Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8018
Gene name
LocationContig_94:26161..28297
Strand+
Gene length (bp)2136
Transcript length (bp)2025
Coding sequence length (bp)2025
Protein length (aa) 675

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05602 CLPTM1 Cleft lip and palate transmembrane protein 1 (CLPTM1) 9.7E-151 40 517

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2NL17|CLPT1_BOVIN Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus GN=CLPTM1 PE=2 SV=1 159 623 1.0E-102
sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 159 624 3.0E-102
sp|Q8VBZ3|CLPT1_MOUSE Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus GN=Clptm1 PE=1 SV=1 159 624 2.0E-101
sp|Q6DEL2|CLPT1_DANRE Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio GN=clptm1 PE=2 SV=1 105 622 1.0E-97
sp|Q54RJ1|CNRB_DICDI CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum GN=cnrB PE=3 SV=1 97 624 3.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2NL17|CLPT1_BOVIN Cleft lip and palate transmembrane protein 1 homolog OS=Bos taurus GN=CLPTM1 PE=2 SV=1 159 623 1.0E-102
sp|O96005|CLPT1_HUMAN Cleft lip and palate transmembrane protein 1 OS=Homo sapiens GN=CLPTM1 PE=1 SV=1 159 624 3.0E-102
sp|Q8VBZ3|CLPT1_MOUSE Cleft lip and palate transmembrane protein 1 homolog OS=Mus musculus GN=Clptm1 PE=1 SV=1 159 624 2.0E-101
sp|Q6DEL2|CLPT1_DANRE Cleft lip and palate transmembrane protein 1 homolog OS=Danio rerio GN=clptm1 PE=2 SV=1 105 622 1.0E-97
sp|Q54RJ1|CNRB_DICDI CLPTM1-like membrane protein cnrB OS=Dictyostelium discoideum GN=cnrB PE=3 SV=1 97 624 3.0E-92
sp|Q5R7B1|CLP1L_PONAB Cleft lip and palate transmembrane protein 1-like protein OS=Pongo abelii GN=CLPTM1L PE=2 SV=1 158 628 3.0E-83
sp|Q8BXA5|CLP1L_MOUSE Cleft lip and palate transmembrane protein 1-like protein OS=Mus musculus GN=Clptm1l PE=1 SV=1 158 629 8.0E-83
sp|Q96KA5|CLP1L_HUMAN Cleft lip and palate transmembrane protein 1-like protein OS=Homo sapiens GN=CLPTM1L PE=1 SV=1 158 628 8.0E-83
sp|Q6DHU1|CLP1L_DANRE Cleft lip and palate transmembrane protein 1-like protein OS=Danio rerio GN=clptm1l PE=2 SV=1 158 624 5.0E-81
sp|A2VE61|CLP1L_BOVIN Cleft lip and palate transmembrane protein 1-like protein OS=Bos taurus GN=CLPTM1L PE=2 SV=1 158 629 1.0E-80
sp|Q5ZKJ0|CLP1L_CHICK Cleft lip and palate transmembrane protein 1-like protein OS=Gallus gallus GN=CLPTM1L PE=2 SV=1 135 629 2.0E-78
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 34 51 17
2 370 392 22
3 407 427 20
4 494 516 22
5 526 548 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8018
MPPQGDHQAQPAAQPQQQPQPPQRQQGGFSFNKLLLGGAVYIGLNILISYVMQKDQKAVTWKDPATGEPVVVAGN
TGDIPPYQLRPKSLDQGASYRSIPNKIAPIWPQDSHVDIVVTLSPSFNPAPISQTPPEYVVFKQEKFHLSNSSDM
RSIDTTFSVPDAVQKNGTLWGHFYIGLSGSLLDPMQPDYDPGRAYRFTYPLTQYLPKKKVTKTRNLLEGRPDPAT
EPEEPEPSGPIVASHYHPNASFAFVPAMGVRELASLHPAIKQFLRLEATGARDGTGQNSWYYPLLFVNTFWQLTN
HMTVLNETVKELPLHIDLKNMPFWQFQLMATIEMNSKESARQAAFGASLPGGGDGTEIEMFKEIFIDTNPILLAI
TAIVTVAHLVLETLAFGSDIAHYRKKKDNVGISVRSILANVFMQTIIFLYLLDNSQNTSWMILGSQVVGIAIELW
KITTVVDVRLRPSAPGSWLPYSVVFEDKHKLTETEEKTKEYDEIAFRYMYMLAVPLLVAYGIYSVVYETHKSWYS
FVITTLVGSVYTYGFLMMVPSLYINYRLKSVAHMPAKAMMYKFLNTFIDDLFAFTIKMPILHRLATLRDDVIFFI
YLYQKWAYRTDYSRVNEFGQGGEEDGDKKVDDGDKMEQKAQEESTSKEAVAEPIEEATEGIATGRASEHATKRK*
Coding >OphauB2|8018
ATGCCACCCCAGGGCGACCATCAAGCCCAGCCGGCGGCTCAGCCCCAGCAACAGCCCCAGCCACCCCAGCGGCAG
CAAGGCGGCTTCAGCTTCAACAAGCTGCTCCTGGGCGGTGCCGTCTACATCGGACTCAACATTCTCATTTCCTAC
GTGATGCAAAAGGACCAAAAGGCCGTTACTTGGAAAGATCCTGCCACGGGCGAACCAGTCGTTGTCGCCGGCAAT
ACGGGCGACATTCCCCCTTACCAGCTCCGGCCAAAAAGCCTCGACCAAGGCGCGTCCTACCGGTCCATCCCCAAC
AAGATTGCGCCCATCTGGCCTCAGGATAGTCACGTCGACATTGTCGTCACGCTGTCGCCCTCTTTCAACCCAGCT
CCAATCTCGCAGACGCCGCCCGAATATGTTGTCTTCAAGCAAGAGAAATTCCACCTCAGCAACAGCTCTGACATG
CGCTCCATCGACACGACATTTTCTGTCCCTGACGCTGTGCAAAAGAATGGTACTCTCTGGGGCCACTTCTACATC
GGTCTTAGTGGCAGTCTCCTTGATCCCATGCAACCTGATTACGACCCTGGCAGGGCCTACCGCTTCACATATCCC
TTGACCCAGTACTTGCCCAAGAAAAAGGTTACCAAGACGAGGAACTTGCTCGAGGGCCGTCCGGATCCTGCTACT
GAGCCCGAGGAACCGGAACCCTCTGGACCCATCGTGGCCAGCCACTACCACCCAAACGCCAGTTTTGCCTTTGTT
CCCGCCATGGGTGTCCGAGAACTGGCTTCACTCCACCCGGCCATCAAGCAGTTCTTGCGTCTTGAAGCCACTGGG
GCCCGAGATGGCACGGGCCAAAACAGCTGGTACTATCCGTTGCTGTTTGTCAACACATTTTGGCAATTGACAAAT
CACATGACGGTTCTCAACGAAACAGTCAAGGAGCTGCCGCTACATATCGACCTCAAGAACATGCCTTTTTGGCAG
TTTCAGCTCATGGCGACCATAGAGATGAACTCAAAAGAGTCTGCACGCCAGGCTGCCTTTGGGGCCTCCTTACCA
GGCGGTGGAGACGGCACTGAAATCGAAATGTTCAAGGAAATTTTCATTGATACAAACCCAATACTGCTCGCCATC
ACGGCCATTGTGACGGTTGCGCATCTGGTGCTTGAGACGCTAGCTTTTGGCTCTGACATTGCACATTACCGCAAG
AAGAAGGACAATGTTGGCATCTCGGTGCGCTCAATTCTTGCCAATGTGTTTATGCAGACCATCATCTTCTTATAT
CTGCTCGACAATTCGCAGAATACGAGCTGGATGATTCTTGGGTCCCAGGTCGTGGGCATTGCCATTGAGCTTTGG
AAAATTACCACAGTGGTGGACGTGCGACTGCGACCGTCGGCACCCGGCTCCTGGCTGCCGTACAGTGTCGTCTTT
GAGGATAAACACAAGCTGACAGAGACGGAAGAGAAGACCAAGGAGTACGACGAGATTGCTTTTCGCTACATGTAC
ATGCTGGCGGTACCCTTGCTGGTGGCATACGGCATCTACTCGGTTGTGTACGAGACGCACAAGTCTTGGTATTCG
TTTGTCATAACAACACTAGTCGGGTCCGTCTACACGTACGGCTTCCTCATGATGGTGCCGTCGCTCTACATCAAC
TACCGGCTCAAGAGCGTGGCCCACATGCCGGCCAAAGCCATGATGTACAAGTTTCTCAACACGTTTATTGACGAC
TTGTTTGCGTTTACCATCAAGATGCCTATTTTACACCGGCTGGCTACATTGCGTGACGACGTCATTTTCTTCATT
TACTTGTACCAAAAATGGGCATATCGGACAGACTATTCGCGCGTCAATGAATTCGGACAGGGCGGAGAAGAAGAC
GGAGACAAAAAAGTAGATGATGGGGACAAGATGGAGCAAAAGGCGCAAGAGGAGTCGACGAGCAAAGAGGCAGTG
GCCGAGCCCATTGAAGAAGCGACGGAAGGCATTGCGACGGGACGGGCTTCTGAGCATGCGACAAAACGGAAATAA
Transcript >OphauB2|8018
ATGCCACCCCAGGGCGACCATCAAGCCCAGCCGGCGGCTCAGCCCCAGCAACAGCCCCAGCCACCCCAGCGGCAG
CAAGGCGGCTTCAGCTTCAACAAGCTGCTCCTGGGCGGTGCCGTCTACATCGGACTCAACATTCTCATTTCCTAC
GTGATGCAAAAGGACCAAAAGGCCGTTACTTGGAAAGATCCTGCCACGGGCGAACCAGTCGTTGTCGCCGGCAAT
ACGGGCGACATTCCCCCTTACCAGCTCCGGCCAAAAAGCCTCGACCAAGGCGCGTCCTACCGGTCCATCCCCAAC
AAGATTGCGCCCATCTGGCCTCAGGATAGTCACGTCGACATTGTCGTCACGCTGTCGCCCTCTTTCAACCCAGCT
CCAATCTCGCAGACGCCGCCCGAATATGTTGTCTTCAAGCAAGAGAAATTCCACCTCAGCAACAGCTCTGACATG
CGCTCCATCGACACGACATTTTCTGTCCCTGACGCTGTGCAAAAGAATGGTACTCTCTGGGGCCACTTCTACATC
GGTCTTAGTGGCAGTCTCCTTGATCCCATGCAACCTGATTACGACCCTGGCAGGGCCTACCGCTTCACATATCCC
TTGACCCAGTACTTGCCCAAGAAAAAGGTTACCAAGACGAGGAACTTGCTCGAGGGCCGTCCGGATCCTGCTACT
GAGCCCGAGGAACCGGAACCCTCTGGACCCATCGTGGCCAGCCACTACCACCCAAACGCCAGTTTTGCCTTTGTT
CCCGCCATGGGTGTCCGAGAACTGGCTTCACTCCACCCGGCCATCAAGCAGTTCTTGCGTCTTGAAGCCACTGGG
GCCCGAGATGGCACGGGCCAAAACAGCTGGTACTATCCGTTGCTGTTTGTCAACACATTTTGGCAATTGACAAAT
CACATGACGGTTCTCAACGAAACAGTCAAGGAGCTGCCGCTACATATCGACCTCAAGAACATGCCTTTTTGGCAG
TTTCAGCTCATGGCGACCATAGAGATGAACTCAAAAGAGTCTGCACGCCAGGCTGCCTTTGGGGCCTCCTTACCA
GGCGGTGGAGACGGCACTGAAATCGAAATGTTCAAGGAAATTTTCATTGATACAAACCCAATACTGCTCGCCATC
ACGGCCATTGTGACGGTTGCGCATCTGGTGCTTGAGACGCTAGCTTTTGGCTCTGACATTGCACATTACCGCAAG
AAGAAGGACAATGTTGGCATCTCGGTGCGCTCAATTCTTGCCAATGTGTTTATGCAGACCATCATCTTCTTATAT
CTGCTCGACAATTCGCAGAATACGAGCTGGATGATTCTTGGGTCCCAGGTCGTGGGCATTGCCATTGAGCTTTGG
AAAATTACCACAGTGGTGGACGTGCGACTGCGACCGTCGGCACCCGGCTCCTGGCTGCCGTACAGTGTCGTCTTT
GAGGATAAACACAAGCTGACAGAGACGGAAGAGAAGACCAAGGAGTACGACGAGATTGCTTTTCGCTACATGTAC
ATGCTGGCGGTACCCTTGCTGGTGGCATACGGCATCTACTCGGTTGTGTACGAGACGCACAAGTCTTGGTATTCG
TTTGTCATAACAACACTAGTCGGGTCCGTCTACACGTACGGCTTCCTCATGATGGTGCCGTCGCTCTACATCAAC
TACCGGCTCAAGAGCGTGGCCCACATGCCGGCCAAAGCCATGATGTACAAGTTTCTCAACACGTTTATTGACGAC
TTGTTTGCGTTTACCATCAAGATGCCTATTTTACACCGGCTGGCTACATTGCGTGACGACGTCATTTTCTTCATT
TACTTGTACCAAAAATGGGCATATCGGACAGACTATTCGCGCGTCAATGAATTCGGACAGGGCGGAGAAGAAGAC
GGAGACAAAAAAGTAGATGATGGGGACAAGATGGAGCAAAAGGCGCAAGAGGAGTCGACGAGCAAAGAGGCAGTG
GCCGAGCCCATTGAAGAAGCGACGGAAGGCATTGCGACGGGACGGGCTTCTGAGCATGCGACAAAACGGAAATAA
Gene >OphauB2|8018
ATGCCACCCCAGGGCGACCATCAAGCCCAGCCGGCGGCTCAGCCCCAGCAACAGCCCCAGCCACCCCAGCGGCAG
CAAGGCGTATGCAATGCTCAAGGCCTCCATCGTGCTCCCTTGCTAACCAGGACTCCCAGGGCTTCAGCTTCAACA
AGCTGCTCCTGGGCGGTGCCGTCTACATCGGACTCAACATTCTCATTTCCTACGTGATGCAAAAGGACCAAAAGG
CCGTTACTTGGAAAGATCCTGCCACGGGCGAACCAGTCGTTGTCGCCGGCAATACGGGCGACATTCCCCCTTACC
AGCTCCGGCCAAAAAGCCTCGACCAAGGCGCGTCCTACCGGTCCATCCCCAACAAGATTGCGCCCATCTGGCCTC
AGGATAGTCACGTCGACATTGTCGTCACGCTGTCGCCCTCTTTCAACCCAGCTCCAATCTCGCAGACGCCGCCCG
AATATGTTGTCTTCAAGCAAGAGAAATTCCACCTCAGCAACAGCTCTGACATGCGCTCCATCGACACGACATTTT
CTGTCCCTGACGCTGTGCAAAAGAATGGTACTCTCTGGGGCCACTTCTACATCGGTCTTAGTGGCAGTCTCCTTG
ATCCCATGCAACCTGATTACGACCCTGGCAGGGCCTACCGCTTCACATATCCCTTGACCCAGTACTTGCCCAAGA
AAAAGGTTACCAAGACGAGGAACTTGCTCGAGGGCCGTCCGGATCCTGCTACTGAGCCCGAGGAACCGGAACCCT
CTGGACCCATCGTGGCCAGCCACTACCACCCAAACGCCAGTTTTGCCTTTGTTCCCGCCATGGGTGTCCGAGAAC
TGGCTTCACTCCACCCGGCCATCAAGCAGTTCTTGCGTCTTGAAGCCACTGGGGCCCGAGATGGCACGGGCCAAA
ACAGCTGGTACTGTGGGTTTAAACCCAAGTCCAACTGTGAAGCTTTTTATCAATGCTGATTTGGTGGCAGATCCG
TTGCTGTTTGTCAACACATTTTGGCAATTGACAAATCACATGACGGTTCTCAACGAAACAGTCAAGGAGCTGCCG
CTACATATCGACCTCAAGAACATGCCTTTTTGGCAGTTTCAGCTCATGGCGACCATAGAGATGAACTCAAAAGAG
TCTGCACGCCAGGCTGCCTTTGGGGCCTCCTTACCAGGCGGTGGAGACGGCACTGAAATCGAAATGTTCAAGGAA
ATTTTCATTGATACAAACCCAATACTGCTCGCCATCACGGCCATTGTGACGGTTGCGCATCTGGTGCTTGAGACG
CTAGCTTTTGGCTCTGACATTGCACATTACCGCAAGAAGAAGGACAATGTTGGCATCTCGGTGCGCTCAATTCTT
GCCAATGTGTTTATGCAGACCATCATCTTCTTATATCTGCTCGACAATTCGCAGAATACGAGCTGGATGATTCTT
GGGTCCCAGGTCGTGGGCATTGCCATTGAGCTTTGGAAAATTACCACAGTGGTGGACGTGCGACTGCGACCGTCG
GCACCCGGCTCCTGGCTGCCGTACAGTGTCGTCTTTGAGGATAAACACAAGCTGACAGAGACGGAAGAGAAGACC
AAGGAGTACGACGAGATTGCTTTTCGCTACATGTACATGCTGGCGGTACCCTTGCTGGTGGCATACGGCATCTAC
TCGGTTGTGTACGAGACGCACAAGTCTTGGTATTCGTTTGTCATAACAACACTAGTCGGGTCCGTCTACACGTAC
GGCTTCCTCATGATGGTGCCGTCGCTCTACATCAACTACCGGCTCAAGAGCGTGGCCCACATGCCGGCCAAAGCC
ATGATGTACAAGTTTCTCAACACGTTTATTGACGACTTGTTTGCGTTTACCATCAAGATGCCTATTTTACACCGG
CTGGCTACATTGCGTGACGACGTCATTTTCTTCATTTACTTGTACCAAAAATGGGCATATCGGACAGACTATTCG
CGCGTCAATGAATTCGGACAGGGCGGAGAAGAAGACGGAGACAAAAAAGTAGATGATGGGGACAAGATGGAGCAA
AAGGCGCAAGAGGAGTCGACGAGCAAAGAGGCAGTGGCCGAGCCCATTGAAGAAGCGACGGAAGGCATTGCGACG
GGACGGGCTTCTGAGCATGCGACAAAACGGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail