp|Q86AQ7|VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1 26 196 1.0E-08
sp|O15498|YKT6_HUMAN Synaptobrevin homolog YKT6 OS=Homo sapiens GN=YKT6 PE=1 SV=1 50 189 3.0E-07
sp|Q7ZUN8|YKT6_DANRE Synaptobrevin homolog YKT6 OS=Danio rerio GN=ykt6 PE=2 SV=1 49 189 1.0E-06
sp|Q6DDU7|YKT6A_XENLA Synaptobrevin homolog YKT6-A OS=Xenopus laevis GN=ykt6-a PE=2 SV=1 49 189 4.0E-06
sp|Q6P816|YKT6_XENTR Synaptobrevin homolog YKT6 OS=Xenopus tropicalis GN=ykt6 PE=2 SV=1 49 189 4.0E-06
sp|Q5EGY4|YKT6_RAT Synaptobrevin homolog YKT6 OS=Rattus norvegicus GN=Ykt6 PE=1 SV=1 49 189 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 192 214 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8020
MILSTQISRLDGLMLCASVDDAQSESSTVAEVKQQTRQVLRKLTPTSEAQASIESGRYTIHYLIDSGVVFLCICD
RSYPRKLAFTFLSDLAREFTTVHPSQTVHNPSLRPYAFMDFDGFIAKTRTTYADARASQNLDKLNDELRDVTKVM
TKNIEDLLYRGDSLERMGELSSRLRDDSKKYRRAAVRINWELLLKQYGPIAGFGFIVLLFIYWRFF*
Coding >OphauB2|8020
ATGATTTTATCGACACAGATATCAAGGCTAGATGGCCTCATGCTCTGCGCCTCGGTCGACGACGCCCAGTCCGAG
TCGTCCACCGTTGCCGAAGTCAAGCAGCAAACGCGGCAGGTGTTGCGCAAGCTGACGCCCACGTCGGAGGCACAA
GCAAGCATCGAATCCGGCCGCTACACCATCCACTACCTCATTGACTCGGGCGTCGTCTTTCTCTGCATCTGCGAC
CGCTCCTATCCTCGAAAACTCGCCTTTACCTTCTTGTCCGACCTGGCCCGCGAGTTCACCACGGTGCATCCCTCG
CAGACTGTGCATAATCCATCTCTGCGGCCCTATGCCTTTATGGACTTTGACGGCTTCATTGCAAAGACGAGAACC
ACATATGCCGATGCCCGCGCCTCACAGAACCTCGACAAGCTCAACGACGAGCTGCGCGACGTGACAAAGGTCATG
ACCAAGAATATTGAGGATTTGCTCTACCGCGGAGATAGCCTGGAGCGCATGGGTGAGTTGAGCAGCCGCCTCCGC
GATGATAGCAAAAAGTATCGCCGGGCTGCCGTGCGCATCAATTGGGAACTGCTGCTCAAACAGTACGGCCCTATT
GCCGGTTTTGGATTCATAGTCCTCCTATTCATCTACTGGCGCTTCTTTTGA
Transcript >OphauB2|8020
ATGATTTTATCGACACAGATATCAAGGCTAGATGGCCTCATGCTCTGCGCCTCGGTCGACGACGCCCAGTCCGAG
TCGTCCACCGTTGCCGAAGTCAAGCAGCAAACGCGGCAGGTGTTGCGCAAGCTGACGCCCACGTCGGAGGCACAA
GCAAGCATCGAATCCGGCCGCTACACCATCCACTACCTCATTGACTCGGGCGTCGTCTTTCTCTGCATCTGCGAC
CGCTCCTATCCTCGAAAACTCGCCTTTACCTTCTTGTCCGACCTGGCCCGCGAGTTCACCACGGTGCATCCCTCG
CAGACTGTGCATAATCCATCTCTGCGGCCCTATGCCTTTATGGACTTTGACGGCTTCATTGCAAAGACGAGAACC
ACATATGCCGATGCCCGCGCCTCACAGAACCTCGACAAGCTCAACGACGAGCTGCGCGACGTGACAAAGGTCATG
ACCAAGAATATTGAGGATTTGCTCTACCGCGGAGATAGCCTGGAGCGCATGGGTGAGTTGAGCAGCCGCCTCCGC
GATGATAGCAAAAAGTATCGCCGGGCTGCCGTGCGCATCAATTGGGAACTGCTGCTCAAACAGTACGGCCCTATT
GCCGGTTTTGGATTCATAGTCCTCCTATTCATCTACTGGCGCTTCTTTTGA
Gene >OphauB2|8020
ATGATTTTATCGACACAGATATCAAGGCTAGATGGTGCAGGGCGCTATTCCATGACTTGCGTCTGCGAGCCGCAC
GCTAATGCTTAGACAGGCCTCATGCTCTGCGCCTCGGTCGACGACGCCCAGGTCCGTCGGCTCGGCTTCTCCTAG
TCGACACAATCCATCTGCTAACCCTCCTCTTGGCCACAGTCCGAGTCGTCCACCGTTGCCGAAGTCAAGCAGCAA
ACGCGGCAGGTGTTGCGCAAGCTGACGCCCACGTCGGAGGCACAAGCAAGCATCGAATCCGGCCGCTACACCATC
CACTACCTCATTGACTCGGGCGTCGTCTTTCTCTGCATCTGCGACCGCTCCTATCCTCGAAAACTCGCCTTTACC
TTCTTGTCCGACCTGGCCCGCGAGTTCACCACGGTGCATCCCTCGCAGACTGTGCATAATCCATCTCTGCGGCCC
TATGCCTTTATGGACTTTGACGGCTTCATTGCAAAGACGAGAACCACATATGCCGATGCCCGCGCCTCACAGAAC
CTCGACAAGCTCAACGACGAGCTGCGCGACGTGACAAAGGTCATGACCAAGAATATTGAGGATTTGCTCTACCGC
GGAGATAGCCTGGAGCGCATGGGTGAGTTGAGCAGCCGCCTCCGCGATGATAGCAAAAAGTATCGCCGGGCTGCC
GTGCGCATCAATTGGGAACTGCTGCTCAAACAGTACGGCCCTATTGCCGGTTTTGGATTCATAGTCCTCCTATTC
ATCTACTGGCGCTTCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail