Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7982
Gene name
LocationContig_92:39840..49622
Strand+
Gene length (bp)9782
Transcript length (bp)9600
Coding sequence length (bp)9600
Protein length (aa) 3200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 8.9E-89 2266 2547
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 3.5E-87 593 829
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 2.5E-84 139 380
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 2.0E-71 2795 2970
PF12624 Chorein_N N-terminal region of Chorein or VPS13 9.8E-40 2 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 1 3143 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 1 3193 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1188 3146 0.0E+00
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1 1376 2.0E-103
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 1 1376 3.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 1 3143 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 1 3193 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1188 3146 0.0E+00
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1 1376 2.0E-103
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 1 1376 3.0E-99
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 1 1049 2.0E-98
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1 1299 2.0E-96
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1 1297 2.0E-96
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1 820 1.0E-88
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 1 685 1.0E-82
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 2143 3134 2.0E-82
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 2034 3092 3.0E-70
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 1 835 3.0E-68
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 2532 3166 4.0E-68
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 2685 3139 3.0E-64
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 2618 3139 6.0E-63
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 2665 3145 6.0E-63
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 2665 3145 2.0E-62
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1 846 7.0E-61
sp|Q9BGZ0|VP13A_MACFA Vacuolar protein sorting-associated protein 13A (Fragment) OS=Macaca fascicularis GN=VPS13A PE=2 SV=1 2618 3101 3.0E-58
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 2640 3158 3.0E-50
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 2539 3116 5.0E-50
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2796 3131 2.0E-47
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 567 2448 4.0E-43
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 958 2410 3.0E-42
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 138 422 5.0E-42
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 2584 3109 2.0E-40
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1441 2545 1.0E-23
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 1 137 1.0E-20
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 202 708 3.0E-20
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 2845 3077 1.0E-19
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 2845 3091 2.0E-19
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1795 2414 7.0E-19
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2359 2759 1.0E-14
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 1 193 2.0E-14
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1811 2414 3.0E-14
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 1 89 2.0E-12
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 1 82 3.0E-11
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 1 82 3.0E-11
sp|Q86K84|VP13L_DICDI Vacuolar protein sorting-associated protein 13-like protein OS=Dictyostelium discoideum GN=vps13l PE=3 SV=1 2876 3065 4.0E-10
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1002 1288 9.0E-10
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 586 707 1.0E-09
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 2981 3062 2.0E-08
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 143 248 8.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7982
MLEGLVAGLLNRFLGMYVKNFDPTQLKVGIWSGDVKLRNLELRREALDQLKLPINVIEGHLGDLTLVIPWSNLRG
APVKVFIEDVFLLASPKEEAEYDEAEEERRRQRLKMEKLDSAELLKERNRDGMSQEEQKKNQSFTQSLVTKVVDN
LQVTVKNIHVRYEDSISAPGHPFALGLTLQEFSAVSTDGNWTPTFIQDSSSVTHKLATLGALAVYWNTDSELFGS
GREAQPPPEEAMSHHDMVDRFKAMIVSTSAADANNQFILKPVSGQAKIELDKSGDIRVPKFKANLLFEEIGLVLD
DNQYRDALMMVDLFHYFIRHQEYKALKPKGVRPSQDPKAWLQFAGNAVLGKIHEKNRQWSWDYFRQRRDDRISYI
ELFKKKKQQQQLSPDDVERLGNLEWKLSYEDLRFWRSLARNQLKKENAAALKKQSETQDQQGWLAWMWGSKPQGR
IEKNEENTQMTEEQRKELYDMIDWDEKTALADEVDMPREAVKLCLEASLGTGSFTLKKSPHGDARDLLSLHFDLF
KAKALQRKDSLLANVSLGGLRVNDGTTPNSLYPEIVRVKDAPKTKEQRRLSLMELESSNGEPFFQFEVEQNPIER
AGDIAVVGKLKPLEVVWNPNFVVGIVDFFRPPERHMESITALMESAGATVEGIREQTRAGLEFALEEHRTVNAEL
DLQAPLIIVPVSITTSKSTCLIIDAGHIHVNSQLVDEQTMKEIQSRQRLSDSEKDFKRLESVMYDKFVVKLTSTQ
VLIGPSIAETKAELGYKSEGSQLHVVEQINVDFVVETSILPKAPNLTRFKVSGHLPMLHVTVSDTKYKNLMKIID
VAIPKLGQEEATQDATVQDQISQAQRPRLVTNKTSNRPRRKSQREPRQSSAFPFMQPQTAVVIDDIDEDEDDFED
ASDGADAEQLKIQQRTFEFKFTVDVLKGSLYRSDADKRLPDALLVEMVAERFDLDFYTRRFDMAAEVSLGSVAVE
DFVDSPSAEFKSIVSSGDSEDLQSGRSLVHVKLVRVNKQSPEFMPVYEGVETNVTAAISTINIIVTRKTLLTLLD
FVLITFTGGDDWEEQQRQPALPDAEQGGSASTDDTVARQAPSTASIRVKVDLKTIRLILNNDGIRLATLSFNHAD
AGIFLRAKTMRISVRLGDVSLVDDVNLGVSEESNLRKLVTIQGDDLADFRYETFDPSNHKAYPGYDSSVYLRAGS
VKVNFVEEPFRKIIDFLVKFGKMQALYNAARQAAVSRANQMQQSPSRFKFDVVVKTPIVVFPRMMFAGRPSRDLV
TAFLGEIYAQNKFAPLDDSEQSDIAMKISMGIRNVRLTSNFEYDNEWSEELEMIDHVDLGFNITYAEHKNGAQRP
DLEIEGSLSDIKLRLTQHQLRFLLEISKSVPAAFAGDGADGDEEAARLVGEETLQRAKTMSWDGGKSSDEHHVDL
SPELSVAENCWTKLDLVFRVDTIGLELIMAPQNGPVGDLDASSLSRFSLDDTKVKTRMLSDGSLEAELLVGSFTI
YDSRPRETNKFRRIMTSSNTDSQQLMASLSMSGGHDKSLIAMATIDSPRVIFALDYLFALHKFAIEGLVLDTTTP
MDDESLNETPEESDADSMQVTYTTPGQGASGQKRAAELQEQTWPAMSVGFRVNLVDAQVILIANPLTPSSEAIVL
SIRQMLLSQQHALTFHISQVGMFLCRMDKFETSHLRIIDDFSIQLNMDSSQAKVVSMHIDVEPLILRLSLRDILL
ALQIFARAGELSGGDATTQEPKQSQADKKARQLGDGGTRNKSLSGRGRGQSTIAKARGGEGSSVGGNKEPGRATL
GMTRQELTATIEGMRIVLIGDVHELPILDVGVKQFTATAENWSWALKAEAAIEFYSNVYNFSKSSWEPLLEPWQV
GFGVAKEADSGLLAVEVASQKTFDVTITTATIALASKSFDFLTTEQDVLGKPRGGEAPYRIRNHTGFDVELEGKA
STSEEPLRLRLDDGQEGPWSFEHWEKMRENLLTESGQNDVCVKMEGSGFDMVKNVRLSREGEFLYSLRPKADNVL
HRLCVEVRLGADNVKRVTLRSPLLVENATQIPVELGVYDADEGHLLKIEKIAPGDSRPLPVGAVYEKRALVRPDG
GFGYQWSQDEVWWRELLKRPTRQLLCRAENGEPFFFQLHAQFDRANPMCKAYPYMRVKLSAPVTLENLLPYDFKY
RIYDKNSKKDWSNFLRKGGVSPVHAVELSHLLLLSIDMQDSVFKPSDFGIINAGSSDDFRKETRLLLKDDEGLAL
HLSLHYFKTANSGGAFKVAVYSPYIVLNKTGLDLRIRAKSFLQQARAAAGQFPRLPTGDSERPKALPLMFSFGND
DHRNRAMLKVDESEWSKPQSFDAIGSTSEVVVMSASRQREMHLGLTVQSGDGKYKMTKVVTLAPRFIVVNKVGEQ
MLVRESTSPGYMTLRGGALQPLHFMQKSPVKQLCLCYPGVDNHWSAPFNIAHLGTTHVKIARARQRQRLVRVETL
MEESTIFLHLSMESNNWPFSMRNESDVEFTFWQANPTLDEADVEDYSGWKPIRYRLPRRSIMPYAWDFPAAKFRE
VVIAAHAKERHVKLAEIGNQVPMKIVARDGQPQIIDINVAADGPTQTLILSNFRPSKSMYKPKPLSRTSSGPDAF
EVKQQETGATLRAQLKLSGIGISLINAQLKELAYITFRHVQLRFMDSPLIQTLSLAVKWIQIDNQLYGGIFPIVL
YPSVVPKRANEVEAHPSLHAMVSRVKDDSYGVVYFKYATVLVQQMTLDLDEDFVFALLDFSDVPGASWTLVHHDG
KLCDQDLDIPEPSQHQSGHDIYFELLNIQPTQLDLSFMRTERVNAQDKTSTRNPIMFFLNVMTMAIGNVNDAPIR
FNALMLDNVRVTIPVLMQNISNHYSQEVMYQIHKILGSADFLGNPVGLFNNISSGVTDIFYEPYQGLILSDRPEE
FGIGIAKGAASFAKKTVYGFSDSFSKFTGSLSKGLAAASLDKQFQDRRRITRARNRPKHALYGVTAGANSLFTSV
ASGVGGLARKPLEGAEQEGALGFFKGVGKGVLGLATKPAVGVLDMASNVSEGIRNTTTVFDGSELDRARYPRFIP
NDGIVRPYNAREALGQYWLKQVDNGRYFDEQYIGHLELPKEDMVVMVTYARILLIRSRRLTSEWDVPLKDVQTIA
KERTGVSLVLRGGANGPFIPVGGGSERSFLYRMVGVAVEEFNRRFRGGD*
Coding >OphauB2|7982
ATGCTCGAGGGACTCGTCGCAGGCCTGCTCAACCGCTTCCTGGGAATGTATGTCAAAAACTTTGACCCCACGCAG
CTCAAGGTGGGCATATGGTCTGGTGATGTCAAACTTCGCAATCTCGAGCTTCGCCGCGAAGCCCTCGACCAGCTT
AAGTTACCCATCAACGTCATCGAGGGCCATCTTGGCGACCTCACTCTTGTCATTCCTTGGTCAAATCTGCGAGGC
GCTCCCGTCAAGGTCTTTATCGAAGATGTCTTTCTTCTCGCTAGCCCCAAGGAAGAGGCCGAATATGACGAGGCC
GAAGAGGAGCGCAGAAGGCAGCGTCTCAAAATGGAAAAGTTGGACAGCGCCGAGCTTCTCAAGGAGCGCAACCGC
GACGGCATGAGCCAAGAGGAGCAAAAGAAAAACCAGAGTTTCACGCAGAGCCTCGTCACCAAGGTTGTCGACAAC
CTTCAAGTTACTGTAAAAAATATACACGTGCGCTACGAAGACTCAATATCTGCCCCAGGCCATCCATTTGCTCTG
GGCCTGACTCTCCAAGAGTTTTCTGCCGTCAGCACGGATGGAAATTGGACTCCAACCTTTATACAAGATTCTTCA
TCCGTCACCCATAAGCTCGCCACACTGGGTGCTCTGGCTGTCTACTGGAACACTGACTCGGAGCTCTTTGGCAGC
GGCCGCGAGGCTCAGCCACCTCCCGAGGAAGCCATGTCGCACCATGACATGGTGGACCGGTTCAAGGCCATGATT
GTATCCACGAGTGCGGCCGACGCCAACAACCAGTTTATCCTCAAGCCTGTCAGTGGCCAGGCCAAGATTGAACTC
GACAAGTCTGGAGACATACGTGTGCCCAAGTTCAAGGCCAACTTGCTGTTCGAGGAGATTGGCCTTGTGCTCGAT
GACAATCAATATCGCGATGCCCTCATGATGGTAGATCTCTTTCACTATTTTATTCGCCACCAGGAATACAAGGCT
CTGAAGCCCAAGGGCGTTCGCCCAAGCCAAGACCCCAAGGCATGGCTTCAGTTTGCTGGAAACGCCGTCTTGGGC
AAAATACACGAAAAGAACCGCCAGTGGTCCTGGGACTATTTTCGACAACGGCGCGACGATCGCATTAGTTATATA
GAACTGTTCAAGAAGAAGAAACAGCAACAGCAACTGTCTCCTGACGATGTGGAACGTCTTGGCAATCTCGAATGG
AAATTGAGCTACGAGGACCTGCGCTTCTGGAGGTCTTTGGCCCGCAACCAGTTGAAGAAGGAAAACGCGGCGGCA
TTGAAGAAACAGTCGGAGACACAGGACCAGCAAGGATGGCTGGCCTGGATGTGGGGCTCCAAGCCTCAGGGACGC
ATCGAGAAGAATGAAGAAAACACCCAGATGACTGAGGAGCAGCGCAAGGAGCTGTATGACATGATTGACTGGGAC
GAAAAGACGGCCCTGGCAGACGAGGTCGATATGCCTCGCGAGGCTGTGAAGCTGTGTCTGGAGGCCTCGCTGGGC
ACTGGAAGCTTCACCTTGAAAAAGAGCCCTCACGGAGACGCACGAGACCTTTTGAGCCTTCATTTTGACCTCTTC
AAGGCCAAGGCACTGCAACGTAAAGACTCCCTGCTTGCCAATGTGAGCCTGGGGGGCCTTCGAGTCAACGACGGC
ACCACGCCCAACAGCCTCTACCCCGAGATTGTGCGCGTCAAGGATGCCCCCAAAACCAAGGAGCAAAGGCGTCTT
TCCCTCATGGAGCTGGAGAGCAGCAATGGCGAGCCATTTTTCCAGTTTGAAGTGGAGCAAAATCCAATCGAGCGC
GCGGGGGATATTGCTGTTGTTGGCAAATTGAAGCCGCTCGAGGTTGTCTGGAACCCAAATTTTGTCGTGGGAATC
GTCGACTTTTTTCGACCCCCAGAGAGACACATGGAGTCTATTACGGCTCTCATGGAAAGCGCCGGCGCCACCGTA
GAAGGTATTCGAGAGCAGACTCGTGCTGGGCTAGAATTTGCGTTGGAAGAACATCGCACAGTCAATGCCGAGCTA
GACTTGCAAGCACCTCTCATCATTGTCCCTGTCAGCATCACTACCAGCAAGTCGACGTGCCTCATTATTGACGCG
GGACACATTCATGTCAATAGCCAACTGGTGGATGAGCAGACGATGAAGGAGATTCAGTCCCGACAGCGGCTTTCT
GATAGTGAAAAGGACTTCAAGCGACTAGAGTCGGTCATGTACGACAAGTTTGTCGTCAAGCTCACATCGACTCAA
GTTCTCATTGGACCTTCAATTGCCGAGACCAAGGCAGAACTTGGCTACAAGTCCGAGGGCTCTCAGCTGCACGTT
GTCGAGCAGATTAATGTTGACTTTGTTGTGGAGACATCAATTTTGCCAAAGGCGCCCAATTTGACGAGATTCAAA
GTCTCGGGCCACTTGCCAATGCTTCACGTTACCGTCTCGGATACCAAGTACAAAAATCTGATGAAAATCATTGAT
GTCGCTATTCCCAAGCTCGGACAAGAGGAAGCGACTCAAGACGCTACTGTTCAAGATCAAATCAGCCAGGCTCAG
CGCCCACGTCTGGTGACTAATAAGACTTCCAACAGGCCACGGCGCAAGTCGCAGCGTGAGCCTAGACAGTCATCT
GCCTTTCCATTTATGCAGCCTCAAACGGCGGTAGTCATTGACGACATTGACGAAGACGAGGATGACTTTGAAGAT
GCCAGCGATGGAGCGGATGCGGAGCAGCTCAAAATACAGCAGCGTACCTTTGAATTCAAGTTTACAGTTGATGTT
CTCAAGGGATCGCTTTATAGAAGCGACGCAGACAAGAGACTGCCTGATGCTCTCCTTGTGGAAATGGTGGCTGAG
CGCTTTGATCTCGACTTTTACACGAGAAGATTTGACATGGCGGCCGAGGTGTCACTCGGCTCCGTTGCCGTGGAA
GACTTTGTCGACAGCCCCTCTGCAGAGTTCAAGTCGATTGTCTCATCTGGGGATAGCGAAGACTTGCAATCTGGG
CGAAGCCTCGTCCACGTTAAACTGGTCAGGGTCAACAAGCAGTCACCCGAGTTTATGCCAGTATACGAGGGCGTG
GAGACGAATGTCACGGCTGCGATATCCACCATCAACATCATTGTCACAAGGAAAACACTGCTCACGCTCCTCGAC
TTTGTTCTCATTACCTTTACCGGAGGCGATGATTGGGAAGAGCAGCAAAGACAGCCAGCGCTTCCGGATGCAGAG
CAAGGCGGCAGCGCTTCAACTGACGACACGGTGGCTCGACAGGCCCCAAGCACCGCCTCGATACGTGTCAAGGTG
GACCTCAAGACTATCCGGCTCATCCTCAATAACGACGGGATTCGGCTGGCGACACTATCCTTCAACCATGCTGAC
GCTGGCATCTTCTTGCGTGCTAAGACTATGCGCATCTCGGTCAGACTGGGCGACGTCTCGCTTGTCGACGACGTC
AATCTGGGTGTTTCTGAGGAATCAAATCTGCGCAAACTCGTCACCATTCAGGGGGACGACTTGGCCGACTTTCGC
TACGAGACATTTGATCCGTCCAACCACAAGGCATACCCTGGTTATGACAGCTCAGTCTACCTCCGTGCTGGGTCT
GTCAAGGTCAACTTTGTGGAGGAGCCATTTCGCAAAATCATTGACTTCTTGGTCAAATTTGGCAAAATGCAGGCT
CTATACAACGCTGCTAGACAGGCGGCCGTTTCGCGTGCAAACCAAATGCAACAGAGTCCGAGCAGATTCAAGTTT
GATGTCGTGGTCAAGACGCCCATTGTTGTTTTCCCACGAATGATGTTTGCTGGACGGCCTAGCCGTGATTTAGTA
ACGGCCTTTTTGGGCGAGATATACGCACAAAACAAGTTTGCACCTCTGGACGACTCGGAACAGTCGGACATTGCC
ATGAAGATTTCCATGGGCATACGCAATGTGCGATTGACTTCCAACTTTGAGTATGACAATGAGTGGTCGGAAGAA
CTGGAGATGATTGATCACGTTGATCTCGGCTTCAATATTACTTATGCCGAGCACAAGAATGGAGCACAGCGCCCG
GATCTGGAGATTGAAGGCTCGCTGTCCGACATCAAGCTTCGACTGACGCAGCATCAGCTCAGATTTCTACTCGAG
ATTTCCAAGTCTGTACCGGCGGCCTTTGCTGGCGACGGGGCGGATGGCGATGAAGAGGCTGCCCGTCTAGTCGGG
GAGGAGACGTTGCAACGTGCCAAGACCATGTCTTGGGACGGGGGCAAGAGCAGCGACGAGCATCATGTCGACCTT
TCCCCAGAGCTCAGTGTAGCCGAGAATTGCTGGACCAAGCTGGACCTGGTTTTTCGCGTCGACACCATAGGACTT
GAACTCATCATGGCGCCACAAAACGGCCCGGTGGGAGACTTGGATGCGTCGAGCCTGTCGCGATTTTCGCTCGAT
GACACCAAGGTCAAGACGCGCATGCTTTCCGACGGCTCGCTCGAGGCCGAGTTGCTGGTTGGCTCATTCACCATT
TACGATAGTCGGCCGAGGGAGACGAACAAGTTTCGTCGCATCATGACATCGTCCAACACGGACTCGCAGCAGCTC
ATGGCTAGTCTGAGCATGTCGGGGGGCCATGACAAGAGCCTCATCGCCATGGCTACTATTGACAGCCCTCGAGTC
ATTTTTGCCCTCGACTACTTGTTTGCTCTGCACAAGTTTGCTATCGAGGGCCTGGTGCTCGACACGACGACGCCC
ATGGACGACGAGAGCTTGAACGAGACGCCCGAGGAATCGGACGCCGACTCGATGCAAGTGACGTACACGACGCCA
GGACAAGGAGCCTCTGGGCAAAAGCGGGCGGCGGAGCTCCAAGAGCAAACTTGGCCAGCCATGAGTGTTGGTTTT
AGAGTGAATCTGGTGGACGCACAGGTTATTCTCATTGCCAACCCGCTCACTCCCAGTTCAGAGGCGATTGTCTTG
AGCATTCGTCAGATGCTTCTATCTCAACAACATGCACTCACCTTTCACATTTCCCAAGTGGGCATGTTTTTATGC
CGCATGGACAAGTTTGAAACTTCGCATTTGAGAATCATTGACGACTTTTCGATACAGCTAAACATGGACAGTTCT
CAGGCCAAAGTGGTGAGCATGCACATTGACGTGGAGCCTTTGATTTTGCGACTGTCACTGCGAGATATTCTGCTG
GCGCTGCAAATCTTTGCAAGGGCGGGCGAGTTGTCTGGGGGCGACGCGACGACGCAGGAGCCCAAGCAATCGCAG
GCAGACAAGAAGGCGCGGCAGCTGGGAGATGGGGGCACGAGGAACAAGTCCCTGAGTGGGCGTGGACGAGGCCAG
TCGACCATTGCCAAGGCTAGAGGAGGCGAAGGATCGAGCGTTGGAGGAAACAAGGAGCCAGGGCGAGCGACTCTT
GGCATGACGCGGCAAGAATTGACGGCGACGATTGAGGGCATGCGCATCGTCTTGATTGGCGATGTGCACGAGCTT
CCCATTTTGGACGTGGGAGTCAAGCAGTTCACGGCAACGGCGGAGAATTGGTCGTGGGCTCTCAAGGCAGAGGCG
GCGATTGAGTTTTACTCCAACGTGTACAACTTCTCCAAGTCTAGCTGGGAGCCGCTGCTGGAGCCGTGGCAGGTG
GGCTTTGGAGTTGCCAAGGAGGCGGATAGCGGGCTGCTGGCTGTCGAGGTGGCGTCGCAAAAGACGTTTGACGTG
ACGATTACAACGGCGACGATTGCGCTGGCGTCCAAGTCGTTTGATTTTTTGACGACGGAGCAGGACGTGCTGGGC
AAGCCACGGGGAGGCGAGGCTCCGTATCGCATCCGGAACCACACGGGCTTCGACGTTGAGCTCGAGGGCAAGGCG
TCGACGAGCGAGGAGCCCCTGAGGCTGAGACTGGACGACGGGCAAGAGGGCCCGTGGAGCTTTGAGCACTGGGAG
AAGATGCGGGAGAATCTCTTGACAGAGTCGGGGCAAAACGACGTGTGTGTCAAGATGGAGGGCAGCGGCTTCGAC
ATGGTGAAGAATGTGCGACTGAGCCGCGAGGGCGAGTTTCTGTACAGCCTGCGGCCCAAGGCGGACAATGTGCTG
CACCGGCTGTGCGTCGAGGTGAGGCTGGGTGCGGACAATGTCAAGAGGGTGACGCTGCGTTCGCCGCTGCTGGTG
GAAAACGCAACGCAGATTCCCGTGGAGCTGGGCGTTTATGACGCGGACGAGGGCCATTTGCTCAAGATTGAGAAG
ATTGCGCCGGGCGACTCGCGGCCACTGCCCGTGGGGGCCGTGTACGAGAAGCGAGCGCTGGTGCGTCCAGATGGC
GGCTTTGGCTACCAGTGGAGCCAAGATGAGGTGTGGTGGCGGGAGCTGCTCAAGCGGCCAACTCGGCAGCTTCTG
TGCAGGGCGGAGAATGGGGAGCCCTTTTTCTTTCAGCTGCACGCGCAGTTTGACAGGGCGAATCCCATGTGCAAG
GCCTATCCGTACATGAGAGTTAAGCTCTCGGCGCCCGTGACGCTCGAGAACCTGCTGCCATACGACTTCAAGTAC
CGCATCTACGACAAGAACAGCAAAAAGGACTGGAGCAACTTTTTGCGCAAGGGCGGCGTCAGCCCGGTGCATGCG
GTGGAGCTGTCGCATCTGCTGCTGCTCAGCATCGACATGCAGGACAGCGTCTTCAAGCCCAGCGACTTTGGCATC
ATCAACGCGGGCAGCAGCGACGACTTCCGCAAGGAGACGCGGCTGCTGCTCAAGGACGACGAGGGCCTGGCGCTG
CACCTCAGCCTGCACTACTTCAAGACGGCCAACAGCGGAGGCGCCTTCAAGGTGGCGGTGTACAGCCCCTACATT
GTGCTCAACAAGACGGGCCTGGACCTGCGCATCCGGGCCAAGAGCTTCCTCCAGCAGGCCAGGGCGGCAGCGGGC
CAGTTCCCGCGGCTGCCAACGGGCGACTCGGAGCGGCCCAAGGCGCTGCCTCTCATGTTCTCGTTTGGCAACGAT
GACCATAGGAACAGGGCCATGCTCAAGGTGGACGAGTCTGAGTGGAGCAAGCCGCAGAGCTTCGACGCCATTGGC
AGCACGTCGGAAGTGGTGGTCATGTCGGCGTCGCGGCAGCGCGAGATGCACCTGGGCCTGACGGTGCAGTCGGGC
GACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGCCGCGCTTCATTGTGGTGAACAAGGTGGGCGAGCAA
ATGCTGGTGCGCGAGTCGACGTCGCCCGGCTACATGACGCTGCGAGGCGGCGCGCTGCAGCCGCTGCACTTTATG
CAAAAGTCGCCCGTCAAGCAGCTGTGCCTGTGCTATCCCGGCGTCGACAACCACTGGTCGGCGCCCTTCAACATT
GCCCATCTGGGCACGACGCACGTCAAGATTGCCCGTGCCCGCCAGCGCCAGCGCCTGGTGCGCGTCGAGACGCTC
ATGGAGGAGTCCACCATTTTCCTGCACCTGAGCATGGAGAGCAACAACTGGCCCTTTTCCATGCGCAACGAGAGC
GACGTCGAGTTTACCTTTTGGCAGGCCAACCCCACGCTCGACGAGGCCGATGTCGAGGACTATAGCGGCTGGAAG
CCCATTCGCTATCGCCTGCCGCGCCGCAGCATCATGCCCTATGCCTGGGACTTTCCCGCCGCCAAGTTTCGCGAG
GTGGTGATTGCCGCCCACGCCAAGGAGCGCCACGTCAAGCTGGCCGAGATTGGCAACCAGGTGCCCATGAAGATT
GTGGCGCGCGACGGCCAGCCGCAAATCATTGACATCAACGTGGCGGCCGACGGGCCCACCCAGACGCTGATTCTG
AGCAACTTCCGCCCCAGCAAGAGCATGTACAAGCCCAAGCCGCTGTCGCGCACCAGCAGCGGCCCCGACGCCTTT
GAGGTCAAGCAGCAGGAGACGGGCGCCACCCTGCGCGCCCAGCTCAAGCTCTCGGGCATTGGCATCTCCCTCATC
AATGCCCAGCTCAAGGAGCTGGCCTACATTACCTTTCGCCACGTGCAGCTGCGCTTCATGGACTCGCCCCTCATC
CAGACGCTGTCGCTGGCCGTCAAGTGGATCCAGATTGACAACCAGCTCTATGGCGGCATCTTCCCCATTGTCCTC
TACCCCAGCGTCGTGCCCAAGCGCGCCAACGAGGTCGAGGCCCACCCCTCGCTGCACGCCATGGTTAGCCGCGTC
AAGGACGACTCGTACGGCGTCGTCTACTTCAAGTACGCCACCGTGCTGGTGCAGCAGATGACGCTCGACCTGGAC
GAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCGACGTGCCCGGCGCCAGCTGGACTCTTGTCCACCACGACGGC
AAGCTGTGCGACCAGGACCTCGACATCCCCGAGCCCTCGCAGCACCAGTCGGGCCACGACATTTACTTTGAGCTG
CTCAACATCCAGCCCACGCAGCTCGACCTGAGCTTCATGCGCACAGAGCGCGTCAATGCCCAGGACAAGACGTCG
ACGCGCAACCCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCCCCCATAAGA
TTCAACGCCTTGATGCTCGACAATGTCCGCGTCACCATTCCCGTCCTCATGCAAAACATCTCCAACCACTACAGC
CAAGAGGTCATGTACCAGATCCACAAGATTCTCGGCTCCGCCGACTTTTTGGGCAACCCCGTCGGCCTCTTCAAC
AACATCTCGTCGGGCGTCACCGACATCTTTTACGAGCCCTACCAGGGCCTGATCCTCTCGGACAGGCCCGAGGAG
TTTGGCATTGGCATTGCCAAGGGCGCCGCCTCGTTTGCCAAGAAGACTGTCTATGGCTTCAGCGACAGCTTCTCC
AAGTTTACCGGCAGCTTGAGCAAGGGCCTGGCCGCCGCCTCGCTCGACAAGCAGTTCCAGGACCGCCGCCGCATC
ACCAGGGCCCGCAACAGGCCCAAGCACGCCCTCTACGGCGTCACAGCCGGAGCCAACTCGCTCTTCACCAGCGTC
GCCTCTGGCGTTGGCGGCCTGGCCCGCAAGCCCCTCGAGGGTGCCGAGCAGGAGGGCGCCCTCGGCTTCTTCAAG
GGCGTCGGCAAGGGCGTGCTTGGCCTGGCCACCAAGCCCGCCGTTGGCGTCCTCGACATGGCCAGCAACGTGAGC
GAGGGCATTCGCAACACAACCACTGTCTTTGACGGCTCCGAGCTGGACCGCGCCCGCTACCCGCGCTTCATTCCA
AACGACGGCATCGTGCGCCCCTATAATGCCCGCGAGGCTCTGGGGCAGTACTGGCTCAAGCAGGTGGACAATGGC
CGCTACTTTGACGAGCAGTACATTGGCCACCTCGAGCTGCCCAAGGAGGACATGGTGGTCATGGTGACGTATGCG
CGCATTCTGCTTATCCGCTCGAGGCGCCTGACGAGCGAGTGGGACGTGCCGCTCAAGGATGTGCAGACCATTGCC
AAGGAGCGCACAGGCGTCAGCCTGGTGCTGCGAGGAGGGGCTAATGGACCCTTTATCCCGGTCGGCGGTGGCAGC
GAGAGGAGCTTCTTGTACCGCATGGTGGGCGTTGCAGTGGAAGAGTTCAACCGGCGCTTCAGAGGCGGCGACTAA
Transcript >OphauB2|7982
ATGCTCGAGGGACTCGTCGCAGGCCTGCTCAACCGCTTCCTGGGAATGTATGTCAAAAACTTTGACCCCACGCAG
CTCAAGGTGGGCATATGGTCTGGTGATGTCAAACTTCGCAATCTCGAGCTTCGCCGCGAAGCCCTCGACCAGCTT
AAGTTACCCATCAACGTCATCGAGGGCCATCTTGGCGACCTCACTCTTGTCATTCCTTGGTCAAATCTGCGAGGC
GCTCCCGTCAAGGTCTTTATCGAAGATGTCTTTCTTCTCGCTAGCCCCAAGGAAGAGGCCGAATATGACGAGGCC
GAAGAGGAGCGCAGAAGGCAGCGTCTCAAAATGGAAAAGTTGGACAGCGCCGAGCTTCTCAAGGAGCGCAACCGC
GACGGCATGAGCCAAGAGGAGCAAAAGAAAAACCAGAGTTTCACGCAGAGCCTCGTCACCAAGGTTGTCGACAAC
CTTCAAGTTACTGTAAAAAATATACACGTGCGCTACGAAGACTCAATATCTGCCCCAGGCCATCCATTTGCTCTG
GGCCTGACTCTCCAAGAGTTTTCTGCCGTCAGCACGGATGGAAATTGGACTCCAACCTTTATACAAGATTCTTCA
TCCGTCACCCATAAGCTCGCCACACTGGGTGCTCTGGCTGTCTACTGGAACACTGACTCGGAGCTCTTTGGCAGC
GGCCGCGAGGCTCAGCCACCTCCCGAGGAAGCCATGTCGCACCATGACATGGTGGACCGGTTCAAGGCCATGATT
GTATCCACGAGTGCGGCCGACGCCAACAACCAGTTTATCCTCAAGCCTGTCAGTGGCCAGGCCAAGATTGAACTC
GACAAGTCTGGAGACATACGTGTGCCCAAGTTCAAGGCCAACTTGCTGTTCGAGGAGATTGGCCTTGTGCTCGAT
GACAATCAATATCGCGATGCCCTCATGATGGTAGATCTCTTTCACTATTTTATTCGCCACCAGGAATACAAGGCT
CTGAAGCCCAAGGGCGTTCGCCCAAGCCAAGACCCCAAGGCATGGCTTCAGTTTGCTGGAAACGCCGTCTTGGGC
AAAATACACGAAAAGAACCGCCAGTGGTCCTGGGACTATTTTCGACAACGGCGCGACGATCGCATTAGTTATATA
GAACTGTTCAAGAAGAAGAAACAGCAACAGCAACTGTCTCCTGACGATGTGGAACGTCTTGGCAATCTCGAATGG
AAATTGAGCTACGAGGACCTGCGCTTCTGGAGGTCTTTGGCCCGCAACCAGTTGAAGAAGGAAAACGCGGCGGCA
TTGAAGAAACAGTCGGAGACACAGGACCAGCAAGGATGGCTGGCCTGGATGTGGGGCTCCAAGCCTCAGGGACGC
ATCGAGAAGAATGAAGAAAACACCCAGATGACTGAGGAGCAGCGCAAGGAGCTGTATGACATGATTGACTGGGAC
GAAAAGACGGCCCTGGCAGACGAGGTCGATATGCCTCGCGAGGCTGTGAAGCTGTGTCTGGAGGCCTCGCTGGGC
ACTGGAAGCTTCACCTTGAAAAAGAGCCCTCACGGAGACGCACGAGACCTTTTGAGCCTTCATTTTGACCTCTTC
AAGGCCAAGGCACTGCAACGTAAAGACTCCCTGCTTGCCAATGTGAGCCTGGGGGGCCTTCGAGTCAACGACGGC
ACCACGCCCAACAGCCTCTACCCCGAGATTGTGCGCGTCAAGGATGCCCCCAAAACCAAGGAGCAAAGGCGTCTT
TCCCTCATGGAGCTGGAGAGCAGCAATGGCGAGCCATTTTTCCAGTTTGAAGTGGAGCAAAATCCAATCGAGCGC
GCGGGGGATATTGCTGTTGTTGGCAAATTGAAGCCGCTCGAGGTTGTCTGGAACCCAAATTTTGTCGTGGGAATC
GTCGACTTTTTTCGACCCCCAGAGAGACACATGGAGTCTATTACGGCTCTCATGGAAAGCGCCGGCGCCACCGTA
GAAGGTATTCGAGAGCAGACTCGTGCTGGGCTAGAATTTGCGTTGGAAGAACATCGCACAGTCAATGCCGAGCTA
GACTTGCAAGCACCTCTCATCATTGTCCCTGTCAGCATCACTACCAGCAAGTCGACGTGCCTCATTATTGACGCG
GGACACATTCATGTCAATAGCCAACTGGTGGATGAGCAGACGATGAAGGAGATTCAGTCCCGACAGCGGCTTTCT
GATAGTGAAAAGGACTTCAAGCGACTAGAGTCGGTCATGTACGACAAGTTTGTCGTCAAGCTCACATCGACTCAA
GTTCTCATTGGACCTTCAATTGCCGAGACCAAGGCAGAACTTGGCTACAAGTCCGAGGGCTCTCAGCTGCACGTT
GTCGAGCAGATTAATGTTGACTTTGTTGTGGAGACATCAATTTTGCCAAAGGCGCCCAATTTGACGAGATTCAAA
GTCTCGGGCCACTTGCCAATGCTTCACGTTACCGTCTCGGATACCAAGTACAAAAATCTGATGAAAATCATTGAT
GTCGCTATTCCCAAGCTCGGACAAGAGGAAGCGACTCAAGACGCTACTGTTCAAGATCAAATCAGCCAGGCTCAG
CGCCCACGTCTGGTGACTAATAAGACTTCCAACAGGCCACGGCGCAAGTCGCAGCGTGAGCCTAGACAGTCATCT
GCCTTTCCATTTATGCAGCCTCAAACGGCGGTAGTCATTGACGACATTGACGAAGACGAGGATGACTTTGAAGAT
GCCAGCGATGGAGCGGATGCGGAGCAGCTCAAAATACAGCAGCGTACCTTTGAATTCAAGTTTACAGTTGATGTT
CTCAAGGGATCGCTTTATAGAAGCGACGCAGACAAGAGACTGCCTGATGCTCTCCTTGTGGAAATGGTGGCTGAG
CGCTTTGATCTCGACTTTTACACGAGAAGATTTGACATGGCGGCCGAGGTGTCACTCGGCTCCGTTGCCGTGGAA
GACTTTGTCGACAGCCCCTCTGCAGAGTTCAAGTCGATTGTCTCATCTGGGGATAGCGAAGACTTGCAATCTGGG
CGAAGCCTCGTCCACGTTAAACTGGTCAGGGTCAACAAGCAGTCACCCGAGTTTATGCCAGTATACGAGGGCGTG
GAGACGAATGTCACGGCTGCGATATCCACCATCAACATCATTGTCACAAGGAAAACACTGCTCACGCTCCTCGAC
TTTGTTCTCATTACCTTTACCGGAGGCGATGATTGGGAAGAGCAGCAAAGACAGCCAGCGCTTCCGGATGCAGAG
CAAGGCGGCAGCGCTTCAACTGACGACACGGTGGCTCGACAGGCCCCAAGCACCGCCTCGATACGTGTCAAGGTG
GACCTCAAGACTATCCGGCTCATCCTCAATAACGACGGGATTCGGCTGGCGACACTATCCTTCAACCATGCTGAC
GCTGGCATCTTCTTGCGTGCTAAGACTATGCGCATCTCGGTCAGACTGGGCGACGTCTCGCTTGTCGACGACGTC
AATCTGGGTGTTTCTGAGGAATCAAATCTGCGCAAACTCGTCACCATTCAGGGGGACGACTTGGCCGACTTTCGC
TACGAGACATTTGATCCGTCCAACCACAAGGCATACCCTGGTTATGACAGCTCAGTCTACCTCCGTGCTGGGTCT
GTCAAGGTCAACTTTGTGGAGGAGCCATTTCGCAAAATCATTGACTTCTTGGTCAAATTTGGCAAAATGCAGGCT
CTATACAACGCTGCTAGACAGGCGGCCGTTTCGCGTGCAAACCAAATGCAACAGAGTCCGAGCAGATTCAAGTTT
GATGTCGTGGTCAAGACGCCCATTGTTGTTTTCCCACGAATGATGTTTGCTGGACGGCCTAGCCGTGATTTAGTA
ACGGCCTTTTTGGGCGAGATATACGCACAAAACAAGTTTGCACCTCTGGACGACTCGGAACAGTCGGACATTGCC
ATGAAGATTTCCATGGGCATACGCAATGTGCGATTGACTTCCAACTTTGAGTATGACAATGAGTGGTCGGAAGAA
CTGGAGATGATTGATCACGTTGATCTCGGCTTCAATATTACTTATGCCGAGCACAAGAATGGAGCACAGCGCCCG
GATCTGGAGATTGAAGGCTCGCTGTCCGACATCAAGCTTCGACTGACGCAGCATCAGCTCAGATTTCTACTCGAG
ATTTCCAAGTCTGTACCGGCGGCCTTTGCTGGCGACGGGGCGGATGGCGATGAAGAGGCTGCCCGTCTAGTCGGG
GAGGAGACGTTGCAACGTGCCAAGACCATGTCTTGGGACGGGGGCAAGAGCAGCGACGAGCATCATGTCGACCTT
TCCCCAGAGCTCAGTGTAGCCGAGAATTGCTGGACCAAGCTGGACCTGGTTTTTCGCGTCGACACCATAGGACTT
GAACTCATCATGGCGCCACAAAACGGCCCGGTGGGAGACTTGGATGCGTCGAGCCTGTCGCGATTTTCGCTCGAT
GACACCAAGGTCAAGACGCGCATGCTTTCCGACGGCTCGCTCGAGGCCGAGTTGCTGGTTGGCTCATTCACCATT
TACGATAGTCGGCCGAGGGAGACGAACAAGTTTCGTCGCATCATGACATCGTCCAACACGGACTCGCAGCAGCTC
ATGGCTAGTCTGAGCATGTCGGGGGGCCATGACAAGAGCCTCATCGCCATGGCTACTATTGACAGCCCTCGAGTC
ATTTTTGCCCTCGACTACTTGTTTGCTCTGCACAAGTTTGCTATCGAGGGCCTGGTGCTCGACACGACGACGCCC
ATGGACGACGAGAGCTTGAACGAGACGCCCGAGGAATCGGACGCCGACTCGATGCAAGTGACGTACACGACGCCA
GGACAAGGAGCCTCTGGGCAAAAGCGGGCGGCGGAGCTCCAAGAGCAAACTTGGCCAGCCATGAGTGTTGGTTTT
AGAGTGAATCTGGTGGACGCACAGGTTATTCTCATTGCCAACCCGCTCACTCCCAGTTCAGAGGCGATTGTCTTG
AGCATTCGTCAGATGCTTCTATCTCAACAACATGCACTCACCTTTCACATTTCCCAAGTGGGCATGTTTTTATGC
CGCATGGACAAGTTTGAAACTTCGCATTTGAGAATCATTGACGACTTTTCGATACAGCTAAACATGGACAGTTCT
CAGGCCAAAGTGGTGAGCATGCACATTGACGTGGAGCCTTTGATTTTGCGACTGTCACTGCGAGATATTCTGCTG
GCGCTGCAAATCTTTGCAAGGGCGGGCGAGTTGTCTGGGGGCGACGCGACGACGCAGGAGCCCAAGCAATCGCAG
GCAGACAAGAAGGCGCGGCAGCTGGGAGATGGGGGCACGAGGAACAAGTCCCTGAGTGGGCGTGGACGAGGCCAG
TCGACCATTGCCAAGGCTAGAGGAGGCGAAGGATCGAGCGTTGGAGGAAACAAGGAGCCAGGGCGAGCGACTCTT
GGCATGACGCGGCAAGAATTGACGGCGACGATTGAGGGCATGCGCATCGTCTTGATTGGCGATGTGCACGAGCTT
CCCATTTTGGACGTGGGAGTCAAGCAGTTCACGGCAACGGCGGAGAATTGGTCGTGGGCTCTCAAGGCAGAGGCG
GCGATTGAGTTTTACTCCAACGTGTACAACTTCTCCAAGTCTAGCTGGGAGCCGCTGCTGGAGCCGTGGCAGGTG
GGCTTTGGAGTTGCCAAGGAGGCGGATAGCGGGCTGCTGGCTGTCGAGGTGGCGTCGCAAAAGACGTTTGACGTG
ACGATTACAACGGCGACGATTGCGCTGGCGTCCAAGTCGTTTGATTTTTTGACGACGGAGCAGGACGTGCTGGGC
AAGCCACGGGGAGGCGAGGCTCCGTATCGCATCCGGAACCACACGGGCTTCGACGTTGAGCTCGAGGGCAAGGCG
TCGACGAGCGAGGAGCCCCTGAGGCTGAGACTGGACGACGGGCAAGAGGGCCCGTGGAGCTTTGAGCACTGGGAG
AAGATGCGGGAGAATCTCTTGACAGAGTCGGGGCAAAACGACGTGTGTGTCAAGATGGAGGGCAGCGGCTTCGAC
ATGGTGAAGAATGTGCGACTGAGCCGCGAGGGCGAGTTTCTGTACAGCCTGCGGCCCAAGGCGGACAATGTGCTG
CACCGGCTGTGCGTCGAGGTGAGGCTGGGTGCGGACAATGTCAAGAGGGTGACGCTGCGTTCGCCGCTGCTGGTG
GAAAACGCAACGCAGATTCCCGTGGAGCTGGGCGTTTATGACGCGGACGAGGGCCATTTGCTCAAGATTGAGAAG
ATTGCGCCGGGCGACTCGCGGCCACTGCCCGTGGGGGCCGTGTACGAGAAGCGAGCGCTGGTGCGTCCAGATGGC
GGCTTTGGCTACCAGTGGAGCCAAGATGAGGTGTGGTGGCGGGAGCTGCTCAAGCGGCCAACTCGGCAGCTTCTG
TGCAGGGCGGAGAATGGGGAGCCCTTTTTCTTTCAGCTGCACGCGCAGTTTGACAGGGCGAATCCCATGTGCAAG
GCCTATCCGTACATGAGAGTTAAGCTCTCGGCGCCCGTGACGCTCGAGAACCTGCTGCCATACGACTTCAAGTAC
CGCATCTACGACAAGAACAGCAAAAAGGACTGGAGCAACTTTTTGCGCAAGGGCGGCGTCAGCCCGGTGCATGCG
GTGGAGCTGTCGCATCTGCTGCTGCTCAGCATCGACATGCAGGACAGCGTCTTCAAGCCCAGCGACTTTGGCATC
ATCAACGCGGGCAGCAGCGACGACTTCCGCAAGGAGACGCGGCTGCTGCTCAAGGACGACGAGGGCCTGGCGCTG
CACCTCAGCCTGCACTACTTCAAGACGGCCAACAGCGGAGGCGCCTTCAAGGTGGCGGTGTACAGCCCCTACATT
GTGCTCAACAAGACGGGCCTGGACCTGCGCATCCGGGCCAAGAGCTTCCTCCAGCAGGCCAGGGCGGCAGCGGGC
CAGTTCCCGCGGCTGCCAACGGGCGACTCGGAGCGGCCCAAGGCGCTGCCTCTCATGTTCTCGTTTGGCAACGAT
GACCATAGGAACAGGGCCATGCTCAAGGTGGACGAGTCTGAGTGGAGCAAGCCGCAGAGCTTCGACGCCATTGGC
AGCACGTCGGAAGTGGTGGTCATGTCGGCGTCGCGGCAGCGCGAGATGCACCTGGGCCTGACGGTGCAGTCGGGC
GACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGCCGCGCTTCATTGTGGTGAACAAGGTGGGCGAGCAA
ATGCTGGTGCGCGAGTCGACGTCGCCCGGCTACATGACGCTGCGAGGCGGCGCGCTGCAGCCGCTGCACTTTATG
CAAAAGTCGCCCGTCAAGCAGCTGTGCCTGTGCTATCCCGGCGTCGACAACCACTGGTCGGCGCCCTTCAACATT
GCCCATCTGGGCACGACGCACGTCAAGATTGCCCGTGCCCGCCAGCGCCAGCGCCTGGTGCGCGTCGAGACGCTC
ATGGAGGAGTCCACCATTTTCCTGCACCTGAGCATGGAGAGCAACAACTGGCCCTTTTCCATGCGCAACGAGAGC
GACGTCGAGTTTACCTTTTGGCAGGCCAACCCCACGCTCGACGAGGCCGATGTCGAGGACTATAGCGGCTGGAAG
CCCATTCGCTATCGCCTGCCGCGCCGCAGCATCATGCCCTATGCCTGGGACTTTCCCGCCGCCAAGTTTCGCGAG
GTGGTGATTGCCGCCCACGCCAAGGAGCGCCACGTCAAGCTGGCCGAGATTGGCAACCAGGTGCCCATGAAGATT
GTGGCGCGCGACGGCCAGCCGCAAATCATTGACATCAACGTGGCGGCCGACGGGCCCACCCAGACGCTGATTCTG
AGCAACTTCCGCCCCAGCAAGAGCATGTACAAGCCCAAGCCGCTGTCGCGCACCAGCAGCGGCCCCGACGCCTTT
GAGGTCAAGCAGCAGGAGACGGGCGCCACCCTGCGCGCCCAGCTCAAGCTCTCGGGCATTGGCATCTCCCTCATC
AATGCCCAGCTCAAGGAGCTGGCCTACATTACCTTTCGCCACGTGCAGCTGCGCTTCATGGACTCGCCCCTCATC
CAGACGCTGTCGCTGGCCGTCAAGTGGATCCAGATTGACAACCAGCTCTATGGCGGCATCTTCCCCATTGTCCTC
TACCCCAGCGTCGTGCCCAAGCGCGCCAACGAGGTCGAGGCCCACCCCTCGCTGCACGCCATGGTTAGCCGCGTC
AAGGACGACTCGTACGGCGTCGTCTACTTCAAGTACGCCACCGTGCTGGTGCAGCAGATGACGCTCGACCTGGAC
GAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCGACGTGCCCGGCGCCAGCTGGACTCTTGTCCACCACGACGGC
AAGCTGTGCGACCAGGACCTCGACATCCCCGAGCCCTCGCAGCACCAGTCGGGCCACGACATTTACTTTGAGCTG
CTCAACATCCAGCCCACGCAGCTCGACCTGAGCTTCATGCGCACAGAGCGCGTCAATGCCCAGGACAAGACGTCG
ACGCGCAACCCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCCCCCATAAGA
TTCAACGCCTTGATGCTCGACAATGTCCGCGTCACCATTCCCGTCCTCATGCAAAACATCTCCAACCACTACAGC
CAAGAGGTCATGTACCAGATCCACAAGATTCTCGGCTCCGCCGACTTTTTGGGCAACCCCGTCGGCCTCTTCAAC
AACATCTCGTCGGGCGTCACCGACATCTTTTACGAGCCCTACCAGGGCCTGATCCTCTCGGACAGGCCCGAGGAG
TTTGGCATTGGCATTGCCAAGGGCGCCGCCTCGTTTGCCAAGAAGACTGTCTATGGCTTCAGCGACAGCTTCTCC
AAGTTTACCGGCAGCTTGAGCAAGGGCCTGGCCGCCGCCTCGCTCGACAAGCAGTTCCAGGACCGCCGCCGCATC
ACCAGGGCCCGCAACAGGCCCAAGCACGCCCTCTACGGCGTCACAGCCGGAGCCAACTCGCTCTTCACCAGCGTC
GCCTCTGGCGTTGGCGGCCTGGCCCGCAAGCCCCTCGAGGGTGCCGAGCAGGAGGGCGCCCTCGGCTTCTTCAAG
GGCGTCGGCAAGGGCGTGCTTGGCCTGGCCACCAAGCCCGCCGTTGGCGTCCTCGACATGGCCAGCAACGTGAGC
GAGGGCATTCGCAACACAACCACTGTCTTTGACGGCTCCGAGCTGGACCGCGCCCGCTACCCGCGCTTCATTCCA
AACGACGGCATCGTGCGCCCCTATAATGCCCGCGAGGCTCTGGGGCAGTACTGGCTCAAGCAGGTGGACAATGGC
CGCTACTTTGACGAGCAGTACATTGGCCACCTCGAGCTGCCCAAGGAGGACATGGTGGTCATGGTGACGTATGCG
CGCATTCTGCTTATCCGCTCGAGGCGCCTGACGAGCGAGTGGGACGTGCCGCTCAAGGATGTGCAGACCATTGCC
AAGGAGCGCACAGGCGTCAGCCTGGTGCTGCGAGGAGGGGCTAATGGACCCTTTATCCCGGTCGGCGGTGGCAGC
GAGAGGAGCTTCTTGTACCGCATGGTGGGCGTTGCAGTGGAAGAGTTCAACCGGCGCTTCAGAGGCGGCGACTAA
Gene >OphauB2|7982
ATGCTCGAGGGACTCGTCGCAGGCCTGCTCAACCGCTTCCTGGGAATGTATGTCAAAAACTTTGACCCCACGCAG
CTCAAGGTGGGCATATGGTCTGGTGATGTCAAACTTCGCAATCTCGAGCTTCGCCGCGAAGCCCTCGACCAGCTT
AAGTTACCCATCAACGTCATCGAGGGCCATCTTGGCGACCTCACTCTTGTCATTCCTTGGTCAAATCTGCGAGGC
GCTCCCGTCAAGGTCTTTATCGAAGATGTCTTTCTTCTCGCTAGCCCCAAGGAAGAGGCCGAATATGACGAGGCC
GAAGAGGAGCGCAGAAGGCAGCGTCTCAAAATGGAAAAGTTGGACAGCGCCGAGCTTCTCAAGGAGCGCAACCGC
GACGGCATGAGCCAAGAGGAGCAAAAGAAAAACCAGAGTTTCACGCAGAGCCTCGTCACCAAGGTTGTCGACAAC
CTTCAAGTTACTGTAAAAAATATACACGTGCGCTACGAAGACTCAATATCTGCCCCAGGCCATCCATTTGCTCTG
GGCCTGACTCTCCAAGAGTTTTCTGCCGTCAGCACGGATGGAAATTGGACTCCAACCTTTATACAAGATTCTTCA
TCCGTCACCCATAAGCTCGCCACACTGGGTGCTCTGGCTGTCTACTGGAACACTGACTCGGAGCTCTTTGGCAGC
GGCCGCGAGGCTCAGCCACCTCCCGAGGAAGCCATGTCGCACCATGACATGGTGGACCGGTTCAAGGCCATGATT
GTATCCACGAGTGCGGCCGACGCCAACAACCAGTTTATCCTCAAGCCTGTCAGTGGCCAGGCCAAGATTGAACTC
GACAAGTCTGGAGACATACGTGTGCCCAAGTTCAAGGCCAACTTGCTGTTCGAGGAGATTGGCCTTGTGCTCGAT
GACAATCAATATCGCGATGCCCTCATGATGGTAGATCTCTTTCACTATTTTATTCGCCACCAGGAATACAAGGCT
CTGAAGCCCAAGGGCGTTCGCCCAAGCCAAGACCCCAAGGCATGGCTTCAGTTTGCTGGAAACGCCGTCTTGGGC
AAAATACACGAAAAGAACCGCCAGTGGTCCTGGGACTATTTTCGACAACGGCGCGACGATCGCATTAGTTATATA
GAACTGTTCAAGAAGAAGAAACAGCAACAGCAACTGTCTCCTGACGATGTGGAACGTCTTGGCAATCTCGAATGG
AAATTGAGCTACGAGGACCTGCGCTTCTGGAGGTCTTTGGCCCGCAACCAGTTGAAGAAGGAAAACGCGGCGGCA
TTGAAGAAACAGTCGGAGACACAGGACCAGCAAGGATGGCTGGCCTGGATGTGGGGCTCCAAGCCTCAGGGACGC
ATCGAGAAGAATGAAGAAAACACCCAGATGACTGAGGAGCAGCGCAAGGAGCTGTATGACATGATTGACTGGGAC
GAAAAGACGGCCCTGGCAGACGAGGTCGATATGCCTCGCGAGGCTGTGAAGCTGTGTCTGGAGGCCTCGCTGGGC
ACTGGAAGCTTCACCTTGAAAAAGAGCCCTCACGGAGACGCACGAGACCTTTTGAGCCTTCATTTTGACCTCTTC
AAGGCCAAGGCACTGCAACGTAAAGACTCCCTGCTTGCCAATGTGAGCCTGGGGGGCCTTCGAGTCAACGACGGC
ACCACGCCCAACAGCCTCTACCCCGAGATTGTGCGCGTCAAGGATGCCCCCAAAACCAAGGAGCAAAGGCGTCTT
TCCCTCATGGAGCTGGAGAGCAGCAATGGCGAGCCATTTTTCCAGTTTGAAGTGGAGCAAAATCCAATCGAGCGC
GCGGGGGATATTGCTGTTGTTGGCAAATTGAAGCCGCTCGAGGTTGTCTGGAACCCAAATTTTGTCGTGGGAATC
GTCGACTTTTTTCGACCCCCAGAGAGACACATGGAGTCTATTACGGCTCTCATGGAAAGCGCCGGCGCCACCGTA
GAAGGTATTCGAGAGCAGACTCGTGCTGGGCTAGAATTTGCGTTGGAAGAACATCGCACAGTCAATGCCGAGCTA
GACTTGCAAGCACCTCTCATCATTGTCCCTGTCAGCATCACTACCAGCAAGTCGACGTGCCTCATTATTGACGCG
GGACACATTCATGTCAATAGCCAACTGGTGGATGAGCAGACGATGAAGGAGATTCAGTCCCGACAGCGGCTTTCT
GATAGTGAAAAGGACTTCAAGCGACTAGAGTCGGTCATGTACGACAAGTTTGTCGTCAAGCTCACATCGACTCAA
GTTCTCATTGGACCTTCAATTGCCGAGACCAAGGCAGAACTTGGCTACAAGTCCGAGGGCTCTCAGCTGCACGTT
GTCGAGCAGATTAATGTTGACTTTGTTGTGGAGACATCAATTTTGCCAAAGGCGCCCAATTTGACGAGATTCAAA
GTCTCGGGCCACTTGCCAATGCTTCACGTTACCGTCTCGGATACCAAGTACAAAAATCTGATGAAAATCATTGAT
GTCGCTATTCCCAAGCTCGGACAAGAGGAAGCGACTCAAGACGCTACTGTTCAAGATCAAATCAGCCAGGCTCAG
CGCCCACGTCTGGTGACTAATAAGACTTCCAACAGGCCACGGCGCAAGTCGCAGCGTGAGCCTAGACAGTCATCT
GCCTTTCCATTTATGCAGCCTCAAACGGCGGTAGTCATTGACGACATTGACGAAGACGAGGATGACTTTGAAGAT
GCCAGCGATGGAGCGGATGCGGAGCAGCTCAAAATACAGCAGCGTACCTTTGAATTCAAGTTTACAGTTGATGTT
CTCAAGGGATCGCTTTATAGAAGCGACGCAGACAAGAGACTGCCTGATGCTCTCCTTGTGGAAATGGTGGCTGAG
CGCTTTGATCTCGACTTTTACACGAGAAGATTTGACATGGCGGCCGAGGTGTCACTCGGCTCCGTTGCCGTGGAA
GACTTTGTCGACAGCCCCTCTGCAGAGTTCAAGTCGATTGTCTCATCTGGGGATAGCGAAGACTTGCAATCTGGG
CGAAGCCTCGTCCACGTTAAACTGGTCAGGGTCAACAAGCAGTCACCCGAGTTTATGCCAGTATACGAGGGCGTG
GAGACGAATGTCACGGCTGCGATATCCACCATCAACATCATTGTCACAAGGAAAACACTGCTCACGCTCCTCGAC
TTTGTTCTCATTACCTTTACCGGAGGCGATGATTGGGAAGAGCAGCAAAGACAGCCAGCGCTTCCGGATGCAGAG
CAAGGCGGCAGCGCTTCAACTGACGACACGGTGGCTCGACAGGCCCCAAGCACCGCCTCGATACGTGTCAAGGTG
GACCTCAAGACTATCCGGCTCATCCTCAATAACGACGGGATTCGGCTGGCGACACTATCCTTCAACCATGCTGAC
GCTGGCATCTTCTTGCGTGCTAAGACTATGCGCATCTCGGTCAGACTGGGCGACGTCTCGCTTGTCGACGACGTC
AATCTGGGTGTTTCTGAGGAATCAAATCTGCGCAAACTCGTCACCATTCAGGGGGACGACTTGGCCGACTTTCGC
TACGAGACATTTGATCCGTCCAACCACAAGGCATACCCTGGTTATGACAGCTCAGTCTACCTCCGTGCTGGGTCT
GTCAAGGTCAACTTTGTGGAGGAGCCATTTCGCAAAATCATTGACTTCTTGGTCAAATTTGGCAAAATGCAGGCT
CTATACAACGCTGCTAGACAGGCGGCCGTTTCGCGTGCAAACCAAATGCAACAGAGTCCGAGCAGATTCAAGTTT
GATGTCGTGGTCAAGACGCCCATTGTTGTTTTCCCACGAATGATGTTTGCTGGACGGCCTAGCCGTGATTTAGTA
ACGGCCTTTTTGGGCGAGATATACGCACAAAACAAGTTTGCACCTCTGGACGACTCGGAACAGTCGGACATTGCC
ATGAAGATTTCCATGGGCATACGCAATGTGCGATTGACTTCCAACTTTGAGTATGACAATGAGTGGTCGGAAGAA
CTGGAGATGATTGATCACGTTGATCTCGGCTTCAATATTACTTATGCCGAGCACAAGAATGGAGCACAGCGCCCG
GATCTGGAGATTGAAGGCTCGCTGTCCGACATCAAGCTTCGACTGACGCAGCATCAGCTCAGATTTCTACTCGAG
ATTTCCAAGTCTGTACCGGCGGCCTTTGCTGGCGACGGGGCGGATGGCGATGAAGAGGCTGCCCGTCTAGTCGGG
GAGGAGACGTTGCAACGTGCCAAGACCATGTCTTGGGACGGGGGCAAGAGCAGCGACGAGCATCATGTCGACCTT
TCCCCAGAGCTCAGTGTAGCCGAGAATTGCTGGACCAAGCTGGACCTGGTTTTTCGCGTCGACACCATAGGACTT
GAACTCATCATGGCGCCACAAAACGGCCCGGTGGGAGACTTGGATGCGTCGAGCCTGTCGCGATTTTCGCTCGAT
GACACCAAGGTCAAGACGCGCATGCTTTCCGACGGCTCGCTCGAGGCCGAGTTGCTGGTTGGCTCATTCACCATT
TACGATAGTCGGCCGAGGGAGACGAACAAGTTTCGTCGCATCATGACATCGTCCAACACGGACTCGCAGCAGCTC
ATGGCTAGTCTGAGCATGTCGGGGGGCCATGACAAGAGCCTCATCGCCATGGCTACTATTGACAGCCCTCGAGTC
ATTTTTGCCCTCGACTACTTGTTTGCTCTGCACAAGTTTGCTATCGAGGGCCTGGTGCTCGACACGACGACGCCC
ATGGACGACGAGAGCTTGAACGAGACGCCCGAGGAATCGGACGCCGACTCGATGCAAGTGACGTACACGACGCCA
GGACAAGGAGCCTCTGGGCAAAAGCGGGCGGCGGAGCTCCAAGAGCAAACTTGGCCAGCCATGAGTGTTGGTTTT
AGAGTGAATCTGGTGGACGCACAGGTTATTCTCATTGCCAACCCGCTCACTCCCAGTTCAGAGGCGATTGTCTTG
AGCATTCGTCAGATGCTTCTATCTCAACAACATGCACTCACCTTTCACATTTCCCAAGTGGGCATGTTTTTATGC
CGCATGGACAAGTTTGAAACTTCGCATTTGAGAATCATTGACGACTTTTCGATACAGCTAAACATGGACAGTTCT
CAGGCCAAAGTGGTGAGCATGCACATTGACGTGGAGCCTTTGATTTTGCGACTGTCACTGCGAGATATTCTGCTG
GCGCTGCAAATCTTTGCAAGGGCGGGCGAGTTGTCTGGGGGCGACGCGACGACGCAGGAGCCCAAGCAATCGCAG
GCAGACAAGAAGGCGCGGCAGCTGGGAGATGGGGGCACGAGGAACAAGTCCCTGAGTGGGCGTGGACGAGGCCAG
TCGACCATTGCCAAGGCTAGAGGAGGCGAAGGATCGAGCGTTGGAGGAAACAAGGAGCCAGGGCGAGCGACTCTT
GGCATGACGCGGCAAGAATTGACGGCGACGATTGAGGGCATGCGCATCGTCTTGATTGGCGATGTGCACGAGCTT
CCCATTTTGGACGTGGGAGTCAAGCAGTTCACGGCAACGGCGGAGAATTGGTCGTGGGCTCTCAAGGCAGAGGCG
GCGATTGAGTTTTACTCCAACGTGTACAACTTCTCCAAGTCTAGCTGGGAGCCGCTGCTGGAGCCGTGGCAGGTG
GGCTTTGGAGTTGCCAAGGAGGCGGATAGCGGGCTGCTGGCTGTCGAGGTGGCGTCGCAAAAGACGTTTGACGTG
ACGATTACAACGGCGACGATTGCGCTGGCGTCCAAGTCGTTTGATTTTTTGACGACGGAGCAGGACGTGCTGGGC
AAGCCACGGGGAGGCGAGGCTCCGTATCGCATCCGGAACCACACGGGCTTCGACGTTGAGCTCGAGGGCAAGGCG
TCGACGAGCGAGGAGCCCCTGAGGCTGAGACTGGACGACGGGCAAGAGGGCCCGTGGAGCTTTGAGCACTGGGAG
AAGATGCGGGAGAATCTCTTGACAGAGTCGGGGCAAAACGACGTGTGTGTCAAGATGGAGGGCAGCGGCTTCGAC
ATGGTGAAGAATGTGCGACTGAGCCGCGAGGGCGAGTTTCTGTACAGCCTGCGGCCCAAGGCGGACAATGTGCTG
CACCGGCTGTGCGTCGAGGTGAGGCTGGGTGCGGACAATGTCAAGAGGGTGACGCTGCGTTCGCCGCTGCTGGTG
GAAAACGCAACGCAGATTCCCGTGGAGCTGGGCGTTTATGACGCGGACGAGGGCCATTTGCTCAAGATTGAGAAG
ATTGCGCCGGGCGACTCGCGGCCACTGCCCGTGGGGGCCGTGTACGAGAAGCGAGCGCTGGTGCGTCCAGATGGC
GGCTTTGGCTACCAGTGGAGCCAAGATGAGGTGTGGTGGCGGGAGCTGCTCAAGCGGCCAACTCGGCAGCTTCTG
TGCAGGGCGGAGAATGGGGAGCCCTTTTTCTTTCAGCTGCACGCGCAGTTTGACAGGGCGAATCCCATGTGCAAG
TGAGGCCTCCTTTTTTTTTTTCTCCCCTTTTTCCTCCCCTCCATTTTTCCTCTCCTTTTTCCTCCTCTTTTTATG
GTTTCCCCCTCGCTTGTTTGTCTCTCTCTCTCTCTCTCTTTGTGGCTTGTGTGTTTGTCTCTCTCTTTCTCTCTC
TCTTTGTGGCTGACGACGGGACACGCCCCAGGGCCTATCCGTACATGAGAGTTAAGCTCTCGGCGCCCGTGACGC
TCGAGAACCTGCTGCCATACGACTTCAAGTACCGCATCTACGACAAGAACAGCAAAAAGGACTGGAGCAACTTTT
TGCGCAAGGGCGGCGTCAGCCCGGTGCATGCGGTGGAGCTGTCGCATCTGCTGCTGCTCAGCATCGACATGCAGG
ACAGCGTCTTCAAGCCCAGCGACTTTGGCATCATCAACGCGGGCAGCAGCGACGACTTCCGCAAGGAGACGCGGC
TGCTGCTCAAGGACGACGAGGGCCTGGCGCTGCACCTCAGCCTGCACTACTTCAAGACGGCCAACAGCGGAGGCG
CCTTCAAGGTGGCGGTGTACAGCCCCTACATTGTGCTCAACAAGACGGGCCTGGACCTGCGCATCCGGGCCAAGA
GCTTCCTCCAGCAGGCCAGGGCGGCAGCGGGCCAGTTCCCGCGGCTGCCAACGGGCGACTCGGAGCGGCCCAAGG
CGCTGCCTCTCATGTTCTCGTTTGGCAACGATGACCATAGGAACAGGGCCATGCTCAAGGTGGACGAGTCTGAGT
GGAGCAAGCCGCAGAGCTTCGACGCCATTGGCAGCACGTCGGAAGTGGTGGTCATGTCGGCGTCGCGGCAGCGCG
AGATGCACCTGGGCCTGACGGTGCAGTCGGGCGACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGCCGC
GCTTCATTGTGGTGAACAAGGTGGGCGAGCAAATGCTGGTGCGCGAGTCGACGTCGCCCGGCTACATGACGCTGC
GAGGCGGCGCGCTGCAGCCGCTGCACTTTATGCAAAAGTCGCCCGTCAAGCAGCTGTGCCTGTGCTATCCCGGCG
TCGACAACCACTGGTCGGCGCCCTTCAACATTGCCCATCTGGGCACGACGCACGTCAAGATTGCCCGTGCCCGCC
AGCGCCAGCGCCTGGTGCGCGTCGAGACGCTCATGGAGGAGTCCACCATTTTCCTGCACCTGAGCATGGAGAGCA
ACAACTGGCCCTTTTCCATGCGCAACGAGAGCGACGTCGAGTTTACCTTTTGGCAGGCCAACCCCACGCTCGACG
AGGCCGATGTCGAGGACTATAGCGGCTGGAAGCCCATTCGCTATCGCCTGCCGCGCCGCAGCATCATGCCCTATG
CCTGGGACTTTCCCGCCGCCAAGTTTCGCGAGGTGGTGATTGCCGCCCACGCCAAGGAGCGCCACGTCAAGCTGG
CCGAGATTGGCAACCAGGTGCCCATGAAGATTGTGGCGCGCGACGGCCAGCCGCAAATCATTGACATCAACGTGG
CGGCCGACGGGCCCACCCAGACGCTGATTCTGAGCAACTTCCGCCCCAGCAAGAGCATGTACAAGCCCAAGCCGC
TGTCGCGCACCAGCAGCGGCCCCGACGCCTTTGAGGTCAAGCAGCAGGAGACGGGCGCCACCCTGCGCGCCCAGC
TCAAGCTCTCGGGCATTGGCATCTCCCTCATCAATGCCCAGCTCAAGGAGCTGGCCTACATTACCTTTCGCCACG
TGCAGCTGCGCTTCATGGACTCGCCCCTCATCCAGACGCTGTCGCTGGCCGTCAAGTGGATCCAGATTGACAACC
AGCTCTATGGCGGCATCTTCCCCATTGTCCTCTACCCCAGCGTCGTGCCCAAGCGCGCCAACGAGGTCGAGGCCC
ACCCCTCGCTGCACGCCATGGTTAGCCGCGTCAAGGACGACTCGTACGGCGTCGTCTACTTCAAGTACGCCACCG
TGCTGGTGCAGCAGATGACGCTCGACCTGGACGAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCGACGTGCCCG
GCGCCAGCTGGACTCTTGTCCACCACGACGGCAAGCTGTGCGACCAGGACCTCGACATCCCCGAGCCCTCGCAGC
ACCAGTCGGGCCACGACATTTACTTTGAGCTGCTCAACATCCAGCCCACGCAGCTCGACCTGAGCTTCATGCGCA
CAGAGCGCGTCAATGCCCAGGACAAGACGTCGACGCGCAACCCCATCATGTTCTTCCTCAACGTCATGACCATGG
CCATTGGCAACGTCAACGACGCCCCCATAAGATTCAACGCCTTGATGCTCGACAATGTCCGCGTCACCATTCCCG
TCCTCATGCAAAACATCTCCAACCACTACAGCCAAGAGGTCATGTACCAGATCCACAAGATTCTCGGCTCCGCCG
ACTTTTTGGGCAACCCCGTCGGCCTCTTCAACAACATCTCGTCGGGCGTCACCGACATCTTTTACGAGCCCTACC
AGGGCCTGATCCTCTCGGACAGGCCCGAGGAGTTTGGCATTGGCATTGCCAAGGGCGCCGCCTCGTTTGCCAAGA
AGACTGTCTATGGCTTCAGCGACAGCTTCTCCAAGTTTACCGGCAGCTTGAGCAAGGGCCTGGCCGCCGCCTCGC
TCGACAAGCAGTTCCAGGACCGCCGCCGCATCACCAGGGCCCGCAACAGGCCCAAGCACGCCCTCTACGGCGTCA
CAGCCGGAGCCAACTCGCTCTTCACCAGCGTCGCCTCTGGCGTTGGCGGCCTGGCCCGCAAGCCCCTCGAGGGTG
CCGAGCAGGAGGGCGCCCTCGGCTTCTTCAAGGGCGTCGGCAAGGGCGTGCTTGGCCTGGCCACCAAGCCCGCCG
TTGGCGTCCTCGACATGGCCAGCAACGTGAGCGAGGGCATTCGCAACACAACCACTGTCTTTGACGGCTCCGAGC
TGGACCGCGCCCGCTACCCGCGCTTCATTCCAAACGACGGCATCGTGCGCCCCTATAATGCCCGCGAGGCTCTGG
GGCAGTACTGGCTCAAGCAGGTGGACAATGGCCGCTACTTTGACGAGCAGTACATTGGCCACCTCGAGCTGCCCA
AGGAGGACATGGTGGTCATGGTGACGTATGCGCGCATTCTGCTTATCCGCTCGAGGCGCCTGACGAGCGAGTGGG
ACGTGCCGCTCAAGGATGTGCAGACCATTGCCAAGGAGCGCACAGGCGTCAGCCTGGTGCTGCGAGGAGGGGCTA
ATGGACCCTTTATCCCGGTCGGCGGTGGCAGCGAGAGGAGCTTCTTGTACCGCATGGTGGGCGTTGCAGTGGAAG
AGTTCAACCGGCGCTTCAGAGGCGGCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail