Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|8008
Gene name
LocationContig_93:65074..70216
Strand-
Gene length (bp)5142
Transcript length (bp)5142
Coding sequence length (bp)5142
Protein length (aa) 1714

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 1031 1053 22
2 1066 1088 22
3 1098 1117 19
4 1184 1206 22
5 1216 1235 19
6 1297 1319 22
7 1334 1356 22
8 1380 1402 22
9 1412 1434 22
10 1470 1492 22
11 1502 1524 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|8008
MDAGDFDETPAPSCRPSLMGLRNDDDGGSSPPARAGGVRHHLLKTSTSGPTIVDKEFPAPPILSPSLVASDAVAL
AQSPADELENKFPFLPLGQLSTVPNSPYPRMEQQDNAAPPSVALMERTSPFIPPASGGKHTRSLRHGQDGSAHSM
VPSRDSSLRVLTPQDEAHVTITDPNRTIDNASVTLSCIGLSPAASDNDCYSRTSKVGPAFEEDYGQHSIIFDRYS
GKNCRAFSKKVGPFDAHFEHEADLKPDQAHFLSGSSTAVSWTDLRDGLHRDSQVWNSEANSDVIITTLSRAFQRY
TPKVGPFVDGQVMSSAEQCKAPSPRKPTGQQYLTKDQIMDTRPPVVIPHGPKLSPPYARYISKVGPYVESDMETD
DMREHDSPSHSGSLTPTHEFLPVPGAKVRPFVDHGGISHLRTAHHHLPKVQAFSHSTPPSALPRDIALSQCQRCN
GPRGAETHAAEQPVLAHDAASRRDGVARDDYFSPKLQGKHSLSLDPEYRVCSGAEHTLNACSDQWAAWRQEQIEG
SQHSSRTSTLHSFVQDSEAHGSASGQQVRVEEAVPIMAKQDGRRDKSHVSGRLQTARGTSDYIHAPVPVSKVRPH
FQEYSYNERASSTNESHGAVSKVQAAALEATQSGGEDDGQDCSKWQRQDRLEQPTEQESRASGRSHSLGSILDYK
RTAQWLRGILKHREVRTVRFTEGPGRYKQDQPQVDEDRRNSESVVPSRRYTVAGPASSNKPESDFDGHEFRQAVG
QLEHLLNEAFAIASQAIDRPRVPSETRGKPPSLGPDSRHGSVAEAEHEDEGSHDELTPPGAPQGSDDRHGAELWE
VDSTRPPIYRHAATYSGAARRPRLCEIIKNYSNEGSEFRRASSVDEDEQTGSETQDGKIKVVCYVPRRKSSRGTA
KLDKTTLETRDKDGQGKASQAAARHGDEVQGVKEVRMELSPELRSHYEHSRARPMRSIEPHAMASDGDEAIGEGD
LPDHDIAGRPLHTNHGISLRRRSHISLQGAGGFNLSKSRKRQPTARDWSPVRKRFVASVACISTALVGVILGIYA
GIVPSVQYYLIDQSHFTVHGNTGCFLGLALPTLFLWPLPLLHGRKPYILSSLVLAMPLLFPQALAVYSQRLTKTV
SWRGMLLASRTVMGMSLGFASMNFHSTLMDLFGASLMSVNPHQEVVDHYDARRHGGGMGVWLGIWTWCWIGSLAV
GFLVGATIIDNCPPAWGFYVSIMLIAVVLFLNVVCPEVRRSAFRRSVAEVRTGSDVSRRLARGEIMMHRVKTGPR
WWGQEVYHGVALSLEMVSQPGFATLALYSAWIYAQVVLIIVLLGSLTSRFYRLRSPQVGLLVGAMALGALLAIPF
QKANVFSRSRQKQMNTNLATLNRKVAWSSHLVRRTIFTLLLPLVGICYAAVSSGPPMHVSVPTIFSTAVGFLSCL
AIAECNGLVMETFDCSDLSPGMTGRQRSGDGKSPKRTNYSSFPRVSAGFAAIHGLAFVLAAGATALGGLVTRTLG
QQVSTGVVAAILFILTVMLLLILARFTEAQIVPRCKSEEMDRVVEARRRSTVRRASMPNSHEAVMEEERAWQPVM
MGNPTGKKRRMNVLELGKLSRWQEIRRRNKLIDSGIHANRAVFDRGMEALQDYVGNFEHTGAQNLTAKSKAGRKT
PRRPRRVQSGAVRADECVELEVLDLDEGGLRARRNMDTGCVMSQTMTEESNDGAARFGRRGEH*
Coding >OphauB2|8008
ATGGACGCTGGCGACTTTGATGAGACACCGGCTCCCAGTTGCCGTCCGTCTCTAATGGGCCTTCGAAACGACGAC
GATGGAGGCTCATCACCTCCAGCACGAGCTGGGGGCGTTCGCCACCATTTGCTAAAGACGTCTACAAGCGGTCCC
ACCATTGTTGACAAGGAATTTCCTGCTCCTCCAATCCTTAGCCCATCTTTGGTGGCTAGCGATGCTGTTGCTCTG
GCTCAGTCGCCCGCAGATGAGCTTGAAAACAAGTTTCCCTTTCTTCCCCTAGGCCAGTTGTCGACAGTGCCAAAT
TCCCCGTATCCTCGGATGGAGCAACAAGACAATGCAGCGCCGCCATCTGTGGCCTTGATGGAACGGACTTCTCCC
TTTATTCCGCCGGCATCAGGAGGGAAGCATACTCGCAGCCTCCGCCATGGCCAGGATGGCTCAGCACACTCAATG
GTGCCGAGCCGAGATTCATCATTGCGAGTATTAACTCCGCAAGACGAGGCCCACGTCACAATAACGGACCCAAAT
AGAACAATAGACAATGCATCGGTAACGTTGTCATGTATTGGTCTGTCGCCTGCAGCATCCGACAATGACTGCTAT
AGTCGCACGTCCAAGGTTGGCCCTGCTTTTGAAGAGGATTACGGCCAGCATAGCATCATATTCGACAGGTACTCT
GGCAAAAATTGCCGGGCATTTTCGAAAAAAGTAGGCCCGTTTGATGCTCATTTCGAGCATGAGGCAGACTTGAAG
CCTGACCAGGCCCATTTCTTGTCTGGCTCATCAACAGCAGTTTCTTGGACTGACTTGCGCGACGGCTTGCACAGA
GACAGCCAAGTGTGGAACTCGGAAGCAAATTCGGATGTCATCATCACCACGTTGTCAAGGGCTTTTCAACGATAC
ACGCCCAAGGTTGGGCCATTTGTAGATGGCCAAGTCATGAGCTCTGCTGAGCAATGTAAGGCTCCATCACCCAGG
AAACCTACTGGCCAACAATATCTCACTAAAGACCAAATTATGGACACGAGGCCGCCTGTGGTGATTCCTCATGGG
CCCAAGTTGTCACCTCCATATGCACGCTATATATCCAAGGTTGGACCATATGTTGAATCGGACATGGAGACGGAT
GACATGCGCGAGCATGATAGTCCAAGCCACTCTGGCTCTTTGACTCCCACACACGAGTTTCTCCCTGTTCCCGGA
GCCAAAGTCAGGCCCTTTGTGGACCATGGCGGCATATCGCACTTGAGAACAGCACACCACCATTTGCCAAAGGTC
CAGGCCTTTTCGCACAGCACACCGCCCTCTGCACTACCTAGGGATATCGCCTTGAGCCAATGCCAGCGATGCAAT
GGGCCAAGAGGAGCCGAGACACATGCTGCAGAGCAGCCAGTTTTAGCCCACGATGCAGCGTCTCGGCGAGATGGT
GTTGCACGCGACGACTACTTTTCACCAAAGCTTCAAGGAAAGCACTCTCTTTCGCTTGATCCAGAGTATCGGGTT
TGCTCAGGGGCTGAGCACACGTTGAATGCATGTTCGGACCAGTGGGCGGCCTGGAGACAAGAGCAAATAGAGGGC
AGTCAACATTCGAGTCGGACCAGCACATTACATTCTTTTGTTCAAGACTCTGAAGCACACGGTTCAGCCTCTGGA
CAGCAAGTCCGTGTTGAAGAGGCAGTGCCCATCATGGCAAAACAGGATGGCCGCCGTGACAAATCTCATGTATCT
GGTCGCCTACAGACTGCAAGAGGCACCTCGGATTACATTCATGCTCCAGTCCCGGTTTCCAAGGTCCGACCACAC
TTTCAAGAGTACTCGTACAATGAACGCGCTTCGAGCACAAACGAGAGCCATGGCGCAGTATCAAAGGTGCAGGCT
GCAGCCCTGGAGGCGACGCAAAGTGGCGGTGAGGATGACGGCCAAGATTGTTCCAAGTGGCAGCGGCAGGACAGA
TTGGAGCAGCCGACAGAGCAAGAATCAAGGGCGTCGGGCCGCAGTCATTCCCTGGGCTCGATTTTGGACTACAAG
CGTACCGCTCAGTGGCTACGTGGCATTCTGAAGCATCGTGAAGTACGCACAGTCAGATTTACCGAGGGACCTGGC
AGGTACAAGCAAGACCAGCCGCAAGTCGACGAAGATCGACGCAACTCTGAGTCGGTTGTGCCATCGCGCCGCTAT
ACAGTGGCGGGTCCTGCTTCTTCGAACAAGCCAGAGTCTGATTTTGATGGACATGAGTTTAGACAGGCTGTAGGG
CAACTGGAACACCTCTTGAATGAGGCATTCGCTATTGCTTCTCAGGCCATTGACCGCCCAAGAGTGCCGTCTGAG
ACGCGAGGCAAGCCGCCATCACTTGGTCCTGATTCGCGCCATGGGAGCGTTGCCGAGGCAGAGCATGAGGATGAA
GGGTCACATGACGAGCTGACACCTCCCGGCGCCCCCCAAGGCTCTGACGACCGACATGGCGCAGAGCTGTGGGAG
GTTGATAGCACGAGACCCCCTATATATCGGCATGCGGCAACATACTCTGGAGCGGCGCGAAGACCACGGTTGTGC
GAAATTATTAAGAACTACTCAAATGAGGGCAGTGAGTTTAGACGGGCGAGCTCTGTCGACGAGGATGAACAGACT
GGAAGCGAAACGCAGGACGGCAAGATCAAGGTTGTCTGTTACGTTCCCCGGCGAAAATCAAGCCGGGGAACGGCC
AAATTGGACAAGACGACGCTGGAGACGAGAGACAAGGATGGTCAAGGCAAAGCAAGCCAAGCTGCTGCACGGCAC
GGAGATGAAGTGCAAGGAGTCAAGGAGGTGAGAATGGAGCTTAGTCCTGAACTCCGAAGCCATTACGAGCACTCC
CGAGCGAGACCAATGAGGAGCATTGAGCCACATGCCATGGCAAGCGATGGAGACGAGGCGATTGGCGAGGGCGAT
TTGCCGGATCATGACATTGCTGGGCGGCCCCTGCACACCAACCATGGCATCAGCCTGCGGCGGCGGTCCCATATC
AGTCTGCAAGGGGCTGGCGGCTTCAATCTCTCCAAGTCTCGCAAGCGGCAGCCCACAGCCAGAGACTGGTCGCCT
GTGCGCAAACGATTTGTGGCATCTGTGGCATGCATCAGCACTGCCCTGGTTGGCGTCATTTTGGGCATCTATGCT
GGCATTGTGCCGTCTGTGCAGTATTATCTCATTGACCAATCTCACTTTACCGTGCACGGCAACACGGGCTGCTTC
CTGGGCCTGGCTCTGCCGACACTGTTTTTGTGGCCGCTCCCCTTGCTCCACGGCCGCAAGCCATATATCCTGTCG
AGCCTGGTGCTTGCCATGCCGCTTCTCTTTCCCCAGGCACTCGCAGTCTACTCTCAGAGGCTCACCAAGACGGTC
TCGTGGAGAGGCATGCTTCTCGCTTCGCGGACCGTCATGGGCATGTCGCTTGGGTTCGCCAGCATGAACTTTCAC
TCGACACTAATGGATCTCTTTGGGGCCTCGTTGATGAGCGTGAATCCACACCAAGAGGTGGTGGACCATTATGAT
GCCCGGCGGCATGGAGGCGGCATGGGCGTGTGGCTTGGCATCTGGACTTGGTGCTGGATCGGCTCGCTGGCTGTG
GGCTTCTTGGTTGGAGCCACGATTATTGACAACTGCCCCCCGGCCTGGGGCTTTTACGTGAGCATCATGCTGATT
GCCGTGGTGCTCTTTCTCAATGTCGTTTGCCCCGAGGTGCGCCGCTCAGCCTTTCGGCGGTCCGTTGCCGAAGTG
AGGACGGGAAGCGACGTTTCGAGACGGCTTGCACGCGGCGAAATCATGATGCACCGCGTCAAGACTGGCCCTCGA
TGGTGGGGACAAGAGGTTTATCACGGCGTAGCCTTGTCGCTGGAAATGGTTAGCCAGCCCGGGTTTGCCACATTG
GCGCTCTACTCGGCCTGGATTTATGCCCAAGTGGTGCTGATTATTGTGCTTCTGGGTTCTCTGACTTCGCGATTT
TACCGTTTGCGCTCTCCGCAGGTTGGCCTCTTGGTGGGAGCCATGGCACTGGGCGCTCTGCTGGCGATTCCCTTT
CAAAAGGCCAATGTCTTTTCCAGGTCGCGGCAGAAGCAGATGAATACCAATCTGGCAACGCTGAACCGCAAGGTG
GCTTGGTCGTCTCATTTGGTTCGTCGAACCATTTTCACGCTGTTGCTGCCGCTCGTGGGCATTTGCTACGCGGCA
GTCTCGTCGGGCCCGCCAATGCATGTGAGCGTGCCTACGATATTCTCCACGGCGGTGGGCTTCTTGTCGTGTCTG
GCCATTGCCGAGTGCAATGGGCTGGTGATGGAGACGTTTGACTGCTCCGATTTGTCGCCAGGCATGACTGGGCGG
CAGCGCAGCGGAGATGGCAAGAGCCCGAAGCGGACCAATTACTCGTCGTTTCCCCGCGTGAGTGCAGGCTTTGCC
GCCATTCATGGGCTTGCCTTTGTGCTGGCTGCTGGGGCAACAGCGCTGGGCGGGCTGGTGACGAGGACTTTGGGC
CAGCAAGTGTCGACGGGCGTTGTGGCGGCCATTCTCTTCATCCTGACGGTGATGCTGTTGTTGATATTGGCGCGC
TTTACCGAGGCGCAGATTGTGCCCCGGTGCAAGTCTGAAGAAATGGACAGGGTTGTCGAGGCGCGGCGCCGATCA
ACGGTGCGTCGAGCGTCAATGCCGAATAGCCATGAAGCAGTCATGGAGGAGGAGAGGGCTTGGCAGCCCGTCATG
ATGGGCAATCCGACGGGCAAGAAGCGGCGCATGAATGTGCTGGAACTGGGCAAGCTGAGCCGCTGGCAGGAAATA
CGCAGGAGGAACAAGCTGATTGACTCGGGCATTCATGCCAACCGCGCCGTCTTTGATCGAGGCATGGAGGCGCTC
CAAGACTATGTGGGCAACTTTGAGCATACTGGCGCGCAAAACTTGACCGCCAAGAGTAAAGCAGGGCGCAAGACG
CCCCGACGGCCCCGTCGTGTCCAATCAGGCGCGGTGCGGGCTGATGAATGTGTGGAATTGGAGGTGCTTGACTTG
GATGAGGGCGGACTGAGAGCCCGGCGCAACATGGATACCGGGTGTGTCATGAGCCAGACGATGACTGAGGAAAGC
AATGACGGAGCGGCTAGATTTGGGCGACGAGGGGAGCACTGA
Transcript >OphauB2|8008
ATGGACGCTGGCGACTTTGATGAGACACCGGCTCCCAGTTGCCGTCCGTCTCTAATGGGCCTTCGAAACGACGAC
GATGGAGGCTCATCACCTCCAGCACGAGCTGGGGGCGTTCGCCACCATTTGCTAAAGACGTCTACAAGCGGTCCC
ACCATTGTTGACAAGGAATTTCCTGCTCCTCCAATCCTTAGCCCATCTTTGGTGGCTAGCGATGCTGTTGCTCTG
GCTCAGTCGCCCGCAGATGAGCTTGAAAACAAGTTTCCCTTTCTTCCCCTAGGCCAGTTGTCGACAGTGCCAAAT
TCCCCGTATCCTCGGATGGAGCAACAAGACAATGCAGCGCCGCCATCTGTGGCCTTGATGGAACGGACTTCTCCC
TTTATTCCGCCGGCATCAGGAGGGAAGCATACTCGCAGCCTCCGCCATGGCCAGGATGGCTCAGCACACTCAATG
GTGCCGAGCCGAGATTCATCATTGCGAGTATTAACTCCGCAAGACGAGGCCCACGTCACAATAACGGACCCAAAT
AGAACAATAGACAATGCATCGGTAACGTTGTCATGTATTGGTCTGTCGCCTGCAGCATCCGACAATGACTGCTAT
AGTCGCACGTCCAAGGTTGGCCCTGCTTTTGAAGAGGATTACGGCCAGCATAGCATCATATTCGACAGGTACTCT
GGCAAAAATTGCCGGGCATTTTCGAAAAAAGTAGGCCCGTTTGATGCTCATTTCGAGCATGAGGCAGACTTGAAG
CCTGACCAGGCCCATTTCTTGTCTGGCTCATCAACAGCAGTTTCTTGGACTGACTTGCGCGACGGCTTGCACAGA
GACAGCCAAGTGTGGAACTCGGAAGCAAATTCGGATGTCATCATCACCACGTTGTCAAGGGCTTTTCAACGATAC
ACGCCCAAGGTTGGGCCATTTGTAGATGGCCAAGTCATGAGCTCTGCTGAGCAATGTAAGGCTCCATCACCCAGG
AAACCTACTGGCCAACAATATCTCACTAAAGACCAAATTATGGACACGAGGCCGCCTGTGGTGATTCCTCATGGG
CCCAAGTTGTCACCTCCATATGCACGCTATATATCCAAGGTTGGACCATATGTTGAATCGGACATGGAGACGGAT
GACATGCGCGAGCATGATAGTCCAAGCCACTCTGGCTCTTTGACTCCCACACACGAGTTTCTCCCTGTTCCCGGA
GCCAAAGTCAGGCCCTTTGTGGACCATGGCGGCATATCGCACTTGAGAACAGCACACCACCATTTGCCAAAGGTC
CAGGCCTTTTCGCACAGCACACCGCCCTCTGCACTACCTAGGGATATCGCCTTGAGCCAATGCCAGCGATGCAAT
GGGCCAAGAGGAGCCGAGACACATGCTGCAGAGCAGCCAGTTTTAGCCCACGATGCAGCGTCTCGGCGAGATGGT
GTTGCACGCGACGACTACTTTTCACCAAAGCTTCAAGGAAAGCACTCTCTTTCGCTTGATCCAGAGTATCGGGTT
TGCTCAGGGGCTGAGCACACGTTGAATGCATGTTCGGACCAGTGGGCGGCCTGGAGACAAGAGCAAATAGAGGGC
AGTCAACATTCGAGTCGGACCAGCACATTACATTCTTTTGTTCAAGACTCTGAAGCACACGGTTCAGCCTCTGGA
CAGCAAGTCCGTGTTGAAGAGGCAGTGCCCATCATGGCAAAACAGGATGGCCGCCGTGACAAATCTCATGTATCT
GGTCGCCTACAGACTGCAAGAGGCACCTCGGATTACATTCATGCTCCAGTCCCGGTTTCCAAGGTCCGACCACAC
TTTCAAGAGTACTCGTACAATGAACGCGCTTCGAGCACAAACGAGAGCCATGGCGCAGTATCAAAGGTGCAGGCT
GCAGCCCTGGAGGCGACGCAAAGTGGCGGTGAGGATGACGGCCAAGATTGTTCCAAGTGGCAGCGGCAGGACAGA
TTGGAGCAGCCGACAGAGCAAGAATCAAGGGCGTCGGGCCGCAGTCATTCCCTGGGCTCGATTTTGGACTACAAG
CGTACCGCTCAGTGGCTACGTGGCATTCTGAAGCATCGTGAAGTACGCACAGTCAGATTTACCGAGGGACCTGGC
AGGTACAAGCAAGACCAGCCGCAAGTCGACGAAGATCGACGCAACTCTGAGTCGGTTGTGCCATCGCGCCGCTAT
ACAGTGGCGGGTCCTGCTTCTTCGAACAAGCCAGAGTCTGATTTTGATGGACATGAGTTTAGACAGGCTGTAGGG
CAACTGGAACACCTCTTGAATGAGGCATTCGCTATTGCTTCTCAGGCCATTGACCGCCCAAGAGTGCCGTCTGAG
ACGCGAGGCAAGCCGCCATCACTTGGTCCTGATTCGCGCCATGGGAGCGTTGCCGAGGCAGAGCATGAGGATGAA
GGGTCACATGACGAGCTGACACCTCCCGGCGCCCCCCAAGGCTCTGACGACCGACATGGCGCAGAGCTGTGGGAG
GTTGATAGCACGAGACCCCCTATATATCGGCATGCGGCAACATACTCTGGAGCGGCGCGAAGACCACGGTTGTGC
GAAATTATTAAGAACTACTCAAATGAGGGCAGTGAGTTTAGACGGGCGAGCTCTGTCGACGAGGATGAACAGACT
GGAAGCGAAACGCAGGACGGCAAGATCAAGGTTGTCTGTTACGTTCCCCGGCGAAAATCAAGCCGGGGAACGGCC
AAATTGGACAAGACGACGCTGGAGACGAGAGACAAGGATGGTCAAGGCAAAGCAAGCCAAGCTGCTGCACGGCAC
GGAGATGAAGTGCAAGGAGTCAAGGAGGTGAGAATGGAGCTTAGTCCTGAACTCCGAAGCCATTACGAGCACTCC
CGAGCGAGACCAATGAGGAGCATTGAGCCACATGCCATGGCAAGCGATGGAGACGAGGCGATTGGCGAGGGCGAT
TTGCCGGATCATGACATTGCTGGGCGGCCCCTGCACACCAACCATGGCATCAGCCTGCGGCGGCGGTCCCATATC
AGTCTGCAAGGGGCTGGCGGCTTCAATCTCTCCAAGTCTCGCAAGCGGCAGCCCACAGCCAGAGACTGGTCGCCT
GTGCGCAAACGATTTGTGGCATCTGTGGCATGCATCAGCACTGCCCTGGTTGGCGTCATTTTGGGCATCTATGCT
GGCATTGTGCCGTCTGTGCAGTATTATCTCATTGACCAATCTCACTTTACCGTGCACGGCAACACGGGCTGCTTC
CTGGGCCTGGCTCTGCCGACACTGTTTTTGTGGCCGCTCCCCTTGCTCCACGGCCGCAAGCCATATATCCTGTCG
AGCCTGGTGCTTGCCATGCCGCTTCTCTTTCCCCAGGCACTCGCAGTCTACTCTCAGAGGCTCACCAAGACGGTC
TCGTGGAGAGGCATGCTTCTCGCTTCGCGGACCGTCATGGGCATGTCGCTTGGGTTCGCCAGCATGAACTTTCAC
TCGACACTAATGGATCTCTTTGGGGCCTCGTTGATGAGCGTGAATCCACACCAAGAGGTGGTGGACCATTATGAT
GCCCGGCGGCATGGAGGCGGCATGGGCGTGTGGCTTGGCATCTGGACTTGGTGCTGGATCGGCTCGCTGGCTGTG
GGCTTCTTGGTTGGAGCCACGATTATTGACAACTGCCCCCCGGCCTGGGGCTTTTACGTGAGCATCATGCTGATT
GCCGTGGTGCTCTTTCTCAATGTCGTTTGCCCCGAGGTGCGCCGCTCAGCCTTTCGGCGGTCCGTTGCCGAAGTG
AGGACGGGAAGCGACGTTTCGAGACGGCTTGCACGCGGCGAAATCATGATGCACCGCGTCAAGACTGGCCCTCGA
TGGTGGGGACAAGAGGTTTATCACGGCGTAGCCTTGTCGCTGGAAATGGTTAGCCAGCCCGGGTTTGCCACATTG
GCGCTCTACTCGGCCTGGATTTATGCCCAAGTGGTGCTGATTATTGTGCTTCTGGGTTCTCTGACTTCGCGATTT
TACCGTTTGCGCTCTCCGCAGGTTGGCCTCTTGGTGGGAGCCATGGCACTGGGCGCTCTGCTGGCGATTCCCTTT
CAAAAGGCCAATGTCTTTTCCAGGTCGCGGCAGAAGCAGATGAATACCAATCTGGCAACGCTGAACCGCAAGGTG
GCTTGGTCGTCTCATTTGGTTCGTCGAACCATTTTCACGCTGTTGCTGCCGCTCGTGGGCATTTGCTACGCGGCA
GTCTCGTCGGGCCCGCCAATGCATGTGAGCGTGCCTACGATATTCTCCACGGCGGTGGGCTTCTTGTCGTGTCTG
GCCATTGCCGAGTGCAATGGGCTGGTGATGGAGACGTTTGACTGCTCCGATTTGTCGCCAGGCATGACTGGGCGG
CAGCGCAGCGGAGATGGCAAGAGCCCGAAGCGGACCAATTACTCGTCGTTTCCCCGCGTGAGTGCAGGCTTTGCC
GCCATTCATGGGCTTGCCTTTGTGCTGGCTGCTGGGGCAACAGCGCTGGGCGGGCTGGTGACGAGGACTTTGGGC
CAGCAAGTGTCGACGGGCGTTGTGGCGGCCATTCTCTTCATCCTGACGGTGATGCTGTTGTTGATATTGGCGCGC
TTTACCGAGGCGCAGATTGTGCCCCGGTGCAAGTCTGAAGAAATGGACAGGGTTGTCGAGGCGCGGCGCCGATCA
ACGGTGCGTCGAGCGTCAATGCCGAATAGCCATGAAGCAGTCATGGAGGAGGAGAGGGCTTGGCAGCCCGTCATG
ATGGGCAATCCGACGGGCAAGAAGCGGCGCATGAATGTGCTGGAACTGGGCAAGCTGAGCCGCTGGCAGGAAATA
CGCAGGAGGAACAAGCTGATTGACTCGGGCATTCATGCCAACCGCGCCGTCTTTGATCGAGGCATGGAGGCGCTC
CAAGACTATGTGGGCAACTTTGAGCATACTGGCGCGCAAAACTTGACCGCCAAGAGTAAAGCAGGGCGCAAGACG
CCCCGACGGCCCCGTCGTGTCCAATCAGGCGCGGTGCGGGCTGATGAATGTGTGGAATTGGAGGTGCTTGACTTG
GATGAGGGCGGACTGAGAGCCCGGCGCAACATGGATACCGGGTGTGTCATGAGCCAGACGATGACTGAGGAAAGC
AATGACGGAGCGGCTAGATTTGGGCGACGAGGGGAGCACTGA
Gene >OphauB2|8008
ATGGACGCTGGCGACTTTGATGAGACACCGGCTCCCAGTTGCCGTCCGTCTCTAATGGGCCTTCGAAACGACGAC
GATGGAGGCTCATCACCTCCAGCACGAGCTGGGGGCGTTCGCCACCATTTGCTAAAGACGTCTACAAGCGGTCCC
ACCATTGTTGACAAGGAATTTCCTGCTCCTCCAATCCTTAGCCCATCTTTGGTGGCTAGCGATGCTGTTGCTCTG
GCTCAGTCGCCCGCAGATGAGCTTGAAAACAAGTTTCCCTTTCTTCCCCTAGGCCAGTTGTCGACAGTGCCAAAT
TCCCCGTATCCTCGGATGGAGCAACAAGACAATGCAGCGCCGCCATCTGTGGCCTTGATGGAACGGACTTCTCCC
TTTATTCCGCCGGCATCAGGAGGGAAGCATACTCGCAGCCTCCGCCATGGCCAGGATGGCTCAGCACACTCAATG
GTGCCGAGCCGAGATTCATCATTGCGAGTATTAACTCCGCAAGACGAGGCCCACGTCACAATAACGGACCCAAAT
AGAACAATAGACAATGCATCGGTAACGTTGTCATGTATTGGTCTGTCGCCTGCAGCATCCGACAATGACTGCTAT
AGTCGCACGTCCAAGGTTGGCCCTGCTTTTGAAGAGGATTACGGCCAGCATAGCATCATATTCGACAGGTACTCT
GGCAAAAATTGCCGGGCATTTTCGAAAAAAGTAGGCCCGTTTGATGCTCATTTCGAGCATGAGGCAGACTTGAAG
CCTGACCAGGCCCATTTCTTGTCTGGCTCATCAACAGCAGTTTCTTGGACTGACTTGCGCGACGGCTTGCACAGA
GACAGCCAAGTGTGGAACTCGGAAGCAAATTCGGATGTCATCATCACCACGTTGTCAAGGGCTTTTCAACGATAC
ACGCCCAAGGTTGGGCCATTTGTAGATGGCCAAGTCATGAGCTCTGCTGAGCAATGTAAGGCTCCATCACCCAGG
AAACCTACTGGCCAACAATATCTCACTAAAGACCAAATTATGGACACGAGGCCGCCTGTGGTGATTCCTCATGGG
CCCAAGTTGTCACCTCCATATGCACGCTATATATCCAAGGTTGGACCATATGTTGAATCGGACATGGAGACGGAT
GACATGCGCGAGCATGATAGTCCAAGCCACTCTGGCTCTTTGACTCCCACACACGAGTTTCTCCCTGTTCCCGGA
GCCAAAGTCAGGCCCTTTGTGGACCATGGCGGCATATCGCACTTGAGAACAGCACACCACCATTTGCCAAAGGTC
CAGGCCTTTTCGCACAGCACACCGCCCTCTGCACTACCTAGGGATATCGCCTTGAGCCAATGCCAGCGATGCAAT
GGGCCAAGAGGAGCCGAGACACATGCTGCAGAGCAGCCAGTTTTAGCCCACGATGCAGCGTCTCGGCGAGATGGT
GTTGCACGCGACGACTACTTTTCACCAAAGCTTCAAGGAAAGCACTCTCTTTCGCTTGATCCAGAGTATCGGGTT
TGCTCAGGGGCTGAGCACACGTTGAATGCATGTTCGGACCAGTGGGCGGCCTGGAGACAAGAGCAAATAGAGGGC
AGTCAACATTCGAGTCGGACCAGCACATTACATTCTTTTGTTCAAGACTCTGAAGCACACGGTTCAGCCTCTGGA
CAGCAAGTCCGTGTTGAAGAGGCAGTGCCCATCATGGCAAAACAGGATGGCCGCCGTGACAAATCTCATGTATCT
GGTCGCCTACAGACTGCAAGAGGCACCTCGGATTACATTCATGCTCCAGTCCCGGTTTCCAAGGTCCGACCACAC
TTTCAAGAGTACTCGTACAATGAACGCGCTTCGAGCACAAACGAGAGCCATGGCGCAGTATCAAAGGTGCAGGCT
GCAGCCCTGGAGGCGACGCAAAGTGGCGGTGAGGATGACGGCCAAGATTGTTCCAAGTGGCAGCGGCAGGACAGA
TTGGAGCAGCCGACAGAGCAAGAATCAAGGGCGTCGGGCCGCAGTCATTCCCTGGGCTCGATTTTGGACTACAAG
CGTACCGCTCAGTGGCTACGTGGCATTCTGAAGCATCGTGAAGTACGCACAGTCAGATTTACCGAGGGACCTGGC
AGGTACAAGCAAGACCAGCCGCAAGTCGACGAAGATCGACGCAACTCTGAGTCGGTTGTGCCATCGCGCCGCTAT
ACAGTGGCGGGTCCTGCTTCTTCGAACAAGCCAGAGTCTGATTTTGATGGACATGAGTTTAGACAGGCTGTAGGG
CAACTGGAACACCTCTTGAATGAGGCATTCGCTATTGCTTCTCAGGCCATTGACCGCCCAAGAGTGCCGTCTGAG
ACGCGAGGCAAGCCGCCATCACTTGGTCCTGATTCGCGCCATGGGAGCGTTGCCGAGGCAGAGCATGAGGATGAA
GGGTCACATGACGAGCTGACACCTCCCGGCGCCCCCCAAGGCTCTGACGACCGACATGGCGCAGAGCTGTGGGAG
GTTGATAGCACGAGACCCCCTATATATCGGCATGCGGCAACATACTCTGGAGCGGCGCGAAGACCACGGTTGTGC
GAAATTATTAAGAACTACTCAAATGAGGGCAGTGAGTTTAGACGGGCGAGCTCTGTCGACGAGGATGAACAGACT
GGAAGCGAAACGCAGGACGGCAAGATCAAGGTTGTCTGTTACGTTCCCCGGCGAAAATCAAGCCGGGGAACGGCC
AAATTGGACAAGACGACGCTGGAGACGAGAGACAAGGATGGTCAAGGCAAAGCAAGCCAAGCTGCTGCACGGCAC
GGAGATGAAGTGCAAGGAGTCAAGGAGGTGAGAATGGAGCTTAGTCCTGAACTCCGAAGCCATTACGAGCACTCC
CGAGCGAGACCAATGAGGAGCATTGAGCCACATGCCATGGCAAGCGATGGAGACGAGGCGATTGGCGAGGGCGAT
TTGCCGGATCATGACATTGCTGGGCGGCCCCTGCACACCAACCATGGCATCAGCCTGCGGCGGCGGTCCCATATC
AGTCTGCAAGGGGCTGGCGGCTTCAATCTCTCCAAGTCTCGCAAGCGGCAGCCCACAGCCAGAGACTGGTCGCCT
GTGCGCAAACGATTTGTGGCATCTGTGGCATGCATCAGCACTGCCCTGGTTGGCGTCATTTTGGGCATCTATGCT
GGCATTGTGCCGTCTGTGCAGTATTATCTCATTGACCAATCTCACTTTACCGTGCACGGCAACACGGGCTGCTTC
CTGGGCCTGGCTCTGCCGACACTGTTTTTGTGGCCGCTCCCCTTGCTCCACGGCCGCAAGCCATATATCCTGTCG
AGCCTGGTGCTTGCCATGCCGCTTCTCTTTCCCCAGGCACTCGCAGTCTACTCTCAGAGGCTCACCAAGACGGTC
TCGTGGAGAGGCATGCTTCTCGCTTCGCGGACCGTCATGGGCATGTCGCTTGGGTTCGCCAGCATGAACTTTCAC
TCGACACTAATGGATCTCTTTGGGGCCTCGTTGATGAGCGTGAATCCACACCAAGAGGTGGTGGACCATTATGAT
GCCCGGCGGCATGGAGGCGGCATGGGCGTGTGGCTTGGCATCTGGACTTGGTGCTGGATCGGCTCGCTGGCTGTG
GGCTTCTTGGTTGGAGCCACGATTATTGACAACTGCCCCCCGGCCTGGGGCTTTTACGTGAGCATCATGCTGATT
GCCGTGGTGCTCTTTCTCAATGTCGTTTGCCCCGAGGTGCGCCGCTCAGCCTTTCGGCGGTCCGTTGCCGAAGTG
AGGACGGGAAGCGACGTTTCGAGACGGCTTGCACGCGGCGAAATCATGATGCACCGCGTCAAGACTGGCCCTCGA
TGGTGGGGACAAGAGGTTTATCACGGCGTAGCCTTGTCGCTGGAAATGGTTAGCCAGCCCGGGTTTGCCACATTG
GCGCTCTACTCGGCCTGGATTTATGCCCAAGTGGTGCTGATTATTGTGCTTCTGGGTTCTCTGACTTCGCGATTT
TACCGTTTGCGCTCTCCGCAGGTTGGCCTCTTGGTGGGAGCCATGGCACTGGGCGCTCTGCTGGCGATTCCCTTT
CAAAAGGCCAATGTCTTTTCCAGGTCGCGGCAGAAGCAGATGAATACCAATCTGGCAACGCTGAACCGCAAGGTG
GCTTGGTCGTCTCATTTGGTTCGTCGAACCATTTTCACGCTGTTGCTGCCGCTCGTGGGCATTTGCTACGCGGCA
GTCTCGTCGGGCCCGCCAATGCATGTGAGCGTGCCTACGATATTCTCCACGGCGGTGGGCTTCTTGTCGTGTCTG
GCCATTGCCGAGTGCAATGGGCTGGTGATGGAGACGTTTGACTGCTCCGATTTGTCGCCAGGCATGACTGGGCGG
CAGCGCAGCGGAGATGGCAAGAGCCCGAAGCGGACCAATTACTCGTCGTTTCCCCGCGTGAGTGCAGGCTTTGCC
GCCATTCATGGGCTTGCCTTTGTGCTGGCTGCTGGGGCAACAGCGCTGGGCGGGCTGGTGACGAGGACTTTGGGC
CAGCAAGTGTCGACGGGCGTTGTGGCGGCCATTCTCTTCATCCTGACGGTGATGCTGTTGTTGATATTGGCGCGC
TTTACCGAGGCGCAGATTGTGCCCCGGTGCAAGTCTGAAGAAATGGACAGGGTTGTCGAGGCGCGGCGCCGATCA
ACGGTGCGTCGAGCGTCAATGCCGAATAGCCATGAAGCAGTCATGGAGGAGGAGAGGGCTTGGCAGCCCGTCATG
ATGGGCAATCCGACGGGCAAGAAGCGGCGCATGAATGTGCTGGAACTGGGCAAGCTGAGCCGCTGGCAGGAAATA
CGCAGGAGGAACAAGCTGATTGACTCGGGCATTCATGCCAACCGCGCCGTCTTTGATCGAGGCATGGAGGCGCTC
CAAGACTATGTGGGCAACTTTGAGCATACTGGCGCGCAAAACTTGACCGCCAAGAGTAAAGCAGGGCGCAAGACG
CCCCGACGGCCCCGTCGTGTCCAATCAGGCGCGGTGCGGGCTGATGAATGTGTGGAATTGGAGGTGCTTGACTTG
GATGAGGGCGGACTGAGAGCCCGGCGCAACATGGATACCGGGTGTGTCATGAGCCAGACGATGACTGAGGAAAGC
AATGACGGAGCGGCTAGATTTGGGCGACGAGGGGAGCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail