Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8015
Gene name
LocationContig_94:20592..22435
Strand-
Gene length (bp)1843
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10396 TrmE_N GTP-binding protein TrmE N-terminus 9.9E-36 65 191
PF12631 MnmE_helical MnmE helical domain 6.8E-34 194 566
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.3E-18 293 415

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32559|MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS1 PE=1 SV=2 43 569 9.0E-85
sp|B0CJG2|MNME_BRUSI tRNA modification GTPase MnmE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mnmE PE=3 SV=1 64 569 2.0E-84
sp|A9M9E5|MNME_BRUC2 tRNA modification GTPase MnmE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mnmE PE=3 SV=1 64 569 1.0E-83
sp|Q969Y2|GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens GN=GTPBP3 PE=1 SV=2 54 569 1.0E-83
sp|Q8YJS6|MNME_BRUME tRNA modification GTPase MnmE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mnmE PE=3 SV=1 64 569 1.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32559|MSS1_YEAST tRNA modification GTPase MSS1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS1 PE=1 SV=2 43 569 9.0E-85
sp|B0CJG2|MNME_BRUSI tRNA modification GTPase MnmE OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mnmE PE=3 SV=1 64 569 2.0E-84
sp|A9M9E5|MNME_BRUC2 tRNA modification GTPase MnmE OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mnmE PE=3 SV=1 64 569 1.0E-83
sp|Q969Y2|GTPB3_HUMAN tRNA modification GTPase GTPBP3, mitochondrial OS=Homo sapiens GN=GTPBP3 PE=1 SV=2 54 569 1.0E-83
sp|Q8YJS6|MNME_BRUME tRNA modification GTPase MnmE OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mnmE PE=3 SV=1 64 569 1.0E-83
sp|Q57AJ6|MNME_BRUAB tRNA modification GTPase MnmE OS=Brucella abortus biovar 1 (strain 9-941) GN=mnmE PE=3 SV=1 64 569 2.0E-83
sp|Q2YR11|MNME_BRUA2 tRNA modification GTPase MnmE OS=Brucella abortus (strain 2308) GN=mnmE PE=3 SV=1 64 569 2.0E-83
sp|Q8CY34|MNME_BRUSU tRNA modification GTPase MnmE OS=Brucella suis biovar 1 (strain 1330) GN=mnmE PE=3 SV=1 64 569 3.0E-83
sp|A5VT20|MNME_BRUO2 tRNA modification GTPase MnmE OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mnmE PE=3 SV=1 64 569 7.0E-82
sp|A7HSK9|MNME_PARL1 tRNA modification GTPase MnmE OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mnmE PE=3 SV=1 64 569 3.0E-80
sp|A8GUF3|MNME_RICB8 tRNA modification GTPase MnmE OS=Rickettsia bellii (strain OSU 85-389) GN=mnmE PE=3 SV=1 64 569 4.0E-79
sp|Q1RKJ6|MNME_RICBR tRNA modification GTPase MnmE OS=Rickettsia bellii (strain RML369-C) GN=mnmE PE=3 SV=1 64 569 5.0E-79
sp|Q9UTE7|MSS1_SCHPO tRNA modification GTPase mss1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mss1 PE=3 SV=1 65 569 5.0E-78
sp|Q923K4|GTPB3_MOUSE tRNA modification GTPase GTPBP3, mitochondrial OS=Mus musculus GN=Gtpbp3 PE=2 SV=1 52 569 2.0E-76
sp|Q5PQQ1|GTPB3_RAT tRNA modification GTPase GTPBP3, mitochondrial OS=Rattus norvegicus GN=Gtpbp3 PE=2 SV=1 52 569 7.0E-76
sp|Q501Z5|GTPB3_DANRE tRNA modification GTPase GTPBP3, mitochondrial OS=Danio rerio GN=gtpbp3 PE=2 SV=1 63 569 9.0E-76
sp|Q55C52|GTPB3_DICDI tRNA modification GTPase gtpbp3, mitochondrial OS=Dictyostelium discoideum GN=gtpbp3 PE=3 SV=1 64 569 1.0E-75
sp|P0CAX2|MNME_CAUCR tRNA modification GTPase MnmE OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mnmE PE=3 SV=1 64 569 2.0E-75
sp|B8GW34|MNME_CAUCN tRNA modification GTPase MnmE OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=mnmE PE=3 SV=2 64 569 2.0E-75
sp|Q16CZ5|MNME_ROSDO tRNA modification GTPase MnmE OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mnmE PE=3 SV=1 64 569 4.0E-75
sp|A8GPN6|MNME_RICAH tRNA modification GTPase MnmE OS=Rickettsia akari (strain Hartford) GN=mnmE PE=3 SV=1 64 569 1.0E-73
sp|Q5NKZ8|MNME_ZYMMO tRNA modification GTPase MnmE OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=mnmE PE=3 SV=1 65 569 1.0E-73
sp|Q6G1K8|MNME_BARHE tRNA modification GTPase MnmE OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mnmE PE=3 SV=1 64 569 9.0E-73
sp|A8GTM1|MNME_RICRS tRNA modification GTPase MnmE OS=Rickettsia rickettsii (strain Sheila Smith) GN=mnmE PE=3 SV=1 64 569 1.0E-72
sp|B0BV57|MNME_RICRO tRNA modification GTPase MnmE OS=Rickettsia rickettsii (strain Iowa) GN=mnmE PE=3 SV=1 64 569 1.0E-72
sp|Q11CN2|MNME_CHESB tRNA modification GTPase MnmE OS=Chelativorans sp. (strain BNC1) GN=mnmE PE=3 SV=1 64 569 2.0E-72
sp|Q92GE8|MNME_RICCN tRNA modification GTPase MnmE OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mnmE PE=3 SV=1 64 569 3.0E-72
sp|Q9ZCI1|MNME_RICPR tRNA modification GTPase MnmE OS=Rickettsia prowazekii (strain Madrid E) GN=mnmE PE=3 SV=1 64 569 6.0E-72
sp|Q4UK70|MNME_RICFE tRNA modification GTPase MnmE OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mnmE PE=3 SV=1 64 569 8.0E-72
sp|A8I264|MNME_AZOC5 tRNA modification GTPase MnmE OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mnmE PE=3 SV=1 62 569 3.0E-71
sp|Q68VZ0|MNME_RICTY tRNA modification GTPase MnmE OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mnmE PE=3 SV=1 64 569 4.0E-71
sp|Q07UP2|MNME_RHOP5 tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain BisA53) GN=mnmE PE=3 SV=2 61 569 4.0E-71
sp|Q2WBH0|MNME_MAGSA tRNA modification GTPase MnmE OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mnmE PE=3 SV=2 64 569 3.0E-70
sp|B4RD04|MNME_PHEZH tRNA modification GTPase MnmE OS=Phenylobacterium zucineum (strain HLK1) GN=mnmE PE=3 SV=1 64 569 6.0E-70
sp|A8F2P7|MNME_RICM5 tRNA modification GTPase MnmE OS=Rickettsia massiliae (strain Mtu5) GN=mnmE PE=3 SV=1 64 569 6.0E-70
sp|Q0AKE8|MNME_MARMM tRNA modification GTPase MnmE OS=Maricaulis maris (strain MCS10) GN=mnmE PE=3 SV=1 65 569 1.0E-69
sp|B2IJQ3|MNME_BEII9 tRNA modification GTPase MnmE OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=mnmE PE=3 SV=1 46 569 1.0E-69
sp|Q92KW1|MNME_RHIME tRNA modification GTPase MnmE OS=Rhizobium meliloti (strain 1021) GN=mnmE PE=3 SV=2 62 569 2.0E-69
sp|Q5GTQ0|MNME_WOLTR tRNA modification GTPase MnmE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mnmE PE=3 SV=1 62 569 2.0E-69
sp|Q73GH3|MNME_WOLPM tRNA modification GTPase MnmE OS=Wolbachia pipientis wMel GN=mnmE PE=3 SV=1 62 569 2.0E-69
sp|B0T6E0|MNME_CAUSK tRNA modification GTPase MnmE OS=Caulobacter sp. (strain K31) GN=mnmE PE=3 SV=1 63 569 4.0E-69
sp|Q21CM0|MNME_RHOPB tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain BisB18) GN=mnmE PE=3 SV=1 65 569 5.0E-69
sp|C0R405|MNME_WOLWR tRNA modification GTPase MnmE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mnmE PE=3 SV=1 62 569 1.0E-68
sp|B3CMJ7|MNME_WOLPP tRNA modification GTPase MnmE OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=mnmE PE=3 SV=1 62 569 1.0E-68
sp|Q2GIJ8|MNME_ANAPZ tRNA modification GTPase MnmE OS=Anaplasma phagocytophilum (strain HZ) GN=mnmE PE=3 SV=1 64 569 2.0E-68
sp|B3PS53|MNME_RHIE6 tRNA modification GTPase MnmE OS=Rhizobium etli (strain CIAT 652) GN=mnmE PE=3 SV=1 63 569 3.0E-68
sp|A9CHB2|MNME_AGRFC tRNA modification GTPase MnmE OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mnmE PE=3 SV=1 60 399 4.0E-68
sp|A6WX76|MNME_OCHA4 tRNA modification GTPase MnmE OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mnmE PE=3 SV=1 64 385 3.0E-67
sp|A5E8G7|MNME_BRASB tRNA modification GTPase MnmE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mnmE PE=3 SV=1 63 569 3.0E-67
sp|A1UQU6|MNME_BARBK tRNA modification GTPase MnmE OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mnmE PE=3 SV=1 64 569 4.0E-67
sp|A4YJT5|MNME_BRASO tRNA modification GTPase MnmE OS=Bradyrhizobium sp. (strain ORS278) GN=mnmE PE=3 SV=1 63 569 4.0E-67
sp|Q1MA18|MNME_RHIL3 tRNA modification GTPase MnmE OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mnmE PE=3 SV=1 64 569 3.0E-66
sp|A8EZV9|MNME_RICCK tRNA modification GTPase MnmE OS=Rickettsia canadensis (strain McKiel) GN=mnmE PE=3 SV=1 64 569 5.0E-66
sp|B0UJI9|MNME_METS4 tRNA modification GTPase MnmE OS=Methylobacterium sp. (strain 4-46) GN=mnmE PE=3 SV=1 64 569 6.0E-66
sp|Q4FNR7|MNME_PELUB tRNA modification GTPase MnmE OS=Pelagibacter ubique (strain HTCC1062) GN=mnmE PE=3 SV=1 65 569 7.0E-66
sp|Q13E22|MNME_RHOPS tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain BisB5) GN=mnmE PE=3 SV=2 62 569 1.0E-65
sp|Q2J357|MNME_RHOP2 tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain HaA2) GN=mnmE PE=3 SV=1 62 569 2.0E-65
sp|Q3SWH5|MNME_NITWN tRNA modification GTPase MnmE OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mnmE PE=3 SV=1 65 569 3.0E-65
sp|Q98DZ0|MNME_RHILO tRNA modification GTPase MnmE OS=Rhizobium loti (strain MAFF303099) GN=mnmE PE=3 SV=1 62 372 1.0E-64
sp|Q2K2S0|MNME_RHIEC tRNA modification GTPase MnmE OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mnmE PE=3 SV=2 64 569 2.0E-64
sp|A6UEE9|MNME_SINMW tRNA modification GTPase MnmE OS=Sinorhizobium medicae (strain WSM419) GN=mnmE PE=3 SV=1 64 383 3.0E-64
sp|A3PNS7|MNME_RHOS1 tRNA modification GTPase MnmE OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mnmE PE=3 SV=1 64 569 3.0E-64
sp|A5CFM7|MNME_ORITB tRNA modification GTPase MnmE OS=Orientia tsutsugamushi (strain Boryong) GN=mnmE PE=3 SV=1 62 569 3.0E-64
sp|A9IZY1|MNME_BART1 tRNA modification GTPase MnmE OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mnmE PE=3 SV=1 64 385 4.0E-64
sp|A8LPC2|MNME_DINSH tRNA modification GTPase MnmE OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mnmE PE=3 SV=1 64 402 1.0E-63
sp|A4WVZ0|MNME_RHOS5 tRNA modification GTPase MnmE OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mnmE PE=3 SV=1 64 569 1.0E-63
sp|A9HE16|MNME_GLUDA tRNA modification GTPase MnmE OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=mnmE PE=3 SV=1 60 569 2.0E-63
sp|Q3IYH3|MNME_RHOS4 tRNA modification GTPase MnmE OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mnmE PE=3 SV=1 64 569 3.0E-63
sp|Q6FYB8|MNME_BARQU tRNA modification GTPase MnmE OS=Bartonella quintana (strain Toulouse) GN=mnmE PE=3 SV=1 64 569 5.0E-63
sp|Q5FF19|MNME_EHRRG tRNA modification GTPase MnmE OS=Ehrlichia ruminantium (strain Gardel) GN=mnmE PE=3 SV=1 65 387 5.0E-63
sp|Q5HCD7|MNME_EHRRW tRNA modification GTPase MnmE OS=Ehrlichia ruminantium (strain Welgevonden) GN=mnmE PE=3 SV=1 65 387 6.0E-63
sp|Q5P9B1|MNME_ANAMM tRNA modification GTPase MnmE OS=Anaplasma marginale (strain St. Maries) GN=mnmE PE=3 SV=1 64 395 1.0E-62
sp|Q2GI42|MNME_EHRCR tRNA modification GTPase MnmE OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mnmE PE=3 SV=1 65 569 1.0E-62
sp|Q3YT72|MNME_EHRCJ tRNA modification GTPase MnmE OS=Ehrlichia canis (strain Jake) GN=mnmE PE=3 SV=1 65 569 2.0E-62
sp|Q89WP4|MNME_BRADU tRNA modification GTPase MnmE OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mnmE PE=3 SV=1 63 569 4.0E-62
sp|Q2GC37|MNME_NOVAD tRNA modification GTPase MnmE OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=mnmE PE=3 SV=1 64 569 5.0E-62
sp|B1ZGG9|MNME_METPB tRNA modification GTPase MnmE OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=mnmE PE=3 SV=1 60 569 7.0E-62
sp|Q1GCM0|MNME_RUEST tRNA modification GTPase MnmE OS=Ruegeria sp. (strain TM1040) GN=mnmE PE=3 SV=1 64 383 9.0E-62
sp|Q5LLM7|MNME_RUEPO tRNA modification GTPase MnmE OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mnmE PE=3 SV=1 64 569 6.0E-61
sp|Q2RN77|MNME_RHORT tRNA modification GTPase MnmE OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mnmE PE=3 SV=1 64 429 2.0E-59
sp|Q0BW92|MNME_GRABC tRNA modification GTPase MnmE OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mnmE PE=3 SV=1 62 569 8.0E-59
sp|B3Q8A8|MNME_RHOPT tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain TIE-1) GN=mnmE PE=3 SV=1 62 404 8.0E-59
sp|A2BUG6|MNME_PROM5 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9515) GN=mnmE PE=3 SV=1 62 569 9.0E-59
sp|B1M0E0|MNME_METRJ tRNA modification GTPase MnmE OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=mnmE PE=3 SV=1 64 569 9.0E-59
sp|O67030|MNME_AQUAE tRNA modification GTPase MnmE OS=Aquifex aeolicus (strain VF5) GN=mnmE PE=3 SV=1 66 569 4.0E-58
sp|P94612|MNME_COXBU tRNA modification GTPase MnmE OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mnmE PE=3 SV=1 64 569 9.0E-58
sp|A9NBA7|MNME_COXBR tRNA modification GTPase MnmE OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mnmE PE=3 SV=1 64 569 9.0E-58
sp|A9KBS9|MNME_COXBN tRNA modification GTPase MnmE OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mnmE PE=3 SV=1 64 569 9.0E-58
sp|Q97CW2|MNME_CLOAB tRNA modification GTPase MnmE OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mnmE PE=3 SV=1 64 569 2.0E-57
sp|Q6ND14|MNME_RHOPA tRNA modification GTPase MnmE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mnmE PE=3 SV=1 62 404 2.0E-57
sp|C0Q2L4|MNME_SALPC tRNA modification GTPase MnmE OS=Salmonella paratyphi C (strain RKS4594) GN=mnmE PE=3 SV=1 63 569 3.0E-57
sp|Q1QRZ0|MNME_NITHX tRNA modification GTPase MnmE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mnmE PE=3 SV=1 65 569 4.0E-57
sp|B4TN11|MNME_SALSV tRNA modification GTPase MnmE OS=Salmonella schwarzengrund (strain CVM19633) GN=mnmE PE=3 SV=1 63 569 4.0E-57
sp|A9MX84|MNME_SALPB tRNA modification GTPase MnmE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mnmE PE=3 SV=2 63 569 4.0E-57
sp|B4SYB2|MNME_SALNS tRNA modification GTPase MnmE OS=Salmonella newport (strain SL254) GN=mnmE PE=3 SV=1 63 569 4.0E-57
sp|B5QUQ5|MNME_SALEP tRNA modification GTPase MnmE OS=Salmonella enteritidis PT4 (strain P125109) GN=mnmE PE=3 SV=1 63 569 4.0E-57
sp|Q57HZ6|MNME_SALCH tRNA modification GTPase MnmE OS=Salmonella choleraesuis (strain SC-B67) GN=mnmE PE=3 SV=1 63 569 4.0E-57
sp|Q2GD53|MNME_NEOSM tRNA modification GTPase MnmE OS=Neorickettsia sennetsu (strain Miyayama) GN=mnmE PE=3 SV=1 65 385 5.0E-57
sp|Q8ZKY3|MNME_SALTY tRNA modification GTPase MnmE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mnmE PE=3 SV=1 63 569 5.0E-57
sp|A3M8Y8|MNME_ACIBT tRNA modification GTPase MnmE OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=mnmE PE=3 SV=2 62 569 6.0E-57
sp|Q31DJ0|MNME_THICR tRNA modification GTPase MnmE OS=Thiomicrospira crunogena (strain XCL-2) GN=mnmE PE=3 SV=2 61 569 7.0E-57
sp|B5BIL9|MNME_SALPK tRNA modification GTPase MnmE OS=Salmonella paratyphi A (strain AKU_12601) GN=mnmE PE=3 SV=1 63 569 8.0E-57
sp|Q8Z2N8|MNME_SALTI tRNA modification GTPase MnmE OS=Salmonella typhi GN=mnmE PE=3 SV=1 63 569 8.0E-57
sp|Q3J6L9|MNME_NITOC tRNA modification GTPase MnmE OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mnmE PE=3 SV=1 64 569 1.0E-56
sp|Q5FS11|MNME_GLUOX tRNA modification GTPase MnmE OS=Gluconobacter oxydans (strain 621H) GN=mnmE PE=3 SV=1 61 382 1.0E-56
sp|A2C018|MNME_PROM1 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain NATL1A) GN=mnmE PE=3 SV=1 62 569 1.0E-56
sp|Q46HI4|MNME_PROMT tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain NATL2A) GN=mnmE PE=3 SV=1 62 569 2.0E-56
sp|A1JT87|MNME_YERE8 tRNA modification GTPase MnmE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mnmE PE=3 SV=1 61 569 2.0E-56
sp|Q7NPT9|MNME_CHRVO tRNA modification GTPase MnmE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mnmE PE=3 SV=1 65 569 2.0E-56
sp|A9MJT6|MNME_SALAR tRNA modification GTPase MnmE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mnmE PE=3 SV=2 63 569 2.0E-56
sp|B5RFY2|MNME_SALG2 tRNA modification GTPase MnmE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mnmE PE=3 SV=1 63 569 2.0E-56
sp|Q2N6I9|MNME_ERYLH tRNA modification GTPase MnmE OS=Erythrobacter litoralis (strain HTCC2594) GN=mnmE PE=3 SV=1 64 569 3.0E-56
sp|Q7MAX1|MNME_PHOLL tRNA modification GTPase MnmE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mnmE PE=3 SV=1 62 569 3.0E-56
sp|A8ACL8|MNME_CITK8 tRNA modification GTPase MnmE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mnmE PE=3 SV=2 63 569 3.0E-56
sp|B0V5S5|MNME_ACIBY tRNA modification GTPase MnmE OS=Acinetobacter baumannii (strain AYE) GN=mnmE PE=3 SV=1 62 569 4.0E-56
sp|B7NR09|MNME_ECO7I tRNA modification GTPase MnmE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mnmE PE=3 SV=1 61 569 5.0E-56
sp|Q1R4M8|MNME_ECOUT tRNA modification GTPase MnmE OS=Escherichia coli (strain UTI89 / UPEC) GN=mnmE PE=3 SV=1 61 569 5.0E-56
sp|Q8FBV3|MNME_ECOL6 tRNA modification GTPase MnmE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mnmE PE=3 SV=1 61 569 5.0E-56
sp|Q0TB01|MNME_ECOL5 tRNA modification GTPase MnmE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mnmE PE=3 SV=1 61 569 5.0E-56
sp|A1AHP0|MNME_ECOK1 tRNA modification GTPase MnmE OS=Escherichia coli O1:K1 / APEC GN=mnmE PE=3 SV=1 61 569 5.0E-56
sp|B7MGC8|MNME_ECO45 tRNA modification GTPase MnmE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mnmE PE=3 SV=1 61 569 5.0E-56
sp|B5YXB0|MNME_ECO5E tRNA modification GTPase MnmE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mnmE PE=3 SV=1 61 569 6.0E-56
sp|Q8XB41|MNME_ECO57 tRNA modification GTPase MnmE OS=Escherichia coli O157:H7 GN=mnmE PE=3 SV=1 61 569 6.0E-56
sp|Q31UW0|MNME_SHIBS tRNA modification GTPase MnmE OS=Shigella boydii serotype 4 (strain Sb227) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|B2TUS2|MNME_SHIB3 tRNA modification GTPase MnmE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|B6I3T9|MNME_ECOSE tRNA modification GTPase MnmE OS=Escherichia coli (strain SE11) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|P25522|MNME_ECOLI tRNA modification GTPase MnmE OS=Escherichia coli (strain K12) GN=mnmE PE=1 SV=3 61 569 7.0E-56
sp|B1IX32|MNME_ECOLC tRNA modification GTPase MnmE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|B1X9T5|MNME_ECODH tRNA modification GTPase MnmE OS=Escherichia coli (strain K12 / DH10B) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|C4ZYY4|MNME_ECOBW tRNA modification GTPase MnmE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|B7M559|MNME_ECO8A tRNA modification GTPase MnmE OS=Escherichia coli O8 (strain IAI1) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|B7UMH3|MNME_ECO27 tRNA modification GTPase MnmE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mnmE PE=3 SV=1 61 569 7.0E-56
sp|B7LK49|MNME_ESCF3 tRNA modification GTPase MnmE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mnmE PE=3 SV=1 61 569 8.0E-56
sp|B1LL33|MNME_ECOSM tRNA modification GTPase MnmE OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mnmE PE=3 SV=1 61 569 8.0E-56
sp|B7N211|MNME_ECO81 tRNA modification GTPase MnmE OS=Escherichia coli O81 (strain ED1a) GN=mnmE PE=3 SV=1 61 569 8.0E-56
sp|Q329B1|MNME_SHIDS tRNA modification GTPase MnmE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mnmE PE=3 SV=1 61 569 9.0E-56
sp|Q5PKU1|MNME_SALPA tRNA modification GTPase MnmE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mnmE PE=3 SV=1 63 569 9.0E-56
sp|A7GVP7|MNME_BACCN tRNA modification GTPase MnmE OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mnmE PE=3 SV=1 64 569 1.0E-55
sp|B7NF24|MNME_ECOLU tRNA modification GTPase MnmE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mnmE PE=3 SV=1 61 569 1.0E-55
sp|Q83PL3|MNME_SHIFL tRNA modification GTPase MnmE OS=Shigella flexneri GN=mnmE PE=3 SV=1 61 569 2.0E-55
sp|Q0SYP6|MNME_SHIF8 tRNA modification GTPase MnmE OS=Shigella flexneri serotype 5b (strain 8401) GN=mnmE PE=3 SV=1 61 569 2.0E-55
sp|A1WWE4|MNME_HALHL tRNA modification GTPase MnmE OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mnmE PE=3 SV=1 64 569 2.0E-55
sp|A8A6G8|MNME_ECOHS tRNA modification GTPase MnmE OS=Escherichia coli O9:H4 (strain HS) GN=mnmE PE=3 SV=1 61 569 3.0E-55
sp|B7L851|MNME_ECO55 tRNA modification GTPase MnmE OS=Escherichia coli (strain 55989 / EAEC) GN=mnmE PE=3 SV=1 61 569 3.0E-55
sp|Q3YWA7|MNME_SHISS tRNA modification GTPase MnmE OS=Shigella sonnei (strain Ss046) GN=mnmE PE=3 SV=1 61 569 3.0E-55
sp|A5G169|MNME_ACICJ tRNA modification GTPase MnmE OS=Acidiphilium cryptum (strain JF-5) GN=mnmE PE=3 SV=1 61 381 4.0E-55
sp|A2BNY4|MNME_PROMS tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain AS9601) GN=mnmE PE=3 SV=1 74 569 4.0E-55
sp|A3PAQ7|MNME_PROM0 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9301) GN=mnmE PE=3 SV=1 74 569 4.0E-55
sp|A8AXP0|MNME_STRGC tRNA modification GTPase MnmE OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mnmE PE=3 SV=1 64 428 4.0E-55
sp|B4F0U0|MNME_PROMH tRNA modification GTPase MnmE OS=Proteus mirabilis (strain HI4320) GN=mnmE PE=3 SV=1 62 569 5.0E-55
sp|A8G7P7|MNME_SERP5 tRNA modification GTPase MnmE OS=Serratia proteamaculans (strain 568) GN=mnmE PE=3 SV=1 61 569 5.0E-55
sp|B2VCE7|MNME_ERWT9 tRNA modification GTPase MnmE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mnmE PE=3 SV=1 64 569 5.0E-55
sp|Q8CX13|MNME_STRA5 tRNA modification GTPase MnmE OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=mnmE PE=3 SV=1 64 428 5.0E-55
sp|Q3K1I2|MNME_STRA1 tRNA modification GTPase MnmE OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mnmE PE=3 SV=1 64 428 5.0E-55
sp|A4VWD1|MNME_STRSY tRNA modification GTPase MnmE OS=Streptococcus suis (strain 05ZYH33) GN=mnmE PE=3 SV=1 64 428 5.0E-55
sp|A4W2N6|MNME_STRS2 tRNA modification GTPase MnmE OS=Streptococcus suis (strain 98HAH33) GN=mnmE PE=3 SV=1 64 428 5.0E-55
sp|A8G2J5|MNME_PROM2 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9215) GN=mnmE PE=3 SV=1 74 569 5.0E-55
sp|Q8E5T7|MNME_STRA3 tRNA modification GTPase MnmE OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mnmE PE=3 SV=1 64 428 6.0E-55
sp|A7MN03|MNME_CROS8 tRNA modification GTPase MnmE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mnmE PE=3 SV=1 63 569 8.0E-55
sp|A0AMD2|MNME_LISW6 tRNA modification GTPase MnmE OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mnmE PE=3 SV=1 64 569 8.0E-55
sp|Q663S6|MNME_YERPS tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mnmE PE=3 SV=1 61 569 9.0E-55
sp|B2K868|MNME_YERPB tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mnmE PE=3 SV=1 61 569 9.0E-55
sp|A4TSL0|MNME_YERPP tRNA modification GTPase MnmE OS=Yersinia pestis (strain Pestoides F) GN=mnmE PE=3 SV=1 61 569 1.0E-54
sp|Q1CCJ3|MNME_YERPN tRNA modification GTPase MnmE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mnmE PE=3 SV=1 61 569 1.0E-54
sp|A9R5S1|MNME_YERPG tRNA modification GTPase MnmE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mnmE PE=3 SV=1 61 569 1.0E-54
sp|Q1C0B3|MNME_YERPA tRNA modification GTPase MnmE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mnmE PE=3 SV=1 61 569 1.0E-54
sp|A4WGH1|MNME_ENT38 tRNA modification GTPase MnmE OS=Enterobacter sp. (strain 638) GN=mnmE PE=3 SV=1 63 569 2.0E-54
sp|B5XZP4|MNME_KLEP3 tRNA modification GTPase MnmE OS=Klebsiella pneumoniae (strain 342) GN=mnmE PE=3 SV=1 63 569 2.0E-54
sp|A6M3M5|MNME_CLOB8 tRNA modification GTPase MnmE OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mnmE PE=3 SV=1 64 569 2.0E-54
sp|A7FPC2|MNME_YERP3 tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mnmE PE=3 SV=1 61 569 2.0E-54
sp|Q82XA1|MNME_NITEU tRNA modification GTPase MnmE OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mnmE PE=3 SV=1 62 569 3.0E-54
sp|Q0AE55|MNME_NITEC tRNA modification GTPase MnmE OS=Nitrosomonas eutropha (strain C91) GN=mnmE PE=3 SV=2 62 569 4.0E-54
sp|A7ZTR2|MNME_ECO24 tRNA modification GTPase MnmE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mnmE PE=3 SV=1 61 569 4.0E-54
sp|B1JRQ1|MNME_YERPY tRNA modification GTPase MnmE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mnmE PE=3 SV=1 61 569 5.0E-54
sp|A9VTM0|MNME_BACWK tRNA modification GTPase MnmE OS=Bacillus weihenstephanensis (strain KBAB4) GN=mnmE PE=3 SV=1 64 569 5.0E-54
sp|Q3AG56|MNME_CARHZ tRNA modification GTPase MnmE OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mnmE PE=3 SV=1 63 569 5.0E-54
sp|Q31CZ2|MNME_PROM9 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9312) GN=mnmE PE=3 SV=1 74 569 6.0E-54
sp|A4VS81|MNME_PSEU5 tRNA modification GTPase MnmE OS=Pseudomonas stutzeri (strain A1501) GN=mnmE PE=3 SV=1 64 569 6.0E-54
sp|A3CNB0|MNME_STRSV tRNA modification GTPase MnmE OS=Streptococcus sanguinis (strain SK36) GN=mnmE PE=3 SV=1 64 428 8.0E-54
sp|Q8R6K8|MNME_CALS4 tRNA modification GTPase MnmE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mnmE PE=3 SV=1 64 569 1.0E-53
sp|Q5XCB7|MNME_STRP6 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mnmE PE=3 SV=1 64 428 1.0E-53
sp|B2A470|MNME_NATTJ tRNA modification GTPase MnmE OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=mnmE PE=3 SV=1 62 569 1.0E-53
sp|A8MKR9|MNME_ALKOO tRNA modification GTPase MnmE OS=Alkaliphilus oremlandii (strain OhILAs) GN=mnmE PE=3 SV=1 63 426 1.0E-53
sp|Q8Z9U2|MNME_YERPE tRNA modification GTPase MnmE OS=Yersinia pestis GN=mnmE PE=3 SV=1 61 569 1.0E-53
sp|Q814F6|MNME_BACCR tRNA modification GTPase MnmE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mnmE PE=3 SV=1 64 428 1.0E-53
sp|B1KUB2|MNME_CLOBM tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mnmE PE=3 SV=1 64 569 2.0E-53
sp|Q48TS5|MNME_STRPM tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mnmE PE=3 SV=1 64 428 2.0E-53
sp|A6TG09|MNME_KLEP7 tRNA modification GTPase MnmE OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mnmE PE=3 SV=1 63 569 2.0E-53
sp|A4Y199|MNME_PSEMY tRNA modification GTPase MnmE OS=Pseudomonas mendocina (strain ymp) GN=mnmE PE=3 SV=1 64 569 2.0E-53
sp|Q926U7|MNME_LISIN tRNA modification GTPase MnmE OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mnmE PE=3 SV=1 64 569 2.0E-53
sp|Q71VV0|MNME_LISMF tRNA modification GTPase MnmE OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mnmE PE=3 SV=1 64 569 3.0E-53
sp|C4K7P4|MNME_HAMD5 tRNA modification GTPase MnmE OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=mnmE PE=3 SV=1 64 569 3.0E-53
sp|P0DG23|MNME_STRPQ tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mnmE PE=3 SV=1 64 569 3.0E-53
sp|P0DG22|MNME_STRP3 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mnmE PE=3 SV=1 64 569 3.0E-53
sp|C6DK97|MNME_PECCP tRNA modification GTPase MnmE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mnmE PE=3 SV=1 61 569 3.0E-53
sp|Q1JH22|MNME_STRPD tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mnmE PE=3 SV=1 64 428 3.0E-53
sp|Q8P161|MNME_STRP8 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mnmE PE=3 SV=1 64 428 3.0E-53
sp|Q6HAF2|MNME_BACHK tRNA modification GTPase MnmE OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mnmE PE=3 SV=1 64 430 3.0E-53
sp|Q81JD9|MNME_BACAN tRNA modification GTPase MnmE OS=Bacillus anthracis GN=mnmE PE=3 SV=1 64 430 3.0E-53
sp|Q630B8|MNME_BACCZ tRNA modification GTPase MnmE OS=Bacillus cereus (strain ZK / E33L) GN=mnmE PE=3 SV=1 64 430 4.0E-53
sp|Q033L0|MNME_LACC3 tRNA modification GTPase MnmE OS=Lactobacillus casei (strain ATCC 334) GN=mnmE PE=3 SV=1 64 569 4.0E-53
sp|Q1JLX3|MNME_STRPC tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mnmE PE=3 SV=1 64 428 4.0E-53
sp|B1YGA8|MNME_EXIS2 tRNA modification GTPase MnmE OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mnmE PE=3 SV=1 64 569 4.0E-53
sp|A2REM7|MNME_STRPG tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mnmE PE=3 SV=1 64 428 4.0E-53
sp|A5UID5|MNME_HAEIG tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain PittGG) GN=mnmE PE=3 SV=1 64 569 5.0E-53
sp|A6LMN4|MNME_THEM4 tRNA modification GTPase MnmE OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mnmE PE=3 SV=1 64 569 5.0E-53
sp|Q99ZU0|MNME_STRP1 tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M1 GN=mnmE PE=3 SV=1 64 428 6.0E-53
sp|A1AXX6|MNME_PARDP tRNA modification GTPase MnmE OS=Paracoccus denitrificans (strain Pd 1222) GN=mnmE PE=3 SV=1 64 378 6.0E-53
sp|Q1J6U1|MNME_STRPF tRNA modification GTPase MnmE OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mnmE PE=3 SV=1 64 428 6.0E-53
sp|A4ITX1|MNME_GEOTN tRNA modification GTPase MnmE OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mnmE PE=3 SV=1 64 569 7.0E-53
sp|A8F732|MNME_PSELT tRNA modification GTPase MnmE OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mnmE PE=3 SV=1 64 569 8.0E-53
sp|B1IHR9|MNME_CLOBK tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Okra / Type B1) GN=mnmE PE=3 SV=1 64 569 8.0E-53
sp|A5I816|MNME_CLOBH tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mnmE PE=3 SV=1 64 569 8.0E-53
sp|A7FPM0|MNME_CLOB1 tRNA modification GTPase MnmE OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mnmE PE=3 SV=1 64 569 8.0E-53
sp|A7GJN9|MNME_CLOBL tRNA modification GTPase MnmE OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mnmE PE=3 SV=1 64 569 8.0E-53
sp|A0RLR2|MNME_BACAH tRNA modification GTPase MnmE OS=Bacillus thuringiensis (strain Al Hakam) GN=mnmE PE=3 SV=1 64 430 9.0E-53
sp|Q72WU3|MNME_BACC1 tRNA modification GTPase MnmE OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mnmE PE=3 SV=1 64 430 1.0E-52
sp|A4J9S1|MNME_DESRM tRNA modification GTPase MnmE OS=Desulfotomaculum reducens (strain MI-1) GN=mnmE PE=3 SV=1 63 569 1.0E-52
sp|Q0BWA8|MNME_HYPNA tRNA modification GTPase MnmE OS=Hyphomonas neptunium (strain ATCC 15444) GN=mnmE PE=3 SV=1 61 378 1.0E-52
sp|Q1GXL7|MNME_METFK tRNA modification GTPase MnmE OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mnmE PE=3 SV=1 64 569 1.0E-52
sp|Q28VZ6|MNME_JANSC tRNA modification GTPase MnmE OS=Jannaschia sp. (strain CCS1) GN=mnmE PE=3 SV=1 65 382 1.0E-52
sp|P43730|MNME_HAEIN tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mnmE PE=3 SV=2 64 569 2.0E-52
sp|Q8Y3M4|MNME_LISMO tRNA modification GTPase MnmE OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mnmE PE=3 SV=1 64 569 2.0E-52
sp|P0C8P1|MNME_THEEB tRNA modification GTPase MnmE OS=Thermosynechococcus elongatus (strain BP-1) GN=mnmE PE=3 SV=1 64 569 2.0E-52
sp|P0C8N9|MNME_SYNEL tRNA modification GTPase MnmE OS=Synechococcus elongatus GN=mnmE PE=3 SV=1 64 569 2.0E-52
sp|A5N451|MNME_CLOK5 tRNA modification GTPase MnmE OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mnmE PE=3 SV=1 64 569 2.0E-52
sp|A6T4D6|MNME_JANMA tRNA modification GTPase MnmE OS=Janthinobacterium sp. (strain Marseille) GN=mnmE PE=3 SV=1 66 569 3.0E-52
sp|Q4QLQ9|MNME_HAEI8 tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain 86-028NP) GN=mnmE PE=3 SV=1 64 569 3.0E-52
sp|Q1GP64|MNME_SPHAL tRNA modification GTPase MnmE OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=mnmE PE=3 SV=1 81 569 3.0E-52
sp|A5UD71|MNME_HAEIE tRNA modification GTPase MnmE OS=Haemophilus influenzae (strain PittEE) GN=mnmE PE=3 SV=1 64 569 3.0E-52
sp|B0TAB6|MNME_HELMI tRNA modification GTPase MnmE OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mnmE PE=3 SV=1 64 569 3.0E-52
sp|Q7WDI4|MNME_BORBR tRNA modification GTPase MnmE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mnmE PE=3 SV=1 74 569 3.0E-52
sp|A1S1G4|MNME_SHEAM tRNA modification GTPase MnmE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mnmE PE=3 SV=1 64 569 4.0E-52
sp|B2UPK5|MNME_AKKM8 tRNA modification GTPase MnmE OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=mnmE PE=3 SV=1 78 569 4.0E-52
sp|Q7W2J0|MNME_BORPA tRNA modification GTPase MnmE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mnmE PE=3 SV=1 74 569 5.0E-52
sp|Q7VSR5|MNME_BORPE tRNA modification GTPase MnmE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mnmE PE=3 SV=1 74 569 6.0E-52
sp|A0LE48|MNME_MAGMM tRNA modification GTPase MnmE OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mnmE PE=3 SV=1 64 569 6.0E-52
sp|Q477Q5|MNME_DECAR tRNA modification GTPase MnmE OS=Dechloromonas aromatica (strain RCB) GN=mnmE PE=3 SV=1 64 569 7.0E-52
sp|Q9RCA7|MNME_BACHD tRNA modification GTPase MnmE OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mnmE PE=3 SV=1 64 569 7.0E-52
sp|B0S3V2|MNME_FINM2 tRNA modification GTPase MnmE OS=Finegoldia magna (strain ATCC 29328) GN=mnmE PE=3 SV=1 63 569 7.0E-52
sp|P0A176|MNME_PSEPU tRNA modification GTPase MnmE OS=Pseudomonas putida GN=mnmE PE=3 SV=1 64 569 1.0E-51
sp|P0A175|MNME_PSEPK tRNA modification GTPase MnmE OS=Pseudomonas putida (strain KT2440) GN=mnmE PE=3 SV=1 64 569 1.0E-51
sp|A5WBB6|MNME_PSEP1 tRNA modification GTPase MnmE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mnmE PE=3 SV=1 64 569 1.0E-51
sp|Q8DPZ8|MNME_STRR6 tRNA modification GTPase MnmE OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=mnmE PE=3 SV=2 64 428 1.0E-51
sp|Q04KR8|MNME_STRP2 tRNA modification GTPase MnmE OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mnmE PE=3 SV=1 64 428 1.0E-51
sp|B1IBH5|MNME_STRPI tRNA modification GTPase MnmE OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mnmE PE=3 SV=1 64 428 1.0E-51
sp|Q7VE01|MNME_PROMA tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mnmE PE=3 SV=1 61 569 2.0E-51
sp|A4GAN2|MNME_HERAR tRNA modification GTPase MnmE OS=Herminiimonas arsenicoxydans GN=mnmE PE=3 SV=1 66 569 2.0E-51
sp|A9KLX9|MNME_CLOPH tRNA modification GTPase MnmE OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mnmE PE=3 SV=1 64 569 2.0E-51
sp|A3DHY8|MNME_CLOTH tRNA modification GTPase MnmE OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mnmE PE=3 SV=1 63 569 2.0E-51
sp|A9IJ97|MNME_BORPD tRNA modification GTPase MnmE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=mnmE PE=3 SV=1 54 569 3.0E-51
sp|Q21DG1|MNME_SACD2 tRNA modification GTPase MnmE OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mnmE PE=3 SV=1 62 569 4.0E-51
sp|Q2Y5A9|MNME_NITMU tRNA modification GTPase MnmE OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=mnmE PE=3 SV=1 64 569 4.0E-51
sp|Q97R24|MNME_STRPN tRNA modification GTPase MnmE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=mnmE PE=3 SV=1 64 428 4.0E-51
sp|Q1I2H5|MNME_PSEE4 tRNA modification GTPase MnmE OS=Pseudomonas entomophila (strain L48) GN=mnmE PE=3 SV=1 64 569 5.0E-51
sp|Q5FHQ5|MNME_LACAC tRNA modification GTPase MnmE OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mnmE PE=3 SV=1 64 569 7.0E-51
sp|Q6CYQ9|MNME_PECAS tRNA modification GTPase MnmE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mnmE PE=3 SV=1 61 569 7.0E-51
sp|Q8DTT8|MNME_STRMU tRNA modification GTPase MnmE OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mnmE PE=3 SV=1 64 428 9.0E-51
sp|A0PX77|MNME_CLONN tRNA modification GTPase MnmE OS=Clostridium novyi (strain NT) GN=mnmE PE=3 SV=1 64 569 9.0E-51
sp|A2RP37|MNME_LACLM tRNA modification GTPase MnmE OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mnmE PE=3 SV=1 64 432 9.0E-51
sp|Q8Y3H5|MNME_RALSO tRNA modification GTPase MnmE OS=Ralstonia solanacearum (strain GMI1000) GN=mnmE PE=3 SV=2 51 569 1.0E-50
sp|Q8CX54|MNME_OCEIH tRNA modification GTPase MnmE OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mnmE PE=3 SV=1 64 569 1.0E-50
sp|Q6F6L1|MNME_ACIAD tRNA modification GTPase MnmE OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mnmE PE=3 SV=1 65 569 1.0E-50
sp|Q8XH30|MNME_CLOPE tRNA modification GTPase MnmE OS=Clostridium perfringens (strain 13 / Type A) GN=mnmE PE=3 SV=1 64 569 1.0E-50
sp|Q0TLZ4|MNME_CLOP1 tRNA modification GTPase MnmE OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mnmE PE=3 SV=1 64 569 1.0E-50
sp|Q03KR8|MNME_STRTD tRNA modification GTPase MnmE OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mnmE PE=3 SV=1 64 419 2.0E-50
sp|Q5LZW3|MNME_STRT1 tRNA modification GTPase MnmE OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mnmE PE=3 SV=1 64 419 2.0E-50
sp|B0K8H9|MNME_THEP3 tRNA modification GTPase MnmE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mnmE PE=3 SV=1 64 569 2.0E-50
sp|A6TXE5|MNME_ALKMQ tRNA modification GTPase MnmE OS=Alkaliphilus metalliredigens (strain QYMF) GN=mnmE PE=3 SV=1 63 430 2.0E-50
sp|Q0SPQ3|MNME_CLOPS tRNA modification GTPase MnmE OS=Clostridium perfringens (strain SM101 / Type A) GN=mnmE PE=3 SV=1 64 569 2.0E-50
sp|Q0HD65|MNME_SHESM tRNA modification GTPase MnmE OS=Shewanella sp. (strain MR-4) GN=mnmE PE=3 SV=1 64 569 2.0E-50
sp|B0K5N4|MNME_THEPX tRNA modification GTPase MnmE OS=Thermoanaerobacter sp. (strain X514) GN=mnmE PE=3 SV=1 64 569 2.0E-50
sp|Q13SH7|MNME_BURXL tRNA modification GTPase MnmE OS=Burkholderia xenovorans (strain LB400) GN=mnmE PE=3 SV=1 64 569 2.0E-50
sp|Q5M4H3|MNME_STRT2 tRNA modification GTPase MnmE OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mnmE PE=3 SV=1 64 419 2.0E-50
sp|Q21QM5|MNME_RHOFT tRNA modification GTPase MnmE OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mnmE PE=3 SV=1 60 569 2.0E-50
sp|Q9CDH8|MNME_LACLA tRNA modification GTPase MnmE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mnmE PE=3 SV=1 64 522 3.0E-50
sp|B0JVV0|MNME_MICAN tRNA modification GTPase MnmE OS=Microcystis aeruginosa (strain NIES-843) GN=mnmE PE=3 SV=1 64 569 3.0E-50
sp|Q02VP7|MNME_LACLS tRNA modification GTPase MnmE OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mnmE PE=3 SV=1 64 432 4.0E-50
sp|Q30YQ7|MNME_DESAG tRNA modification GTPase MnmE OS=Desulfovibrio alaskensis (strain G20) GN=mnmE PE=3 SV=1 64 569 4.0E-50
sp|Q0HPE7|MNME_SHESR tRNA modification GTPase MnmE OS=Shewanella sp. (strain MR-7) GN=mnmE PE=3 SV=1 64 569 5.0E-50
sp|A0KR31|MNME_SHESA tRNA modification GTPase MnmE OS=Shewanella sp. (strain ANA-3) GN=mnmE PE=3 SV=1 64 569 5.0E-50
sp|A1T0N0|MNME_PSYIN tRNA modification GTPase MnmE OS=Psychromonas ingrahamii (strain 37) GN=mnmE PE=3 SV=1 64 569 5.0E-50
sp|Q7V395|MNME_PROMP tRNA modification GTPase MnmE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=mnmE PE=3 SV=1 62 569 5.0E-50
sp|Q0I6N5|MNME_SYNS3 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain CC9311) GN=mnmE PE=3 SV=1 67 569 5.0E-50
sp|A6Q3D6|MNME_NITSB tRNA modification GTPase MnmE OS=Nitratiruptor sp. (strain SB155-2) GN=mnmE PE=3 SV=1 62 569 6.0E-50
sp|Q9CLQ1|MNME_PASMU tRNA modification GTPase MnmE OS=Pasteurella multocida (strain Pm70) GN=mnmE PE=3 SV=1 64 569 8.0E-50
sp|B0KRC0|MNME_PSEPG tRNA modification GTPase MnmE OS=Pseudomonas putida (strain GB-1) GN=mnmE PE=3 SV=1 64 569 8.0E-50
sp|A1AXR3|MNME_RUTMC tRNA modification GTPase MnmE OS=Ruthia magnifica subsp. Calyptogena magnifica GN=mnmE PE=3 SV=1 61 569 8.0E-50
sp|A7ZAW1|MNME_BACMF tRNA modification GTPase MnmE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mnmE PE=3 SV=1 64 419 8.0E-50
sp|A1VUS4|MNME_POLNA tRNA modification GTPase MnmE OS=Polaromonas naphthalenivorans (strain CJ2) GN=mnmE PE=3 SV=1 66 569 9.0E-50
sp|A1TWI4|MNME_ACIAC tRNA modification GTPase MnmE OS=Acidovorax citrulli (strain AAC00-1) GN=mnmE PE=3 SV=1 60 569 9.0E-50
sp|Q5E8Z9|MNME_VIBF1 tRNA modification GTPase MnmE OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mnmE PE=3 SV=1 64 569 9.0E-50
sp|Q4K396|MNME_PSEF5 tRNA modification GTPase MnmE OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mnmE PE=3 SV=1 64 569 1.0E-49
sp|Q2RFI8|MNME_MOOTA tRNA modification GTPase MnmE OS=Moorella thermoacetica (strain ATCC 39073) GN=mnmE PE=3 SV=1 63 569 1.0E-49
sp|A8YTQ7|MNME_LACH4 tRNA modification GTPase MnmE OS=Lactobacillus helveticus (strain DPC 4571) GN=mnmE PE=3 SV=1 64 569 1.0E-49
sp|A6QAL0|MNME_SULNB tRNA modification GTPase MnmE OS=Sulfurovum sp. (strain NBC37-1) GN=mnmE PE=3 SV=1 64 569 1.0E-49
sp|Q1Q7V4|MNME_PSYCK tRNA modification GTPase MnmE OS=Psychrobacter cryohalolentis (strain K5) GN=mnmE PE=3 SV=2 65 569 2.0E-49
sp|Q30T75|MNME_SULDN tRNA modification GTPase MnmE OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=mnmE PE=3 SV=1 62 428 2.0E-49
sp|A9KX19|MNME_SHEB9 tRNA modification GTPase MnmE OS=Shewanella baltica (strain OS195) GN=mnmE PE=3 SV=1 64 569 2.0E-49
sp|Q9RL97|MNME_STRAG tRNA modification GTPase MnmE OS=Streptococcus agalactiae GN=mnmE PE=3 SV=1 64 428 2.0E-49
sp|A5IKF4|MNME_THEP1 tRNA modification GTPase MnmE OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mnmE PE=3 SV=1 64 569 3.0E-49
sp|Q2LSF6|MNME_SYNAS tRNA modification GTPase MnmE OS=Syntrophus aciditrophicus (strain SB) GN=mnmE PE=3 SV=1 64 569 3.0E-49
sp|B1HPM3|MNME_LYSSC tRNA modification GTPase MnmE OS=Lysinibacillus sphaericus (strain C3-41) GN=mnmE PE=3 SV=1 64 569 3.0E-49
sp|A6WUK3|MNME_SHEB8 tRNA modification GTPase MnmE OS=Shewanella baltica (strain OS185) GN=mnmE PE=3 SV=1 64 569 3.0E-49
sp|A1WDB4|MNME_ACISJ tRNA modification GTPase MnmE OS=Acidovorax sp. (strain JS42) GN=mnmE PE=3 SV=2 60 569 4.0E-49
sp|B0TYD1|MNME_FRAP2 tRNA modification GTPase MnmE OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mnmE PE=3 SV=1 62 569 4.0E-49
sp|Q0VKU8|MNME_ALCBS tRNA modification GTPase MnmE OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mnmE PE=3 SV=1 61 569 5.0E-49
sp|A8FJG0|MNME_BACP2 tRNA modification GTPase MnmE OS=Bacillus pumilus (strain SAFR-032) GN=mnmE PE=3 SV=1 64 428 5.0E-49
sp|Q88RX5|MNME_LACPL tRNA modification GTPase MnmE OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mnmE PE=3 SV=1 64 569 5.0E-49
sp|Q0I0Z2|MNME_HAES1 tRNA modification GTPase MnmE OS=Haemophilus somnus (strain 129Pt) GN=mnmE PE=3 SV=1 62 569 6.0E-49
sp|A5CY46|MNME_PELTS tRNA modification GTPase MnmE OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mnmE PE=3 SV=1 63 569 7.0E-49
sp|Q11TG8|MNME_CYTH3 tRNA modification GTPase MnmE OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mnmE PE=3 SV=1 66 569 8.0E-49
sp|Q5QZJ5|MNME_IDILO tRNA modification GTPase MnmE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mnmE PE=3 SV=1 63 569 9.0E-49
sp|Q3IK56|MNME_PSEHT tRNA modification GTPase MnmE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mnmE PE=3 SV=1 62 569 9.0E-49
sp|Q02DE1|MNME_PSEAB tRNA modification GTPase MnmE OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mnmE PE=3 SV=1 61 569 1.0E-48
sp|Q65CN1|MNME_BACLD tRNA modification GTPase MnmE OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mnmE PE=3 SV=1 64 428 1.0E-48
sp|A1U7J3|MNME_MARHV tRNA modification GTPase MnmE OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mnmE PE=3 SV=1 59 569 1.0E-48
sp|Q15MS9|MNME_PSEA6 tRNA modification GTPase MnmE OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mnmE PE=3 SV=1 64 569 1.0E-48
sp|Q3ANQ3|MNME_CHLCH tRNA modification GTPase MnmE OS=Chlorobium chlorochromatii (strain CaD3) GN=mnmE PE=3 SV=1 63 569 1.0E-48
sp|Q87TR6|MNME_VIBPA tRNA modification GTPase MnmE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mnmE PE=3 SV=1 64 569 1.0E-48
sp|Q1LH94|MNME_CUPMC tRNA modification GTPase MnmE OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=mnmE PE=3 SV=1 66 569 1.0E-48
sp|Q2KTI2|MNME_BORA1 tRNA modification GTPase MnmE OS=Bordetella avium (strain 197N) GN=mnmE PE=3 SV=1 66 569 1.0E-48
sp|Q7MVZ2|MNME_PORGI tRNA modification GTPase MnmE OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mnmE PE=3 SV=2 62 569 1.0E-48
sp|Q87TS2|MNME_PSESM tRNA modification GTPase MnmE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mnmE PE=3 SV=1 64 569 1.0E-48
sp|Q899S2|MNME_CLOTE tRNA modification GTPase MnmE OS=Clostridium tetani (strain Massachusetts / E88) GN=mnmE PE=3 SV=1 64 443 2.0E-48
sp|Q040F3|MNME_LACGA tRNA modification GTPase MnmE OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mnmE PE=3 SV=1 64 569 2.0E-48
sp|Q820T0|MNME_ENTFA tRNA modification GTPase MnmE OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mnmE PE=3 SV=1 64 419 2.0E-48
sp|Q5P4P5|MNME_AROAE tRNA modification GTPase MnmE OS=Aromatoleum aromaticum (strain EbN1) GN=mnmE PE=3 SV=1 60 569 2.0E-48
sp|Q0A4L6|MNME_ALKEH tRNA modification GTPase MnmE OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mnmE PE=3 SV=1 65 569 2.0E-48
sp|Q8CX52|MNME_SHEON tRNA modification GTPase MnmE OS=Shewanella oneidensis (strain MR-1) GN=mnmE PE=3 SV=2 62 569 2.0E-48
sp|P25811|MNME_BACSU tRNA modification GTPase MnmE OS=Bacillus subtilis (strain 168) GN=mnmE PE=3 SV=1 64 423 3.0E-48
sp|Q047F9|MNME_LACDB tRNA modification GTPase MnmE OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mnmE PE=3 SV=1 58 569 3.0E-48
sp|Q1G7Z4|MNME_LACDA tRNA modification GTPase MnmE OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mnmE PE=3 SV=1 58 569 3.0E-48
sp|Q72D51|MNME_DESVH tRNA modification GTPase MnmE OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mnmE PE=3 SV=1 63 569 3.0E-48
sp|Q74H94|MNME_LACJO tRNA modification GTPase MnmE OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mnmE PE=3 SV=1 64 569 4.0E-48
sp|Q48BF3|MNME_PSE14 tRNA modification GTPase MnmE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mnmE PE=3 SV=1 64 569 4.0E-48
sp|Q03N64|MNME_LACBA tRNA modification GTPase MnmE OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mnmE PE=3 SV=1 64 569 4.0E-48
sp|Q38UE9|MNME_LACSS tRNA modification GTPase MnmE OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mnmE PE=3 SV=1 64 569 4.0E-48
sp|B1KQ64|MNME_SHEWM tRNA modification GTPase MnmE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mnmE PE=3 SV=1 64 569 4.0E-48
sp|A7N0X8|MNME_VIBCB tRNA modification GTPase MnmE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mnmE PE=3 SV=1 64 569 4.0E-48
sp|Q0ATU5|MNME_SYNWW tRNA modification GTPase MnmE OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mnmE PE=3 SV=1 64 432 4.0E-48
sp|A9M0N5|MNME_NEIM0 tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C (strain 053442) GN=mnmE PE=3 SV=1 65 569 5.0E-48
sp|A3DAS7|MNME_SHEB5 tRNA modification GTPase MnmE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mnmE PE=3 SV=2 62 569 5.0E-48
sp|Q3K429|MNME_PSEPF tRNA modification GTPase MnmE OS=Pseudomonas fluorescens (strain Pf0-1) GN=mnmE PE=3 SV=1 64 569 5.0E-48
sp|Q6LW56|MNME_PHOPR tRNA modification GTPase MnmE OS=Photobacterium profundum GN=mnmE PE=3 SV=1 64 569 6.0E-48
sp|Q1LTV8|MNME_BAUCH tRNA modification GTPase MnmE OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mnmE PE=3 SV=1 64 569 7.0E-48
sp|B0URU2|MNME_HISS2 tRNA modification GTPase MnmE OS=Histophilus somni (strain 2336) GN=mnmE PE=3 SV=1 62 569 7.0E-48
sp|Q44633|MNME_BUCAP tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mnmE PE=3 SV=1 63 380 8.0E-48
sp|Q9HT07|MNME_PSEAE tRNA modification GTPase MnmE OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mnmE PE=3 SV=1 61 569 8.0E-48
sp|B4RRB9|MNME_NEIG2 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mnmE PE=3 SV=1 65 569 1.0E-47
sp|Q5F529|MNME_NEIG1 tRNA modification GTPase MnmE OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mnmE PE=3 SV=1 65 569 1.0E-47
sp|A5EY43|MNME_DICNV tRNA modification GTPase MnmE OS=Dichelobacter nodosus (strain VCS1703A) GN=mnmE PE=3 SV=1 62 569 1.0E-47
sp|Q9JWB7|MNME_NEIMA tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mnmE PE=3 SV=1 65 569 1.0E-47
sp|Q7U344|MNME_HAEDU tRNA modification GTPase MnmE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mnmE PE=3 SV=1 64 569 1.0E-47
sp|Q5KU57|MNME_GEOKA tRNA modification GTPase MnmE OS=Geobacillus kaustophilus (strain HTA426) GN=mnmE PE=3 SV=1 64 569 1.0E-47
sp|A0KBN1|MNME_BURCH tRNA modification GTPase MnmE OS=Burkholderia cenocepacia (strain HI2424) GN=mnmE PE=3 SV=1 64 569 1.0E-47
sp|Q1BSF9|MNME_BURCA tRNA modification GTPase MnmE OS=Burkholderia cenocepacia (strain AU 1054) GN=mnmE PE=3 SV=1 64 569 1.0E-47
sp|A1VER5|MNME_DESVV tRNA modification GTPase MnmE OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mnmE PE=3 SV=1 63 569 2.0E-47
sp|A7GYZ1|MNME_CAMC5 tRNA modification GTPase MnmE OS=Campylobacter curvus (strain 525.92) GN=mnmE PE=3 SV=1 60 425 2.0E-47
sp|Q9JXL4|MNME_NEIMB tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup B (strain MC58) GN=mnmE PE=3 SV=1 65 569 2.0E-47
sp|A5IXJ1|MNME_MYCAP tRNA modification GTPase MnmE OS=Mycoplasma agalactiae (strain PG2) GN=mnmE PE=3 SV=1 63 569 2.0E-47
sp|Q4L2Z2|MNME_STAHJ tRNA modification GTPase MnmE OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mnmE PE=3 SV=1 64 440 2.0E-47
sp|Q181S7|MNME_PEPD6 tRNA modification GTPase MnmE OS=Peptoclostridium difficile (strain 630) GN=mnmE PE=3 SV=1 63 569 2.0E-47
sp|A4STS4|MNME_AERS4 tRNA modification GTPase MnmE OS=Aeromonas salmonicida (strain A449) GN=mnmE PE=3 SV=1 62 569 2.0E-47
sp|P97043|MNME_LEPIN tRNA modification GTPase MnmE OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mnmE PE=3 SV=3 63 569 2.0E-47
sp|Q5X0M3|MNME_LEGPA tRNA modification GTPase MnmE OS=Legionella pneumophila (strain Paris) GN=mnmE PE=3 SV=1 62 569 3.0E-47
sp|Q72VY6|MNME_LEPIC tRNA modification GTPase MnmE OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mnmE PE=3 SV=1 63 569 3.0E-47
sp|Q5WSF0|MNME_LEGPL tRNA modification GTPase MnmE OS=Legionella pneumophila (strain Lens) GN=mnmE PE=3 SV=1 62 569 3.0E-47
sp|Q5ZR82|MNME_LEGPH tRNA modification GTPase MnmE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mnmE PE=3 SV=1 62 569 3.0E-47
sp|Q4ZL12|MNME_PSEU2 tRNA modification GTPase MnmE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mnmE PE=3 SV=1 64 569 3.0E-47
sp|B1K0Y2|MNME_BURCC tRNA modification GTPase MnmE OS=Burkholderia cenocepacia (strain MC0-3) GN=mnmE PE=3 SV=1 64 569 3.0E-47
sp|Q602M5|MNME_METCA tRNA modification GTPase MnmE OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mnmE PE=3 SV=1 64 391 3.0E-47
sp|A5CVJ3|MNME_VESOH tRNA modification GTPase MnmE OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=mnmE PE=3 SV=1 61 382 4.0E-47
sp|A4T0N1|MNME_POLSQ tRNA modification GTPase MnmE OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=mnmE PE=3 SV=1 66 569 4.0E-47
sp|A5IIK3|MNME_LEGPC tRNA modification GTPase MnmE OS=Legionella pneumophila (strain Corby) GN=mnmE PE=3 SV=1 62 569 4.0E-47
sp|Q7M901|MNME_WOLSU tRNA modification GTPase MnmE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=mnmE PE=3 SV=2 56 569 5.0E-47
sp|Q39BQ4|MNME_BURL3 tRNA modification GTPase MnmE OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mnmE PE=3 SV=2 64 569 5.0E-47
sp|A1RQE8|MNME_SHESW tRNA modification GTPase MnmE OS=Shewanella sp. (strain W3-18-1) GN=mnmE PE=3 SV=1 64 569 5.0E-47
sp|Q39PQ9|MNME_GEOMG tRNA modification GTPase MnmE OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mnmE PE=3 SV=1 63 569 5.0E-47
sp|A4YCM1|MNME_SHEPC tRNA modification GTPase MnmE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mnmE PE=3 SV=1 64 569 6.0E-47
sp|Q9KVY5|MNME_VIBCH tRNA modification GTPase MnmE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mnmE PE=3 SV=2 62 569 6.0E-47
sp|A8YYS1|MNME_STAAT tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mnmE PE=3 SV=1 64 569 6.0E-47
sp|A6QKK2|MNME_STAAE tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain Newman) GN=mnmE PE=3 SV=1 64 569 6.0E-47
sp|Q5HCI3|MNME_STAAC tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain COL) GN=mnmE PE=3 SV=1 64 569 6.0E-47
sp|Q2FDE8|MNME_STAA3 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain USA300) GN=mnmE PE=3 SV=1 64 569 6.0E-47
sp|Q85FG3|MNME_CYAME Probable tRNA modification GTPase MnmE OS=Cyanidioschyzon merolae GN=mnmE PE=3 SV=1 64 569 6.0E-47
sp|A1KCP8|MNME_AZOSB tRNA modification GTPase MnmE OS=Azoarcus sp. (strain BH72) GN=mnmE PE=3 SV=1 60 569 8.0E-47
sp|A5VA82|MNME_SPHWW tRNA modification GTPase MnmE OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mnmE PE=3 SV=1 51 382 9.0E-47
sp|A5F485|MNME_VIBC3 tRNA modification GTPase MnmE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mnmE PE=3 SV=2 62 569 1.0E-46
sp|B1JFV3|MNME_PSEPW tRNA modification GTPase MnmE OS=Pseudomonas putida (strain W619) GN=mnmE PE=3 SV=1 64 569 1.0E-46
sp|Q0KFG6|MNME_CUPNH tRNA modification GTPase MnmE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mnmE PE=3 SV=2 66 569 1.0E-46
sp|B0BR82|MNME_ACTPJ tRNA modification GTPase MnmE OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mnmE PE=3 SV=1 64 569 1.0E-46
sp|A0KQZ6|MNME_AERHH tRNA modification GTPase MnmE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mnmE PE=3 SV=1 62 569 1.0E-46
sp|Q4FPR8|MNME_PSYA2 tRNA modification GTPase MnmE OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=mnmE PE=3 SV=1 65 569 1.0E-46
sp|Q3AGU7|MNME_SYNSC tRNA modification GTPase MnmE OS=Synechococcus sp. (strain CC9605) GN=mnmE PE=3 SV=1 74 382 2.0E-46
sp|Q3MBM5|MNME_ANAVT tRNA modification GTPase MnmE OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mnmE PE=3 SV=1 65 569 2.0E-46
sp|Q8YN91|MNME_NOSS1 tRNA modification GTPase MnmE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mnmE PE=1 SV=1 65 569 2.0E-46
sp|A6W3V0|MNME_MARMS tRNA modification GTPase MnmE OS=Marinomonas sp. (strain MWYL1) GN=mnmE PE=3 SV=1 64 569 2.0E-46
sp|Q8RHA2|MNME_FUSNN tRNA modification GTPase MnmE OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=mnmE PE=3 SV=1 64 569 2.0E-46
sp|A9NE34|MNME_ACHLI tRNA modification GTPase MnmE OS=Acholeplasma laidlawii (strain PG-8A) GN=mnmE PE=3 SV=1 65 569 2.0E-46
sp|Q07VS7|MNME_SHEFN tRNA modification GTPase MnmE OS=Shewanella frigidimarina (strain NCIMB 400) GN=mnmE PE=3 SV=1 64 569 2.0E-46
sp|Q121L2|MNME_POLSJ tRNA modification GTPase MnmE OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=mnmE PE=3 SV=1 64 569 2.0E-46
sp|A2SMI8|MNME_METPP tRNA modification GTPase MnmE OS=Methylibium petroleiphilum (strain PM1) GN=mnmE PE=3 SV=2 60 569 2.0E-46
sp|Q8KPU2|MNME_SYNE7 tRNA modification GTPase MnmE OS=Synechococcus elongatus (strain PCC 7942) GN=mnmE PE=3 SV=3 62 569 3.0E-46
sp|Q2NQ72|MNME_SODGM tRNA modification GTPase MnmE OS=Sodalis glossinidius (strain morsitans) GN=mnmE PE=3 SV=1 64 382 3.0E-46
sp|Q39ZT0|MNME_PELCD tRNA modification GTPase MnmE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mnmE PE=3 SV=2 62 569 3.0E-46
sp|Q8CMN5|MNME_STAES tRNA modification GTPase MnmE OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mnmE PE=3 SV=1 64 569 4.0E-46
sp|Q5HS36|MNME_STAEQ tRNA modification GTPase MnmE OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mnmE PE=3 SV=1 64 569 4.0E-46
sp|A3N2D8|MNME_ACTP2 tRNA modification GTPase MnmE OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=mnmE PE=3 SV=1 64 569 5.0E-46
sp|A1WSU0|MNME_VEREI tRNA modification GTPase MnmE OS=Verminephrobacter eiseniae (strain EF01-2) GN=mnmE PE=3 SV=1 64 569 5.0E-46
sp|Q9WYA4|MNME_THEMA tRNA modification GTPase MnmE OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mnmE PE=1 SV=1 64 569 5.0E-46
sp|Q12HM9|MNME_SHEDO tRNA modification GTPase MnmE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mnmE PE=3 SV=2 64 569 5.0E-46
sp|A1KW66|MNME_NEIMF tRNA modification GTPase MnmE OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mnmE PE=3 SV=1 65 388 7.0E-46
sp|Q746Q3|MNME_GEOSL tRNA modification GTPase MnmE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mnmE PE=3 SV=1 63 569 8.0E-46
sp|Q1WVH7|MNME_LACS1 tRNA modification GTPase MnmE OS=Lactobacillus salivarius (strain UCC118) GN=mnmE PE=3 SV=1 60 569 9.0E-46
sp|Q10VJ7|MNME_TRIEI tRNA modification GTPase MnmE OS=Trichodesmium erythraeum (strain IMS101) GN=mnmE PE=3 SV=1 64 569 9.0E-46
sp|Q46VM0|MNME_CUPPJ tRNA modification GTPase MnmE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mnmE PE=3 SV=1 66 569 1.0E-45
sp|Q5WAG3|MNME_BACSK tRNA modification GTPase MnmE OS=Bacillus clausii (strain KSM-K16) GN=mnmE PE=3 SV=1 64 569 1.0E-45
sp|B0RMM4|MNME_XANCB tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. campestris (strain B100) GN=mnmE PE=3 SV=1 61 569 1.0E-45
sp|Q47U36|MNME_COLP3 tRNA modification GTPase MnmE OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mnmE PE=3 SV=1 74 569 1.0E-45
sp|A4XN51|MNME_CALS8 tRNA modification GTPase MnmE OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mnmE PE=3 SV=1 105 569 1.0E-45
sp|Q2JSU8|MNME_SYNJA tRNA modification GTPase MnmE OS=Synechococcus sp. (strain JA-3-3Ab) GN=mnmE PE=3 SV=1 75 569 1.0E-45
sp|Q65VC3|MNME_MANSM tRNA modification GTPase MnmE OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mnmE PE=3 SV=1 62 569 1.0E-45
sp|Q5N638|MNME_SYNP6 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mnmE PE=3 SV=2 62 569 2.0E-45
sp|Q2NIG1|MNME_AYWBP tRNA modification GTPase MnmE OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=mnmE PE=3 SV=1 64 569 2.0E-45
sp|Q2JIE6|MNME_SYNJB tRNA modification GTPase MnmE OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mnmE PE=3 SV=1 75 390 2.0E-45
sp|Q6APY7|MNME_DESPS tRNA modification GTPase MnmE OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mnmE PE=3 SV=2 61 569 2.0E-45
sp|Q7MQK6|MNME_VIBVY tRNA modification GTPase MnmE OS=Vibrio vulnificus (strain YJ016) GN=mnmE PE=3 SV=2 64 569 2.0E-45
sp|A3QJT0|MNME_SHELP tRNA modification GTPase MnmE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mnmE PE=3 SV=1 64 569 2.0E-45
sp|Q8DDI1|MNME_VIBVU tRNA modification GTPase MnmE OS=Vibrio vulnificus (strain CMCP6) GN=mnmE PE=3 SV=1 64 569 3.0E-45
sp|Q0BAQ4|MNME_BURCM tRNA modification GTPase MnmE OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mnmE PE=3 SV=2 64 569 3.0E-45
sp|B1L9N6|MNME_THESQ tRNA modification GTPase MnmE OS=Thermotoga sp. (strain RQ2) GN=mnmE PE=3 SV=1 64 569 4.0E-45
sp|Q7V491|MNME_PROMM tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9313) GN=mnmE PE=3 SV=1 74 371 4.0E-45
sp|Q8P340|MNME_XANCP tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mnmE PE=3 SV=1 65 569 4.0E-45
sp|Q4UNL0|MNME_XANC8 tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mnmE PE=3 SV=1 65 569 4.0E-45
sp|B1YQJ5|MNME_BURA4 tRNA modification GTPase MnmE OS=Burkholderia ambifaria (strain MC40-6) GN=mnmE PE=3 SV=1 64 569 5.0E-45
sp|A7ZCZ1|MNME_CAMC1 tRNA modification GTPase MnmE OS=Campylobacter concisus (strain 13826) GN=mnmE PE=3 SV=1 64 455 5.0E-45
sp|A2CDC4|MNME_PROM3 tRNA modification GTPase MnmE OS=Prochlorococcus marinus (strain MIT 9303) GN=mnmE PE=3 SV=1 74 371 6.0E-45
sp|Q03D59|MNME_PEDPA tRNA modification GTPase MnmE OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mnmE PE=3 SV=1 64 428 7.0E-45
sp|B1XKC3|MNME_SYNP2 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mnmE PE=3 SV=1 64 419 1.0E-44
sp|B0TQH0|MNME_SHEHH tRNA modification GTPase MnmE OS=Shewanella halifaxensis (strain HAW-EB4) GN=mnmE PE=3 SV=1 64 569 2.0E-44
sp|Q67J33|MNME_SYMTH tRNA modification GTPase MnmE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mnmE PE=3 SV=2 62 569 2.0E-44
sp|A6VQS6|MNME_ACTSZ tRNA modification GTPase MnmE OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mnmE PE=3 SV=1 64 569 2.0E-44
sp|Q8KAS1|MNME_CHLTE tRNA modification GTPase MnmE OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mnmE PE=1 SV=1 53 569 2.0E-44
sp|A5G9V3|MNME_GEOUR tRNA modification GTPase MnmE OS=Geobacter uraniireducens (strain Rf4) GN=mnmE PE=3 SV=1 64 569 2.0E-44
sp|A5GW82|MNME_SYNR3 tRNA modification GTPase MnmE OS=Synechococcus sp. (strain RCC307) GN=mnmE PE=3 SV=1 80 390 2.0E-44
sp|Q1QS99|MNME_CHRSD tRNA modification GTPase MnmE OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mnmE PE=3 SV=1 64 569 3.0E-44
sp|Q9RVL1|MNME_DEIRA tRNA modification GTPase MnmE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mnmE PE=3 SV=1 55 382 4.0E-44
sp|Q7NHT3|MNME_GLOVI tRNA modification GTPase MnmE OS=Gloeobacter violaceus (strain PCC 7421) GN=mnmE PE=3 SV=1 64 569 7.0E-44
sp|A4JJ44|MNME_BURVG tRNA modification GTPase MnmE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mnmE PE=3 SV=1 64 569 7.0E-44
sp|P66973|MNME_STAAW tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain MW2) GN=mnmE PE=3 SV=1 64 569 8.0E-44
sp|Q6GD92|MNME_STAAR tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain MRSA252) GN=mnmE PE=3 SV=1 64 569 8.0E-44
sp|P66972|MNME_STAAN tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain N315) GN=mnmE PE=3 SV=1 64 569 8.0E-44
sp|A5IWD7|MNME_STAA9 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain JH9) GN=mnmE PE=3 SV=1 64 569 8.0E-44
sp|Q2FUQ2|MNME_STAA8 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain NCTC 8325) GN=mnmE PE=3 SV=1 64 569 8.0E-44
sp|A6U595|MNME_STAA2 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain JH1) GN=mnmE PE=3 SV=1 64 569 8.0E-44
sp|Q6G5W4|MNME_STAAS tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain MSSA476) GN=mnmE PE=3 SV=1 64 569 1.0E-43
sp|A8Z5X0|MNME_SULMW tRNA modification GTPase MnmE OS=Sulcia muelleri (strain GWSS) GN=mnmE PE=3 SV=1 62 380 1.0E-43
sp|Q2YZB8|MNME_STAAB tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mnmE PE=3 SV=1 64 569 1.0E-43
sp|A0RNG2|MNME_CAMFF tRNA modification GTPase MnmE OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=mnmE PE=3 SV=1 65 448 1.0E-43
sp|A5GPA1|MNME_SYNPW tRNA modification GTPase MnmE OS=Synechococcus sp. (strain WH7803) GN=mnmE PE=3 SV=1 74 419 1.0E-43
sp|B7J1B2|MNME_BORBZ tRNA modification GTPase MnmE OS=Borrelia burgdorferi (strain ZS7) GN=mnmE PE=3 SV=1 63 569 2.0E-43
sp|P53364|MNME_BORBU tRNA modification GTPase MnmE OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mnmE PE=3 SV=2 63 569 2.0E-43
sp|A0LLH5|MNME_SYNFM tRNA modification GTPase MnmE OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mnmE PE=3 SV=1 129 569 2.0E-43
sp|Q2NX54|MNME_XANOM tRNA modification GTPase MnmE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mnmE PE=3 SV=1 61 569 2.0E-43
sp|B8HSJ3|MNME_CYAP4 tRNA modification GTPase MnmE OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=mnmE PE=3 SV=1 65 569 2.0E-43
sp|Q6MFA3|MNME_PARUW tRNA modification GTPase MnmE OS=Protochlamydia amoebophila (strain UWE25) GN=mnmE PE=3 SV=1 58 419 2.0E-43
sp|Q2S6H2|MNME_SALRD tRNA modification GTPase MnmE OS=Salinibacter ruber (strain DSM 13855 / M31) GN=mnmE PE=3 SV=1 64 569 3.0E-43
sp|Q058F5|MNME_BUCCC tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=mnmE PE=3 SV=1 103 569 3.0E-43
sp|Q6KH82|MNME_MYCMO tRNA modification GTPase MnmE OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=mnmE PE=3 SV=1 64 420 3.0E-43
sp|P73839|MNME_SYNY3 tRNA modification GTPase MnmE OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mnmE PE=3 SV=1 63 569 3.0E-43
sp|P59569|MNME_BUCBP tRNA modification GTPase MnmE OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mnmE PE=3 SV=1 63 569 4.0E-43
sp|A8HAH9|MNME_SHEPA tRNA modification GTPase MnmE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mnmE PE=3 SV=1 64 382 4.0E-43
sp|Q931E1|MNME_STAAM tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mnmE PE=3 SV=1 64 569 5.0E-43
sp|A7X7A8|MNME_STAA1 tRNA modification GTPase MnmE OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mnmE PE=3 SV=1 64 569 5.0E-43
sp|Q8D3I9|MNME_WIGBR tRNA modification GTPase MnmE OS=Wigglesworthia glossinidia brevipalpis GN=mnmE PE=3 SV=1 64 569 6.0E-43
sp|Q3BLZ9|MNME_XANC5 tRNA modification GTPase MnmE OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mnmE PE=3 SV=1 61 569 6.0E-43
sp|Q7U3V6|MNME_SYNPX tRNA modification GTPase MnmE OS=Synechococcus sp. (strain WH8102) GN=mnmE PE=3 SV=1 74 382 7.0E-43
sp|A8FP41|MNME_SHESH tRNA modification GTPase MnmE OS=Shewanella sediminis (strain HAW-EB3) GN=mnmE PE=3 SV=1 64 382 8.0E-43
sp|A8EV95|MNME_ARCB4 tRNA modification GTPase MnmE OS=Arcobacter butzleri (strain RM4018) GN=mnmE PE=3 SV=1 63 422 8.0E-43
sp|Q2A342|MNME_FRATH tRNA modification GTPase MnmE OS=Francisella tularensis subsp. holarctica (strain LVS) GN=mnmE PE=3 SV=1 62 569 9.0E-43
sp|A7NCL5|MNME_FRATF tRNA modification GTPase MnmE OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=mnmE PE=3 SV=1 62 569 9.0E-43
sp|Q72K85|MNME_THET2 tRNA modification GTPase MnmE OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mnmE PE=3 SV=1 64 389 1.0E-42
sp|Q0BLL9|MNME_FRATO tRNA modification GTPase MnmE OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=mnmE PE=3 SV=1 62 569 1.0E-42
sp|Q5GTT5|MNME_XANOR tRNA modification GTPase MnmE OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mnmE PE=3 SV=2 61 569 1.0E-42
sp|B0CBB0|MNME_ACAM1 tRNA modification GTPase MnmE OS=Acaryochloris marina (strain MBIC 11017) GN=mnmE PE=3 SV=1 75 569 1.0E-42
sp|B1Y0F6|MNME_LEPCP tRNA modification GTPase MnmE OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=mnmE PE=3 SV=1 60 569 1.0E-42
sp|A5FGE0|MNME_FLAJ1 tRNA modification GTPase MnmE OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mnmE PE=3 SV=1 64 442 1.0E-42
sp|C0QXH9|MNME_BRAHW tRNA modification GTPase MnmE OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=mnmE PE=3 SV=1 64 569 1.0E-42
sp|B2SUV8|MNME_XANOP tRNA modification GTPase MnmE OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mnmE PE=3 SV=1 61 569 2.0E-42
sp|Q04XE4|MNME_LEPBL tRNA modification GTPase MnmE OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mnmE PE=3 SV=1 63 569 2.0E-42
sp|Q04W28|MNME_LEPBJ tRNA modification GTPase MnmE OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mnmE PE=3 SV=1 63 569 2.0E-42
sp|Q1J154|MNME_DEIGD tRNA modification GTPase MnmE OS=Deinococcus geothermalis (strain DSM 11300) GN=mnmE PE=3 SV=1 59 382 2.0E-42
sp|A6VF44|MNME_PSEA7 tRNA modification GTPase MnmE OS=Pseudomonas aeruginosa (strain PA7) GN=mnmE PE=3 SV=1 74 569 2.0E-42
sp|A1VZU7|MNME_CAMJJ tRNA modification GTPase MnmE OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=mnmE PE=3 SV=1 64 569 3.0E-42
sp|Q0SNY5|MNME_BORAP tRNA modification GTPase MnmE OS=Borrelia afzelii (strain PKo) GN=mnmE PE=3 SV=1 63 569 4.0E-42
sp|A1BCU6|MNME_CHLPD tRNA modification GTPase MnmE OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mnmE PE=3 SV=1 64 569 4.0E-42
sp|B3ETH9|MNME_AMOA5 tRNA modification GTPase MnmE OS=Amoebophilus asiaticus (strain 5a2) GN=mnmE PE=3 SV=1 66 380 5.0E-42
sp|A4IX14|MNME_FRATW tRNA modification GTPase MnmE OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=mnmE PE=3 SV=1 99 569 6.0E-42
sp|Q6MGL5|MNME_BDEBA tRNA modification GTPase MnmE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=mnmE PE=3 SV=1 64 439 6.0E-42
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8015
MLRRLARTQELACASRRSWCLVVLAVHCRAPVPARGTTPRPARARSHYSWPSSSASAHRPASDDTIYALSTAHGR
AGIAVVRISGSSCVDVYRALCPLQKLPQPRYAAVRSLHSPHKADKADADILDPQALVILFPGPRTVTGQDVLELH
LHGGLATVRAVLAAIARCPASHRIRYAEPGEFTRRAFANGRLDLAQVEALGDALAADTEQQRRAAVRGNSGALGR
TYELWRHQLLLARGELEALIDFAEDQHFDEQPAHLLANVARQVRAIIHSIHLHQLGGQRSELLRAGIRIALLGPP
NVGKSSLMNLVVGRQASIVSDEAGTTRDVVEANLDLHGFLCCFADTAGFRSMDSTNAVGAVEAEGIRRAKQKAQE
SDIILVLASIERGQSGPFVYYDEQTLQLAAAADNCLVLVNKRDMVDQITLSKLLHAFRATLAQTSKKLVATPLQV
ISCRQDEQTPSNGPDASGLQSLTDALVDVFSNMTKMPAGLEDALGVTERQIQLLGKCRQHLEDFDAEAHSDESFG
GDVVLAAEYLRYAADCLARLTGKGEIGDVEDVLGVVFEKFCVGK*
Coding >OphauB2|8015
ATGCTTCGGCGCTTGGCTCGGACGCAGGAATTGGCCTGCGCATCGCGGCGGAGCTGGTGCCTCGTGGTTTTGGCC
GTCCACTGCCGGGCCCCTGTGCCAGCAAGAGGCACGACACCACGGCCAGCCAGGGCACGCAGCCATTACTCATGG
CCGTCGTCATCTGCGTCTGCACACCGTCCAGCCTCGGACGACACCATCTATGCCCTGTCGACAGCCCATGGGCGA
GCCGGAATCGCCGTCGTCCGTATTTCTGGGTCTTCGTGCGTGGATGTCTACCGTGCCCTGTGTCCCCTCCAGAAG
CTGCCCCAGCCCAGGTACGCGGCAGTGCGCTCGCTCCATTCGCCGCACAAGGCAGACAAGGCAGACGCAGACATT
CTTGACCCACAGGCCCTCGTCATCCTCTTCCCGGGCCCCAGGACCGTTACGGGTCAGGACGTCTTGGAGCTGCAT
CTCCATGGCGGCTTAGCCACGGTGAGGGCGGTGCTGGCTGCCATTGCTCGCTGCCCAGCCAGCCACCGCATACGC
TATGCCGAGCCGGGCGAGTTCACCAGGCGCGCCTTTGCCAATGGACGCCTGGACCTGGCCCAGGTGGAAGCCCTG
GGCGATGCCCTGGCGGCAGACACGGAGCAGCAGCGCCGTGCGGCGGTCCGCGGCAACTCGGGCGCTCTGGGACGC
ACTTACGAGCTGTGGCGTCACCAGCTGCTGCTGGCGCGCGGCGAGTTGGAGGCCCTCATTGACTTTGCAGAGGAC
CAGCACTTTGACGAGCAGCCTGCCCACCTGTTGGCCAATGTGGCGCGCCAGGTTCGCGCCATTATCCACTCGATC
CATTTGCACCAACTTGGCGGCCAGAGGAGCGAGTTGCTCAGAGCAGGAATCCGTATTGCTCTGTTGGGCCCGCCC
AATGTCGGTAAGAGCTCGCTCATGAACCTCGTCGTTGGTCGCCAAGCGTCCATTGTGTCGGACGAGGCCGGCACC
ACCCGAGATGTCGTCGAGGCCAACCTGGACCTGCATGGCTTTCTTTGTTGCTTTGCTGATACGGCCGGCTTCCGG
TCCATGGATTCGACCAATGCGGTTGGCGCAGTGGAAGCAGAGGGCATCAGGCGAGCCAAGCAGAAGGCCCAAGAG
TCAGACATCATCTTGGTCCTTGCATCCATTGAGCGCGGCCAGTCTGGACCATTTGTGTATTATGACGAGCAAACT
TTGCAGCTTGCGGCAGCGGCTGACAATTGTCTCGTACTCGTCAACAAACGAGACATGGTGGATCAGATTACTCTG
TCCAAGCTTCTCCATGCTTTCCGCGCCACGCTTGCCCAGACAAGCAAAAAACTAGTCGCTACTCCTCTCCAGGTG
ATATCCTGCCGCCAAGACGAGCAAACGCCGTCCAATGGCCCAGACGCTAGCGGCCTGCAAAGCTTGACGGACGCC
CTGGTTGATGTTTTCTCAAACATGACCAAGATGCCAGCCGGGCTCGAAGATGCCTTGGGCGTGACGGAGCGCCAA
ATCCAGTTGCTTGGCAAGTGTCGTCAGCATCTCGAAGACTTTGACGCCGAGGCGCACTCGGATGAGAGCTTTGGC
GGCGACGTCGTCTTGGCAGCTGAGTATCTGAGATATGCGGCCGACTGTCTTGCGCGGCTCACGGGCAAAGGCGAA
ATTGGAGACGTTGAGGATGTCTTGGGTGTTGTTTTTGAAAAGTTTTGTGTGGGCAAGTAA
Transcript >OphauB2|8015
ATGCTTCGGCGCTTGGCTCGGACGCAGGAATTGGCCTGCGCATCGCGGCGGAGCTGGTGCCTCGTGGTTTTGGCC
GTCCACTGCCGGGCCCCTGTGCCAGCAAGAGGCACGACACCACGGCCAGCCAGGGCACGCAGCCATTACTCATGG
CCGTCGTCATCTGCGTCTGCACACCGTCCAGCCTCGGACGACACCATCTATGCCCTGTCGACAGCCCATGGGCGA
GCCGGAATCGCCGTCGTCCGTATTTCTGGGTCTTCGTGCGTGGATGTCTACCGTGCCCTGTGTCCCCTCCAGAAG
CTGCCCCAGCCCAGGTACGCGGCAGTGCGCTCGCTCCATTCGCCGCACAAGGCAGACAAGGCAGACGCAGACATT
CTTGACCCACAGGCCCTCGTCATCCTCTTCCCGGGCCCCAGGACCGTTACGGGTCAGGACGTCTTGGAGCTGCAT
CTCCATGGCGGCTTAGCCACGGTGAGGGCGGTGCTGGCTGCCATTGCTCGCTGCCCAGCCAGCCACCGCATACGC
TATGCCGAGCCGGGCGAGTTCACCAGGCGCGCCTTTGCCAATGGACGCCTGGACCTGGCCCAGGTGGAAGCCCTG
GGCGATGCCCTGGCGGCAGACACGGAGCAGCAGCGCCGTGCGGCGGTCCGCGGCAACTCGGGCGCTCTGGGACGC
ACTTACGAGCTGTGGCGTCACCAGCTGCTGCTGGCGCGCGGCGAGTTGGAGGCCCTCATTGACTTTGCAGAGGAC
CAGCACTTTGACGAGCAGCCTGCCCACCTGTTGGCCAATGTGGCGCGCCAGGTTCGCGCCATTATCCACTCGATC
CATTTGCACCAACTTGGCGGCCAGAGGAGCGAGTTGCTCAGAGCAGGAATCCGTATTGCTCTGTTGGGCCCGCCC
AATGTCGGTAAGAGCTCGCTCATGAACCTCGTCGTTGGTCGCCAAGCGTCCATTGTGTCGGACGAGGCCGGCACC
ACCCGAGATGTCGTCGAGGCCAACCTGGACCTGCATGGCTTTCTTTGTTGCTTTGCTGATACGGCCGGCTTCCGG
TCCATGGATTCGACCAATGCGGTTGGCGCAGTGGAAGCAGAGGGCATCAGGCGAGCCAAGCAGAAGGCCCAAGAG
TCAGACATCATCTTGGTCCTTGCATCCATTGAGCGCGGCCAGTCTGGACCATTTGTGTATTATGACGAGCAAACT
TTGCAGCTTGCGGCAGCGGCTGACAATTGTCTCGTACTCGTCAACAAACGAGACATGGTGGATCAGATTACTCTG
TCCAAGCTTCTCCATGCTTTCCGCGCCACGCTTGCCCAGACAAGCAAAAAACTAGTCGCTACTCCTCTCCAGGTG
ATATCCTGCCGCCAAGACGAGCAAACGCCGTCCAATGGCCCAGACGCTAGCGGCCTGCAAAGCTTGACGGACGCC
CTGGTTGATGTTTTCTCAAACATGACCAAGATGCCAGCCGGGCTCGAAGATGCCTTGGGCGTGACGGAGCGCCAA
ATCCAGTTGCTTGGCAAGTGTCGTCAGCATCTCGAAGACTTTGACGCCGAGGCGCACTCGGATGAGAGCTTTGGC
GGCGACGTCGTCTTGGCAGCTGAGTATCTGAGATATGCGGCCGACTGTCTTGCGCGGCTCACGGGCAAAGGCGAA
ATTGGAGACGTTGAGGATGTCTTGGGTGTTGTTTTTGAAAAGTTTTGTGTGGGCAAGTAA
Gene >OphauB2|8015
ATGCTTCGGCGCTTGGCTCGGACGCAGGAATTGGCCTGCGCATCGCGGCGGAGCTGGTGCCTCGTGGTTTTGGCC
GTCCACTGCCGGGCCCCTGTGCCAGCAAGAGGCACGACACCACGGCCAGCCAGGGCACGCAGCCATTACTCATGG
CCGTCGTCATCTGCGTCTGCACACCGTCCAGCCTCGGACGACACCATCTATGCCCTGTCGACAGCCCATGGGCGA
GCCGGAATCGCCGTCGTCCGTATTTCTGGGTCTTCGTGCGTGGATGTGAGACATGGGCGTTCGCCGCCGACTGGC
TCCCTGGCTGACGCCCTCTTCTCTTACTCGTCGTGTCTGCCTTCAAGGTCTACCGTGCCCTGTGTCCCCTCCAGA
AGCTGCCCCAGCCCAGGTACGCGGCAGTGCGCTCGCTCCATTCGCCGCACAAGGCAGACAAGGCAGACGCAGACA
TTCTTGACCCACAGGCCCTCGTCATCCTCTTCCCGGGCCCCAGGACCGTTACGGGTCAGGACGTCTTGGAGCTGC
ATCTCCATGGCGGCTTAGCCACGGTGAGGGCGGTGCTGGCTGCCATTGCTCGCTGCCCAGCCAGCCACCGCATAC
GCTATGCCGAGCCGGGCGAGTTCACCAGGCGCGCCTTTGCCAATGGACGCCTGGACCTGGCCCAGGTGGAAGCCC
TGGGCGATGCCCTGGCGGCAGACACGGAGCAGCAGCGCCGTGCGGCGGTCCGCGGCAACTCGGGCGCTCTGGGAC
GCACTTACGAGCTGTGGCGTCACCAGCTGCTGCTGGCGCGCGGCGAGTTGGAGGCCCTCATTGACTTTGCAGAGG
ACCAGCACTTTGACGAGCAGCCTGCCCACCTGTTGGCCAATGTGGCGCGCCAGGTTCGCGCCATTATCCACTCGA
TCCATTTGCACCAACTTGGCGGCCAGAGGAGCGAGTTGCTCAGAGCAGGAATCCGTATTGCTCTGTTGGGCCCGC
CCAATGTCGGTAAGAGCTCGCTCATGAACCTCGTCGTTGGTCGCCAAGCGTCCATTGTGTCGGACGAGGCCGGCA
CCACCCGAGATGTCGTCGAGGCCAACCTGGACCTGCATGGCTTTCTTTGTTGCTTTGCTGATACGGCCGGCTTCC
GGTCCATGGATTCGACCAATGCGGTTGGCGCAGTGGAAGCAGAGGGCATCAGGCGAGCCAAGCAGAAGGCCCAAG
AGTCAGACATCATCTTGGTCCTTGCATCCATTGAGCGCGGCCAGTCTGGACCATTTGTGTATTATGACGAGCAAA
CTTTGCAGCTTGCGGCAGCGGCTGACAATTGTCTCGTACTCGTCAACAAACGAGACATGGTGGATCAGATTACTC
TGTCCAAGCTTCTCCATGCTTTCCGCGCCACGCTTGCCCAGACAAGCAAAAAACTAGTCGCTACTCCTCTCCAGG
TGATATCCTGCCGCCAAGACGAGCAAACGCCGTCCAATGGCCCAGACGCTAGCGGCCTGCAAAGCTTGACGGACG
CCCTGGTTGATGTTTTCTCAAACATGACCAAGATGCCAGCCGGGCTCGAAGATGCCTTGGGCGTGACGGAGCGCC
AAATCCAGTTGCTTGGCAAGTGTCGTCAGCATCTCGAAGACTTTGACGCCGAGGCGCACTCGGATGAGAGCTTTG
GCGGCGACGTCGTCTTGGCAGCTGAGTATCTGAGATATGCGGCCGACTGTCTTGCGCGGCTCACGGGCAAAGGCG
AAATTGGAGACGTTGAGGATGTCTTGGGTGTTGTTTTTGAAAAGTGAGTCGTCGACCCCGCCAGTGGCACAAGAT
TCACTAGAATGACTTTGGAAGCAGGTTTTGTGTGGGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail