Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7991
Gene name
LocationContig_92:75519..77043
Strand-
Gene length (bp)1524
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07364 DUF1485 Metallopeptidase family M81 9.3E-106 7 290
PF07171 MlrC_C MlrC C-terminus 2.0E-57 301 472

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q93CA6|MLRC_SPHSX Microcystinase C (Fragment) OS=Sphingomonas sp. GN=mlrC PE=3 SV=1 7 481 2.0E-30

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.856702

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3320
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7270
Ophiocordyceps australis map64 (Brazil) OphauB2|7991 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00468
Ophiocordyceps camponoti-rufipedis Ophun1|3826
Ophiocordyceps kimflemingae Ophio5|1271
Ophiocordyceps subramaniannii Hirsu2|6134

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7991
MARLPVIAVAGLACETSTFSPLKTYAAGFGPKRGDEIIDYYGHLHDSQPLGRQATWRGALIGHALPGGIVVREAF
EALADEIVKRLASLVADEGLDGLWLDLHGAMCVEGMDDAEAELVKRIRGVVGADVVISASMDLHGNVSRQLVHMC
DVLTCYRTAPHQDEAETKERACRHVLELLQTRRRPLKAWIPIPILLPGEKTSTRTEPAQSLYAAVAHVAAQPSVL
DAAVWVGYAWADEPRNRAAVVVTGWDEDQVSQGAQRLADVFWDAHDLFRFAAPAADLDACLDQALVAPPHEQPFV
ISDSGDNPTAGGSGDVTWGLARVLGRPEFHHPRHDPVVIYASLPGPEAVAAAVAAGLGATVTVTAGAHLDSRYAP
PLTLTGTVFSIKHGDGYAETEVVVQVGSVFAILTKRRKPYHKEKDFTDLGLNPRQAAIVIVKIGYLEPDLFDMAR
SWMLALTPGGVDQDLERLDYVRIRRPMWPFDKPFKHRPNLQTRWIASSNQPLHGPDE*
Coding >OphauB2|7991
ATGGCGCGACTGCCCGTCATTGCCGTGGCGGGCCTGGCGTGCGAAACCAGCACCTTTTCGCCCCTCAAGACGTAT
GCGGCGGGCTTTGGGCCCAAGCGCGGGGATGAAATCATCGACTACTATGGCCACTTGCACGACAGCCAGCCCCTG
GGCAGACAGGCGACATGGCGCGGCGCCCTCATCGGACATGCCCTTCCAGGCGGCATCGTGGTGCGCGAGGCCTTT
GAGGCGCTGGCAGACGAGATTGTGAAGCGGCTGGCAAGCCTGGTGGCAGACGAGGGCCTCGACGGGCTGTGGCTT
GACCTGCACGGCGCCATGTGCGTCGAGGGCATGGACGACGCCGAGGCGGAGCTGGTGAAGCGCATCCGTGGCGTG
GTGGGCGCCGACGTGGTGATTTCGGCCTCGATGGACCTTCACGGCAACGTGTCGCGCCAGCTGGTGCACATGTGC
GATGTCCTGACGTGCTACCGCACCGCGCCTCACCAGGACGAGGCCGAGACCAAGGAGCGCGCCTGTCGCCATGTG
CTGGAGCTGCTGCAGACGCGCCGCCGCCCGCTCAAGGCCTGGATCCCCATTCCCATTCTGCTGCCGGGCGAGAAG
ACATCGACGCGCACCGAGCCGGCCCAGAGCCTCTATGCCGCCGTCGCCCACGTGGCCGCCCAGCCCTCTGTGCTC
GATGCCGCCGTCTGGGTGGGCTATGCCTGGGCTGACGAGCCTCGCAACCGCGCCGCCGTGGTGGTGACGGGCTGG
GACGAGGACCAAGTCTCCCAGGGCGCCCAGCGCCTGGCCGACGTCTTCTGGGACGCCCACGACCTCTTCCGCTTT
GCTGCTCCGGCCGCCGACCTTGACGCCTGCCTCGACCAAGCTCTAGTGGCCCCGCCCCACGAACAGCCCTTTGTC
ATCTCCGACTCGGGCGATAATCCCACGGCCGGCGGCTCGGGAGACGTCACCTGGGGCCTGGCCCGTGTGCTTGGC
CGCCCCGAGTTCCACCACCCCCGCCATGACCCCGTCGTCATCTACGCCAGTCTGCCTGGCCCCGAAGCCGTTGCC
GCCGCTGTTGCCGCCGGTCTTGGCGCCACCGTCACCGTCACGGCAGGCGCACACCTCGACAGCCGATACGCCCCG
CCCCTGACCCTGACGGGCACCGTCTTTTCCATCAAGCACGGCGATGGCTACGCAGAGACTGAGGTGGTTGTCCAG
GTCGGCTCCGTCTTTGCCATTCTCACCAAGCGGCGGAAGCCATACCACAAGGAAAAGGACTTTACCGACCTGGGT
CTCAACCCAAGGCAGGCCGCCATTGTCATTGTCAAGATTGGCTACCTCGAGCCAGACCTCTTTGACATGGCCCGC
AGCTGGATGCTGGCCCTGACGCCTGGCGGCGTTGACCAGGACCTCGAGCGCCTTGACTATGTCAGGATTCGCCGG
CCCATGTGGCCCTTTGACAAGCCCTTTAAGCACCGGCCCAATCTGCAAACTCGCTGGATTGCAAGCTCCAACCAG
CCACTCCATGGCCCCGACGAATAG
Transcript >OphauB2|7991
ATGGCGCGACTGCCCGTCATTGCCGTGGCGGGCCTGGCGTGCGAAACCAGCACCTTTTCGCCCCTCAAGACGTAT
GCGGCGGGCTTTGGGCCCAAGCGCGGGGATGAAATCATCGACTACTATGGCCACTTGCACGACAGCCAGCCCCTG
GGCAGACAGGCGACATGGCGCGGCGCCCTCATCGGACATGCCCTTCCAGGCGGCATCGTGGTGCGCGAGGCCTTT
GAGGCGCTGGCAGACGAGATTGTGAAGCGGCTGGCAAGCCTGGTGGCAGACGAGGGCCTCGACGGGCTGTGGCTT
GACCTGCACGGCGCCATGTGCGTCGAGGGCATGGACGACGCCGAGGCGGAGCTGGTGAAGCGCATCCGTGGCGTG
GTGGGCGCCGACGTGGTGATTTCGGCCTCGATGGACCTTCACGGCAACGTGTCGCGCCAGCTGGTGCACATGTGC
GATGTCCTGACGTGCTACCGCACCGCGCCTCACCAGGACGAGGCCGAGACCAAGGAGCGCGCCTGTCGCCATGTG
CTGGAGCTGCTGCAGACGCGCCGCCGCCCGCTCAAGGCCTGGATCCCCATTCCCATTCTGCTGCCGGGCGAGAAG
ACATCGACGCGCACCGAGCCGGCCCAGAGCCTCTATGCCGCCGTCGCCCACGTGGCCGCCCAGCCCTCTGTGCTC
GATGCCGCCGTCTGGGTGGGCTATGCCTGGGCTGACGAGCCTCGCAACCGCGCCGCCGTGGTGGTGACGGGCTGG
GACGAGGACCAAGTCTCCCAGGGCGCCCAGCGCCTGGCCGACGTCTTCTGGGACGCCCACGACCTCTTCCGCTTT
GCTGCTCCGGCCGCCGACCTTGACGCCTGCCTCGACCAAGCTCTAGTGGCCCCGCCCCACGAACAGCCCTTTGTC
ATCTCCGACTCGGGCGATAATCCCACGGCCGGCGGCTCGGGAGACGTCACCTGGGGCCTGGCCCGTGTGCTTGGC
CGCCCCGAGTTCCACCACCCCCGCCATGACCCCGTCGTCATCTACGCCAGTCTGCCTGGCCCCGAAGCCGTTGCC
GCCGCTGTTGCCGCCGGTCTTGGCGCCACCGTCACCGTCACGGCAGGCGCACACCTCGACAGCCGATACGCCCCG
CCCCTGACCCTGACGGGCACCGTCTTTTCCATCAAGCACGGCGATGGCTACGCAGAGACTGAGGTGGTTGTCCAG
GTCGGCTCCGTCTTTGCCATTCTCACCAAGCGGCGGAAGCCATACCACAAGGAAAAGGACTTTACCGACCTGGGT
CTCAACCCAAGGCAGGCCGCCATTGTCATTGTCAAGATTGGCTACCTCGAGCCAGACCTCTTTGACATGGCCCGC
AGCTGGATGCTGGCCCTGACGCCTGGCGGCGTTGACCAGGACCTCGAGCGCCTTGACTATGTCAGGATTCGCCGG
CCCATGTGGCCCTTTGACAAGCCCTTTAAGCACCGGCCCAATCTGCAAACTCGCTGGATTGCAAGCTCCAACCAG
CCACTCCATGGCCCCGACGAATAG
Gene >OphauB2|7991
ATGGCGCGACTGCCCGTCATTGCCGTGGCGGGCCTGGCGTGCGAAACCAGCACCTTTTCGCCCCTCAAGACGTAT
GCGGCGGGCTTTGGGCCCAAGCGCGGGGATGAAATCATCGACTACTATGGCCACTTGCACGACAGCCAGCCCCTG
GGCAGACAGGCGACATGGCGCGGCGCCCTCATCGGACATGCCCTTCCAGGCGGCATCGTGGTGCGCGAGGCCTTT
GAGGCGCTGGCAGACGAGATTGTGAAGCGGCTGGCAAGCCTGGTGGCAGACGAGGGCCTCGACGGGCTGTGGCTT
GACCTGCACGGCGCCATGTGCGTCGAGGGCATGGACGACGCCGAGGCGGAGCTGGTGAAGCGCATCCGTGGCGTG
GTGGGCGCCGACGTGGTGATTTCGGCCTCGATGGACCTTCACGGCAACGTGTCGCGCCAGCTGGTGCACATGTGC
GATGTCCTGACGTGCTACCGCACCGCGCCTCACCAGGACGAGGCCGAGACCAAGGAGCGCGCCTGTCGCCATGTG
CTGGAGCTGCTGCAGACGCGCCGCCGCCCGCTCAAGGCCTGGATCCCCATTCCCATTCTGCTGCCGGGCGAGAAG
ACATCGACGCGCACCGAGCCGGCCCAGAGCCTCTATGCCGCCGTCGCCCACGTGGCCGCCCAGCCCTCTGTGCTC
GATGCCGCCGTCTGGGTGGGCTATGCCTGGGCTGACGAGCCTCGCAACCGCGCCGCCGTGGTGGTGACGGGCTGG
GACGAGGACCAAGTCTCCCAGGGCGCCCAGCGCCTGGCCGACGTCTTCTGGGACGCCCACGACCTCTTCCGCTTT
GCTGCTCCGGCCGCCGACCTTGACGCCTGCCTCGACCAAGCTCTAGTGGCCCCGCCCCACGAACAGCCCTTTGTC
ATCTCCGACTCGGGCGATAATCCCACGGCCGGCGGCTCGGGAGACGTCACCTGGGGCCTGGCCCGTGTGCTTGGC
CGCCCCGAGTTCCACCACCCCCGCCATGACCCCGTCGTCATCTACGCCAGTCTGCCTGGCCCCGAAGCCGTTGCC
GCCGCTGTTGCCGCCGGTCTTGGCGCCACCGTCACCGTCACGGCAGGCGCACACCTCGACAGCCGATACGCCCCG
CCCCTGACCCTGACGGGCACCGTCTTTTCCATCAAGCACGGCGATGGCTACGCAGAGACTGAGGTGGTTGTCCAG
GTCGGCTCCGTCTTTGCCATTCTCACCAAGCGGCGGAAGCCATACCACAAGGAAAAGGACTTTACCGACCTGGGT
CTCAACCCAAGGCAGGCCGCCATTGTCATTGTCAAGATTGGCTACCTCGAGCCAGACCTCTTTGACATGGCCCGC
AGCTGGATGCTGGCCCTGACGCCTGGCGGCGTTGACCAGGACCTCGAGCGCCTTGACTATGTCAGGATTCGCCGG
CCCATGTGGCCCTTTGACAAGCCCTTTAAGCACCGGCCCAATCTGCAAACTCGCTGGATTGCAAGCTCCAACCAG
CCACTCCATGGCCCCGACGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail