Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7982
Gene name
LocationContig_92:39840..49622
Strand+
Gene length (bp)9782
Transcript length (bp)9600
Coding sequence length (bp)9600
Protein length (aa) 3200

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 8.9E-89 2266 2547
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 3.5E-87 593 829
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 2.5E-84 139 380
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 2.0E-71 2795 2970
PF12624 Chorein_N N-terminal region of Chorein or VPS13 9.8E-40 2 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 1 3143 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 1 3193 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1188 3146 0.0E+00
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1 1376 2.0E-103
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 1 1376 3.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 1 3143 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 1 3193 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1188 3146 0.0E+00
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1 1376 2.0E-103
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 1 1376 3.0E-99
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 1 1049 2.0E-98
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1 1299 2.0E-96
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1 1297 2.0E-96
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1 820 1.0E-88
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 1 685 1.0E-82
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 2143 3134 2.0E-82
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 2034 3092 3.0E-70
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 1 835 3.0E-68
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 2532 3166 4.0E-68
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 2685 3139 3.0E-64
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 2618 3139 6.0E-63
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 2665 3145 6.0E-63
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 2665 3145 2.0E-62
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1 846 7.0E-61
sp|Q9BGZ0|VP13A_MACFA Vacuolar protein sorting-associated protein 13A (Fragment) OS=Macaca fascicularis GN=VPS13A PE=2 SV=1 2618 3101 3.0E-58
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 2640 3158 3.0E-50
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 2539 3116 5.0E-50
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2796 3131 2.0E-47
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 567 2448 4.0E-43
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 958 2410 3.0E-42
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 138 422 5.0E-42
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 2584 3109 2.0E-40
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1441 2545 1.0E-23
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 1 137 1.0E-20
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 202 708 3.0E-20
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 2845 3077 1.0E-19
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 2845 3091 2.0E-19
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1795 2414 7.0E-19
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2359 2759 1.0E-14
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 1 193 2.0E-14
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1811 2414 3.0E-14
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 1 89 2.0E-12
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 1 82 3.0E-11
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 1 82 3.0E-11
sp|Q86K84|VP13L_DICDI Vacuolar protein sorting-associated protein 13-like protein OS=Dictyostelium discoideum GN=vps13l PE=3 SV=1 2876 3065 4.0E-10
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1002 1288 9.0E-10
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 586 707 1.0E-09
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 2981 3062 2.0E-08
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 143 248 8.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2095
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3932
Ophiocordyceps australis map64 (Brazil) OphauB2|7982 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00644
Ophiocordyceps camponoti-rufipedis Ophun1|2027
Ophiocordyceps kimflemingae Ophio5|4142
Ophiocordyceps subramaniannii Hirsu2|2462

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7982
MLEGLVAGLLNRFLGMYVKNFDPTQLKVGIWSGDVKLRNLELRREALDQLKLPINVIEGHLGDLTLVIPWSNLRG
APVKVFIEDVFLLASPKEEAEYDEAEEERRRQRLKMEKLDSAELLKERNRDGMSQEEQKKNQSFTQSLVTKVVDN
LQVTVKNIHVRYEDSISAPGHPFALGLTLQEFSAVSTDGNWTPTFIQDSSSVTHKLATLGALAVYWNTDSELFGS
GREAQPPPEEAMSHHDMVDRFKAMIVSTSAADANNQFILKPVSGQAKIELDKSGDIRVPKFKANLLFEEIGLVLD
DNQYRDALMMVDLFHYFIRHQEYKALKPKGVRPSQDPKAWLQFAGNAVLGKIHEKNRQWSWDYFRQRRDDRISYI
ELFKKKKQQQQLSPDDVERLGNLEWKLSYEDLRFWRSLARNQLKKENAAALKKQSETQDQQGWLAWMWGSKPQGR
IEKNEENTQMTEEQRKELYDMIDWDEKTALADEVDMPREAVKLCLEASLGTGSFTLKKSPHGDARDLLSLHFDLF
KAKALQRKDSLLANVSLGGLRVNDGTTPNSLYPEIVRVKDAPKTKEQRRLSLMELESSNGEPFFQFEVEQNPIER
AGDIAVVGKLKPLEVVWNPNFVVGIVDFFRPPERHMESITALMESAGATVEGIREQTRAGLEFALEEHRTVNAEL
DLQAPLIIVPVSITTSKSTCLIIDAGHIHVNSQLVDEQTMKEIQSRQRLSDSEKDFKRLESVMYDKFVVKLTSTQ
VLIGPSIAETKAELGYKSEGSQLHVVEQINVDFVVETSILPKAPNLTRFKVSGHLPMLHVTVSDTKYKNLMKIID
VAIPKLGQEEATQDATVQDQISQAQRPRLVTNKTSNRPRRKSQREPRQSSAFPFMQPQTAVVIDDIDEDEDDFED
ASDGADAEQLKIQQRTFEFKFTVDVLKGSLYRSDADKRLPDALLVEMVAERFDLDFYTRRFDMAAEVSLGSVAVE
DFVDSPSAEFKSIVSSGDSEDLQSGRSLVHVKLVRVNKQSPEFMPVYEGVETNVTAAISTINIIVTRKTLLTLLD
FVLITFTGGDDWEEQQRQPALPDAEQGGSASTDDTVARQAPSTASIRVKVDLKTIRLILNNDGIRLATLSFNHAD
AGIFLRAKTMRISVRLGDVSLVDDVNLGVSEESNLRKLVTIQGDDLADFRYETFDPSNHKAYPGYDSSVYLRAGS
VKVNFVEEPFRKIIDFLVKFGKMQALYNAARQAAVSRANQMQQSPSRFKFDVVVKTPIVVFPRMMFAGRPSRDLV
TAFLGEIYAQNKFAPLDDSEQSDIAMKISMGIRNVRLTSNFEYDNEWSEELEMIDHVDLGFNITYAEHKNGAQRP
DLEIEGSLSDIKLRLTQHQLRFLLEISKSVPAAFAGDGADGDEEAARLVGEETLQRAKTMSWDGGKSSDEHHVDL
SPELSVAENCWTKLDLVFRVDTIGLELIMAPQNGPVGDLDASSLSRFSLDDTKVKTRMLSDGSLEAELLVGSFTI
YDSRPRETNKFRRIMTSSNTDSQQLMASLSMSGGHDKSLIAMATIDSPRVIFALDYLFALHKFAIEGLVLDTTTP
MDDESLNETPEESDADSMQVTYTTPGQGASGQKRAAELQEQTWPAMSVGFRVNLVDAQVILIANPLTPSSEAIVL
SIRQMLLSQQHALTFHISQVGMFLCRMDKFETSHLRIIDDFSIQLNMDSSQAKVVSMHIDVEPLILRLSLRDILL
ALQIFARAGELSGGDATTQEPKQSQADKKARQLGDGGTRNKSLSGRGRGQSTIAKARGGEGSSVGGNKEPGRATL
GMTRQELTATIEGMRIVLIGDVHELPILDVGVKQFTATAENWSWALKAEAAIEFYSNVYNFSKSSWEPLLEPWQV
GFGVAKEADSGLLAVEVASQKTFDVTITTATIALASKSFDFLTTEQDVLGKPRGGEAPYRIRNHTGFDVELEGKA
STSEEPLRLRLDDGQEGPWSFEHWEKMRENLLTESGQNDVCVKMEGSGFDMVKNVRLSREGEFLYSLRPKADNVL
HRLCVEVRLGADNVKRVTLRSPLLVENATQIPVELGVYDADEGHLLKIEKIAPGDSRPLPVGAVYEKRALVRPDG
GFGYQWSQDEVWWRELLKRPTRQLLCRAENGEPFFFQLHAQFDRANPMCKAYPYMRVKLSAPVTLENLLPYDFKY
RIYDKNSKKDWSNFLRKGGVSPVHAVELSHLLLLSIDMQDSVFKPSDFGIINAGSSDDFRKETRLLLKDDEGLAL
HLSLHYFKTANSGGAFKVAVYSPYIVLNKTGLDLRIRAKSFLQQARAAAGQFPRLPTGDSERPKALPLMFSFGND
DHRNRAMLKVDESEWSKPQSFDAIGSTSEVVVMSASRQREMHLGLTVQSGDGKYKMTKVVTLAPRFIVVNKVGEQ
MLVRESTSPGYMTLRGGALQPLHFMQKSPVKQLCLCYPGVDNHWSAPFNIAHLGTTHVKIARARQRQRLVRVETL
MEESTIFLHLSMESNNWPFSMRNESDVEFTFWQANPTLDEADVEDYSGWKPIRYRLPRRSIMPYAWDFPAAKFRE
VVIAAHAKERHVKLAEIGNQVPMKIVARDGQPQIIDINVAADGPTQTLILSNFRPSKSMYKPKPLSRTSSGPDAF
EVKQQETGATLRAQLKLSGIGISLINAQLKELAYITFRHVQLRFMDSPLIQTLSLAVKWIQIDNQLYGGIFPIVL
YPSVVPKRANEVEAHPSLHAMVSRVKDDSYGVVYFKYATVLVQQMTLDLDEDFVFALLDFSDVPGASWTLVHHDG
KLCDQDLDIPEPSQHQSGHDIYFELLNIQPTQLDLSFMRTERVNAQDKTSTRNPIMFFLNVMTMAIGNVNDAPIR
FNALMLDNVRVTIPVLMQNISNHYSQEVMYQIHKILGSADFLGNPVGLFNNISSGVTDIFYEPYQGLILSDRPEE
FGIGIAKGAASFAKKTVYGFSDSFSKFTGSLSKGLAAASLDKQFQDRRRITRARNRPKHALYGVTAGANSLFTSV
ASGVGGLARKPLEGAEQEGALGFFKGVGKGVLGLATKPAVGVLDMASNVSEGIRNTTTVFDGSELDRARYPRFIP
NDGIVRPYNAREALGQYWLKQVDNGRYFDEQYIGHLELPKEDMVVMVTYARILLIRSRRLTSEWDVPLKDVQTIA
KERTGVSLVLRGGANGPFIPVGGGSERSFLYRMVGVAVEEFNRRFRGGD*
Coding >OphauB2|7982
ATGCTCGAGGGACTCGTCGCAGGCCTGCTCAACCGCTTCCTGGGAATGTATGTCAAAAACTTTGACCCCACGCAG
CTCAAGGTGGGCATATGGTCTGGTGATGTCAAACTTCGCAATCTCGAGCTTCGCCGCGAAGCCCTCGACCAGCTT
AAGTTACCCATCAACGTCATCGAGGGCCATCTTGGCGACCTCACTCTTGTCATTCCTTGGTCAAATCTGCGAGGC
GCTCCCGTCAAGGTCTTTATCGAAGATGTCTTTCTTCTCGCTAGCCCCAAGGAAGAGGCCGAATATGACGAGGCC
GAAGAGGAGCGCAGAAGGCAGCGTCTCAAAATGGAAAAGTTGGACAGCGCCGAGCTTCTCAAGGAGCGCAACCGC
GACGGCATGAGCCAAGAGGAGCAAAAGAAAAACCAGAGTTTCACGCAGAGCCTCGTCACCAAGGTTGTCGACAAC
CTTCAAGTTACTGTAAAAAATATACACGTGCGCTACGAAGACTCAATATCTGCCCCAGGCCATCCATTTGCTCTG
GGCCTGACTCTCCAAGAGTTTTCTGCCGTCAGCACGGATGGAAATTGGACTCCAACCTTTATACAAGATTCTTCA
TCCGTCACCCATAAGCTCGCCACACTGGGTGCTCTGGCTGTCTACTGGAACACTGACTCGGAGCTCTTTGGCAGC
GGCCGCGAGGCTCAGCCACCTCCCGAGGAAGCCATGTCGCACCATGACATGGTGGACCGGTTCAAGGCCATGATT
GTATCCACGAGTGCGGCCGACGCCAACAACCAGTTTATCCTCAAGCCTGTCAGTGGCCAGGCCAAGATTGAACTC
GACAAGTCTGGAGACATACGTGTGCCCAAGTTCAAGGCCAACTTGCTGTTCGAGGAGATTGGCCTTGTGCTCGAT
GACAATCAATATCGCGATGCCCTCATGATGGTAGATCTCTTTCACTATTTTATTCGCCACCAGGAATACAAGGCT
CTGAAGCCCAAGGGCGTTCGCCCAAGCCAAGACCCCAAGGCATGGCTTCAGTTTGCTGGAAACGCCGTCTTGGGC
AAAATACACGAAAAGAACCGCCAGTGGTCCTGGGACTATTTTCGACAACGGCGCGACGATCGCATTAGTTATATA
GAACTGTTCAAGAAGAAGAAACAGCAACAGCAACTGTCTCCTGACGATGTGGAACGTCTTGGCAATCTCGAATGG
AAATTGAGCTACGAGGACCTGCGCTTCTGGAGGTCTTTGGCCCGCAACCAGTTGAAGAAGGAAAACGCGGCGGCA
TTGAAGAAACAGTCGGAGACACAGGACCAGCAAGGATGGCTGGCCTGGATGTGGGGCTCCAAGCCTCAGGGACGC
ATCGAGAAGAATGAAGAAAACACCCAGATGACTGAGGAGCAGCGCAAGGAGCTGTATGACATGATTGACTGGGAC
GAAAAGACGGCCCTGGCAGACGAGGTCGATATGCCTCGCGAGGCTGTGAAGCTGTGTCTGGAGGCCTCGCTGGGC
ACTGGAAGCTTCACCTTGAAAAAGAGCCCTCACGGAGACGCACGAGACCTTTTGAGCCTTCATTTTGACCTCTTC
AAGGCCAAGGCACTGCAACGTAAAGACTCCCTGCTTGCCAATGTGAGCCTGGGGGGCCTTCGAGTCAACGACGGC
ACCACGCCCAACAGCCTCTACCCCGAGATTGTGCGCGTCAAGGATGCCCCCAAAACCAAGGAGCAAAGGCGTCTT
TCCCTCATGGAGCTGGAGAGCAGCAATGGCGAGCCATTTTTCCAGTTTGAAGTGGAGCAAAATCCAATCGAGCGC
GCGGGGGATATTGCTGTTGTTGGCAAATTGAAGCCGCTCGAGGTTGTCTGGAACCCAAATTTTGTCGTGGGAATC
GTCGACTTTTTTCGACCCCCAGAGAGACACATGGAGTCTATTACGGCTCTCATGGAAAGCGCCGGCGCCACCGTA
GAAGGTATTCGAGAGCAGACTCGTGCTGGGCTAGAATTTGCGTTGGAAGAACATCGCACAGTCAATGCCGAGCTA
GACTTGCAAGCACCTCTCATCATTGTCCCTGTCAGCATCACTACCAGCAAGTCGACGTGCCTCATTATTGACGCG
GGACACATTCATGTCAATAGCCAACTGGTGGATGAGCAGACGATGAAGGAGATTCAGTCCCGACAGCGGCTTTCT
GATAGTGAAAAGGACTTCAAGCGACTAGAGTCGGTCATGTACGACAAGTTTGTCGTCAAGCTCACATCGACTCAA
GTTCTCATTGGACCTTCAATTGCCGAGACCAAGGCAGAACTTGGCTACAAGTCCGAGGGCTCTCAGCTGCACGTT
GTCGAGCAGATTAATGTTGACTTTGTTGTGGAGACATCAATTTTGCCAAAGGCGCCCAATTTGACGAGATTCAAA
GTCTCGGGCCACTTGCCAATGCTTCACGTTACCGTCTCGGATACCAAGTACAAAAATCTGATGAAAATCATTGAT
GTCGCTATTCCCAAGCTCGGACAAGAGGAAGCGACTCAAGACGCTACTGTTCAAGATCAAATCAGCCAGGCTCAG
CGCCCACGTCTGGTGACTAATAAGACTTCCAACAGGCCACGGCGCAAGTCGCAGCGTGAGCCTAGACAGTCATCT
GCCTTTCCATTTATGCAGCCTCAAACGGCGGTAGTCATTGACGACATTGACGAAGACGAGGATGACTTTGAAGAT
GCCAGCGATGGAGCGGATGCGGAGCAGCTCAAAATACAGCAGCGTACCTTTGAATTCAAGTTTACAGTTGATGTT
CTCAAGGGATCGCTTTATAGAAGCGACGCAGACAAGAGACTGCCTGATGCTCTCCTTGTGGAAATGGTGGCTGAG
CGCTTTGATCTCGACTTTTACACGAGAAGATTTGACATGGCGGCCGAGGTGTCACTCGGCTCCGTTGCCGTGGAA
GACTTTGTCGACAGCCCCTCTGCAGAGTTCAAGTCGATTGTCTCATCTGGGGATAGCGAAGACTTGCAATCTGGG
CGAAGCCTCGTCCACGTTAAACTGGTCAGGGTCAACAAGCAGTCACCCGAGTTTATGCCAGTATACGAGGGCGTG
GAGACGAATGTCACGGCTGCGATATCCACCATCAACATCATTGTCACAAGGAAAACACTGCTCACGCTCCTCGAC
TTTGTTCTCATTACCTTTACCGGAGGCGATGATTGGGAAGAGCAGCAAAGACAGCCAGCGCTTCCGGATGCAGAG
CAAGGCGGCAGCGCTTCAACTGACGACACGGTGGCTCGACAGGCCCCAAGCACCGCCTCGATACGTGTCAAGGTG
GACCTCAAGACTATCCGGCTCATCCTCAATAACGACGGGATTCGGCTGGCGACACTATCCTTCAACCATGCTGAC
GCTGGCATCTTCTTGCGTGCTAAGACTATGCGCATCTCGGTCAGACTGGGCGACGTCTCGCTTGTCGACGACGTC
AATCTGGGTGTTTCTGAGGAATCAAATCTGCGCAAACTCGTCACCATTCAGGGGGACGACTTGGCCGACTTTCGC
TACGAGACATTTGATCCGTCCAACCACAAGGCATACCCTGGTTATGACAGCTCAGTCTACCTCCGTGCTGGGTCT
GTCAAGGTCAACTTTGTGGAGGAGCCATTTCGCAAAATCATTGACTTCTTGGTCAAATTTGGCAAAATGCAGGCT
CTATACAACGCTGCTAGACAGGCGGCCGTTTCGCGTGCAAACCAAATGCAACAGAGTCCGAGCAGATTCAAGTTT
GATGTCGTGGTCAAGACGCCCATTGTTGTTTTCCCACGAATGATGTTTGCTGGACGGCCTAGCCGTGATTTAGTA
ACGGCCTTTTTGGGCGAGATATACGCACAAAACAAGTTTGCACCTCTGGACGACTCGGAACAGTCGGACATTGCC
ATGAAGATTTCCATGGGCATACGCAATGTGCGATTGACTTCCAACTTTGAGTATGACAATGAGTGGTCGGAAGAA
CTGGAGATGATTGATCACGTTGATCTCGGCTTCAATATTACTTATGCCGAGCACAAGAATGGAGCACAGCGCCCG
GATCTGGAGATTGAAGGCTCGCTGTCCGACATCAAGCTTCGACTGACGCAGCATCAGCTCAGATTTCTACTCGAG
ATTTCCAAGTCTGTACCGGCGGCCTTTGCTGGCGACGGGGCGGATGGCGATGAAGAGGCTGCCCGTCTAGTCGGG
GAGGAGACGTTGCAACGTGCCAAGACCATGTCTTGGGACGGGGGCAAGAGCAGCGACGAGCATCATGTCGACCTT
TCCCCAGAGCTCAGTGTAGCCGAGAATTGCTGGACCAAGCTGGACCTGGTTTTTCGCGTCGACACCATAGGACTT
GAACTCATCATGGCGCCACAAAACGGCCCGGTGGGAGACTTGGATGCGTCGAGCCTGTCGCGATTTTCGCTCGAT
GACACCAAGGTCAAGACGCGCATGCTTTCCGACGGCTCGCTCGAGGCCGAGTTGCTGGTTGGCTCATTCACCATT
TACGATAGTCGGCCGAGGGAGACGAACAAGTTTCGTCGCATCATGACATCGTCCAACACGGACTCGCAGCAGCTC
ATGGCTAGTCTGAGCATGTCGGGGGGCCATGACAAGAGCCTCATCGCCATGGCTACTATTGACAGCCCTCGAGTC
ATTTTTGCCCTCGACTACTTGTTTGCTCTGCACAAGTTTGCTATCGAGGGCCTGGTGCTCGACACGACGACGCCC
ATGGACGACGAGAGCTTGAACGAGACGCCCGAGGAATCGGACGCCGACTCGATGCAAGTGACGTACACGACGCCA
GGACAAGGAGCCTCTGGGCAAAAGCGGGCGGCGGAGCTCCAAGAGCAAACTTGGCCAGCCATGAGTGTTGGTTTT
AGAGTGAATCTGGTGGACGCACAGGTTATTCTCATTGCCAACCCGCTCACTCCCAGTTCAGAGGCGATTGTCTTG
AGCATTCGTCAGATGCTTCTATCTCAACAACATGCACTCACCTTTCACATTTCCCAAGTGGGCATGTTTTTATGC
CGCATGGACAAGTTTGAAACTTCGCATTTGAGAATCATTGACGACTTTTCGATACAGCTAAACATGGACAGTTCT
CAGGCCAAAGTGGTGAGCATGCACATTGACGTGGAGCCTTTGATTTTGCGACTGTCACTGCGAGATATTCTGCTG
GCGCTGCAAATCTTTGCAAGGGCGGGCGAGTTGTCTGGGGGCGACGCGACGACGCAGGAGCCCAAGCAATCGCAG
GCAGACAAGAAGGCGCGGCAGCTGGGAGATGGGGGCACGAGGAACAAGTCCCTGAGTGGGCGTGGACGAGGCCAG
TCGACCATTGCCAAGGCTAGAGGAGGCGAAGGATCGAGCGTTGGAGGAAACAAGGAGCCAGGGCGAGCGACTCTT
GGCATGACGCGGCAAGAATTGACGGCGACGATTGAGGGCATGCGCATCGTCTTGATTGGCGATGTGCACGAGCTT
CCCATTTTGGACGTGGGAGTCAAGCAGTTCACGGCAACGGCGGAGAATTGGTCGTGGGCTCTCAAGGCAGAGGCG
GCGATTGAGTTTTACTCCAACGTGTACAACTTCTCCAAGTCTAGCTGGGAGCCGCTGCTGGAGCCGTGGCAGGTG
GGCTTTGGAGTTGCCAAGGAGGCGGATAGCGGGCTGCTGGCTGTCGAGGTGGCGTCGCAAAAGACGTTTGACGTG
ACGATTACAACGGCGACGATTGCGCTGGCGTCCAAGTCGTTTGATTTTTTGACGACGGAGCAGGACGTGCTGGGC
AAGCCACGGGGAGGCGAGGCTCCGTATCGCATCCGGAACCACACGGGCTTCGACGTTGAGCTCGAGGGCAAGGCG
TCGACGAGCGAGGAGCCCCTGAGGCTGAGACTGGACGACGGGCAAGAGGGCCCGTGGAGCTTTGAGCACTGGGAG
AAGATGCGGGAGAATCTCTTGACAGAGTCGGGGCAAAACGACGTGTGTGTCAAGATGGAGGGCAGCGGCTTCGAC
ATGGTGAAGAATGTGCGACTGAGCCGCGAGGGCGAGTTTCTGTACAGCCTGCGGCCCAAGGCGGACAATGTGCTG
CACCGGCTGTGCGTCGAGGTGAGGCTGGGTGCGGACAATGTCAAGAGGGTGACGCTGCGTTCGCCGCTGCTGGTG
GAAAACGCAACGCAGATTCCCGTGGAGCTGGGCGTTTATGACGCGGACGAGGGCCATTTGCTCAAGATTGAGAAG
ATTGCGCCGGGCGACTCGCGGCCACTGCCCGTGGGGGCCGTGTACGAGAAGCGAGCGCTGGTGCGTCCAGATGGC
GGCTTTGGCTACCAGTGGAGCCAAGATGAGGTGTGGTGGCGGGAGCTGCTCAAGCGGCCAACTCGGCAGCTTCTG
TGCAGGGCGGAGAATGGGGAGCCCTTTTTCTTTCAGCTGCACGCGCAGTTTGACAGGGCGAATCCCATGTGCAAG
GCCTATCCGTACATGAGAGTTAAGCTCTCGGCGCCCGTGACGCTCGAGAACCTGCTGCCATACGACTTCAAGTAC
CGCATCTACGACAAGAACAGCAAAAAGGACTGGAGCAACTTTTTGCGCAAGGGCGGCGTCAGCCCGGTGCATGCG
GTGGAGCTGTCGCATCTGCTGCTGCTCAGCATCGACATGCAGGACAGCGTCTTCAAGCCCAGCGACTTTGGCATC
ATCAACGCGGGCAGCAGCGACGACTTCCGCAAGGAGACGCGGCTGCTGCTCAAGGACGACGAGGGCCTGGCGCTG
CACCTCAGCCTGCACTACTTCAAGACGGCCAACAGCGGAGGCGCCTTCAAGGTGGCGGTGTACAGCCCCTACATT
GTGCTCAACAAGACGGGCCTGGACCTGCGCATCCGGGCCAAGAGCTTCCTCCAGCAGGCCAGGGCGGCAGCGGGC
CAGTTCCCGCGGCTGCCAACGGGCGACTCGGAGCGGCCCAAGGCGCTGCCTCTCATGTTCTCGTTTGGCAACGAT
GACCATAGGAACAGGGCCATGCTCAAGGTGGACGAGTCTGAGTGGAGCAAGCCGCAGAGCTTCGACGCCATTGGC
AGCACGTCGGAAGTGGTGGTCATGTCGGCGTCGCGGCAGCGCGAGATGCACCTGGGCCTGACGGTGCAGTCGGGC
GACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGCCGCGCTTCATTGTGGTGAACAAGGTGGGCGAGCAA
ATGCTGGTGCGCGAGTCGACGTCGCCCGGCTACATGACGCTGCGAGGCGGCGCGCTGCAGCCGCTGCACTTTATG
CAAAAGTCGCCCGTCAAGCAGCTGTGCCTGTGCTATCCCGGCGTCGACAACCACTGGTCGGCGCCCTTCAACATT
GCCCATCTGGGCACGACGCACGTCAAGATTGCCCGTGCCCGCCAGCGCCAGCGCCTGGTGCGCGTCGAGACGCTC
ATGGAGGAGTCCACCATTTTCCTGCACCTGAGCATGGAGAGCAACAACTGGCCCTTTTCCATGCGCAACGAGAGC
GACGTCGAGTTTACCTTTTGGCAGGCCAACCCCACGCTCGACGAGGCCGATGTCGAGGACTATAGCGGCTGGAAG
CCCATTCGCTATCGCCTGCCGCGCCGCAGCATCATGCCCTATGCCTGGGACTTTCCCGCCGCCAAGTTTCGCGAG
GTGGTGATTGCCGCCCACGCCAAGGAGCGCCACGTCAAGCTGGCCGAGATTGGCAACCAGGTGCCCATGAAGATT
GTGGCGCGCGACGGCCAGCCGCAAATCATTGACATCAACGTGGCGGCCGACGGGCCCACCCAGACGCTGATTCTG
AGCAACTTCCGCCCCAGCAAGAGCATGTACAAGCCCAAGCCGCTGTCGCGCACCAGCAGCGGCCCCGACGCCTTT
GAGGTCAAGCAGCAGGAGACGGGCGCCACCCTGCGCGCCCAGCTCAAGCTCTCGGGCATTGGCATCTCCCTCATC
AATGCCCAGCTCAAGGAGCTGGCCTACATTACCTTTCGCCACGTGCAGCTGCGCTTCATGGACTCGCCCCTCATC
CAGACGCTGTCGCTGGCCGTCAAGTGGATCCAGATTGACAACCAGCTCTATGGCGGCATCTTCCCCATTGTCCTC
TACCCCAGCGTCGTGCCCAAGCGCGCCAACGAGGTCGAGGCCCACCCCTCGCTGCACGCCATGGTTAGCCGCGTC
AAGGACGACTCGTACGGCGTCGTCTACTTCAAGTACGCCACCGTGCTGGTGCAGCAGATGACGCTCGACCTGGAC
GAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCGACGTGCCCGGCGCCAGCTGGACTCTTGTCCACCACGACGGC
AAGCTGTGCGACCAGGACCTCGACATCCCCGAGCCCTCGCAGCACCAGTCGGGCCACGACATTTACTTTGAGCTG
CTCAACATCCAGCCCACGCAGCTCGACCTGAGCTTCATGCGCACAGAGCGCGTCAATGCCCAGGACAAGACGTCG
ACGCGCAACCCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCCCCCATAAGA
TTCAACGCCTTGATGCTCGACAATGTCCGCGTCACCATTCCCGTCCTCATGCAAAACATCTCCAACCACTACAGC
CAAGAGGTCATGTACCAGATCCACAAGATTCTCGGCTCCGCCGACTTTTTGGGCAACCCCGTCGGCCTCTTCAAC
AACATCTCGTCGGGCGTCACCGACATCTTTTACGAGCCCTACCAGGGCCTGATCCTCTCGGACAGGCCCGAGGAG
TTTGGCATTGGCATTGCCAAGGGCGCCGCCTCGTTTGCCAAGAAGACTGTCTATGGCTTCAGCGACAGCTTCTCC
AAGTTTACCGGCAGCTTGAGCAAGGGCCTGGCCGCCGCCTCGCTCGACAAGCAGTTCCAGGACCGCCGCCGCATC
ACCAGGGCCCGCAACAGGCCCAAGCACGCCCTCTACGGCGTCACAGCCGGAGCCAACTCGCTCTTCACCAGCGTC
GCCTCTGGCGTTGGCGGCCTGGCCCGCAAGCCCCTCGAGGGTGCCGAGCAGGAGGGCGCCCTCGGCTTCTTCAAG
GGCGTCGGCAAGGGCGTGCTTGGCCTGGCCACCAAGCCCGCCGTTGGCGTCCTCGACATGGCCAGCAACGTGAGC
GAGGGCATTCGCAACACAACCACTGTCTTTGACGGCTCCGAGCTGGACCGCGCCCGCTACCCGCGCTTCATTCCA
AACGACGGCATCGTGCGCCCCTATAATGCCCGCGAGGCTCTGGGGCAGTACTGGCTCAAGCAGGTGGACAATGGC
CGCTACTTTGACGAGCAGTACATTGGCCACCTCGAGCTGCCCAAGGAGGACATGGTGGTCATGGTGACGTATGCG
CGCATTCTGCTTATCCGCTCGAGGCGCCTGACGAGCGAGTGGGACGTGCCGCTCAAGGATGTGCAGACCATTGCC
AAGGAGCGCACAGGCGTCAGCCTGGTGCTGCGAGGAGGGGCTAATGGACCCTTTATCCCGGTCGGCGGTGGCAGC
GAGAGGAGCTTCTTGTACCGCATGGTGGGCGTTGCAGTGGAAGAGTTCAACCGGCGCTTCAGAGGCGGCGACTAA
Transcript >OphauB2|7982
ATGCTCGAGGGACTCGTCGCAGGCCTGCTCAACCGCTTCCTGGGAATGTATGTCAAAAACTTTGACCCCACGCAG
CTCAAGGTGGGCATATGGTCTGGTGATGTCAAACTTCGCAATCTCGAGCTTCGCCGCGAAGCCCTCGACCAGCTT
AAGTTACCCATCAACGTCATCGAGGGCCATCTTGGCGACCTCACTCTTGTCATTCCTTGGTCAAATCTGCGAGGC
GCTCCCGTCAAGGTCTTTATCGAAGATGTCTTTCTTCTCGCTAGCCCCAAGGAAGAGGCCGAATATGACGAGGCC
GAAGAGGAGCGCAGAAGGCAGCGTCTCAAAATGGAAAAGTTGGACAGCGCCGAGCTTCTCAAGGAGCGCAACCGC
GACGGCATGAGCCAAGAGGAGCAAAAGAAAAACCAGAGTTTCACGCAGAGCCTCGTCACCAAGGTTGTCGACAAC
CTTCAAGTTACTGTAAAAAATATACACGTGCGCTACGAAGACTCAATATCTGCCCCAGGCCATCCATTTGCTCTG
GGCCTGACTCTCCAAGAGTTTTCTGCCGTCAGCACGGATGGAAATTGGACTCCAACCTTTATACAAGATTCTTCA
TCCGTCACCCATAAGCTCGCCACACTGGGTGCTCTGGCTGTCTACTGGAACACTGACTCGGAGCTCTTTGGCAGC
GGCCGCGAGGCTCAGCCACCTCCCGAGGAAGCCATGTCGCACCATGACATGGTGGACCGGTTCAAGGCCATGATT
GTATCCACGAGTGCGGCCGACGCCAACAACCAGTTTATCCTCAAGCCTGTCAGTGGCCAGGCCAAGATTGAACTC
GACAAGTCTGGAGACATACGTGTGCCCAAGTTCAAGGCCAACTTGCTGTTCGAGGAGATTGGCCTTGTGCTCGAT
GACAATCAATATCGCGATGCCCTCATGATGGTAGATCTCTTTCACTATTTTATTCGCCACCAGGAATACAAGGCT
CTGAAGCCCAAGGGCGTTCGCCCAAGCCAAGACCCCAAGGCATGGCTTCAGTTTGCTGGAAACGCCGTCTTGGGC
AAAATACACGAAAAGAACCGCCAGTGGTCCTGGGACTATTTTCGACAACGGCGCGACGATCGCATTAGTTATATA
GAACTGTTCAAGAAGAAGAAACAGCAACAGCAACTGTCTCCTGACGATGTGGAACGTCTTGGCAATCTCGAATGG
AAATTGAGCTACGAGGACCTGCGCTTCTGGAGGTCTTTGGCCCGCAACCAGTTGAAGAAGGAAAACGCGGCGGCA
TTGAAGAAACAGTCGGAGACACAGGACCAGCAAGGATGGCTGGCCTGGATGTGGGGCTCCAAGCCTCAGGGACGC
ATCGAGAAGAATGAAGAAAACACCCAGATGACTGAGGAGCAGCGCAAGGAGCTGTATGACATGATTGACTGGGAC
GAAAAGACGGCCCTGGCAGACGAGGTCGATATGCCTCGCGAGGCTGTGAAGCTGTGTCTGGAGGCCTCGCTGGGC
ACTGGAAGCTTCACCTTGAAAAAGAGCCCTCACGGAGACGCACGAGACCTTTTGAGCCTTCATTTTGACCTCTTC
AAGGCCAAGGCACTGCAACGTAAAGACTCCCTGCTTGCCAATGTGAGCCTGGGGGGCCTTCGAGTCAACGACGGC
ACCACGCCCAACAGCCTCTACCCCGAGATTGTGCGCGTCAAGGATGCCCCCAAAACCAAGGAGCAAAGGCGTCTT
TCCCTCATGGAGCTGGAGAGCAGCAATGGCGAGCCATTTTTCCAGTTTGAAGTGGAGCAAAATCCAATCGAGCGC
GCGGGGGATATTGCTGTTGTTGGCAAATTGAAGCCGCTCGAGGTTGTCTGGAACCCAAATTTTGTCGTGGGAATC
GTCGACTTTTTTCGACCCCCAGAGAGACACATGGAGTCTATTACGGCTCTCATGGAAAGCGCCGGCGCCACCGTA
GAAGGTATTCGAGAGCAGACTCGTGCTGGGCTAGAATTTGCGTTGGAAGAACATCGCACAGTCAATGCCGAGCTA
GACTTGCAAGCACCTCTCATCATTGTCCCTGTCAGCATCACTACCAGCAAGTCGACGTGCCTCATTATTGACGCG
GGACACATTCATGTCAATAGCCAACTGGTGGATGAGCAGACGATGAAGGAGATTCAGTCCCGACAGCGGCTTTCT
GATAGTGAAAAGGACTTCAAGCGACTAGAGTCGGTCATGTACGACAAGTTTGTCGTCAAGCTCACATCGACTCAA
GTTCTCATTGGACCTTCAATTGCCGAGACCAAGGCAGAACTTGGCTACAAGTCCGAGGGCTCTCAGCTGCACGTT
GTCGAGCAGATTAATGTTGACTTTGTTGTGGAGACATCAATTTTGCCAAAGGCGCCCAATTTGACGAGATTCAAA
GTCTCGGGCCACTTGCCAATGCTTCACGTTACCGTCTCGGATACCAAGTACAAAAATCTGATGAAAATCATTGAT
GTCGCTATTCCCAAGCTCGGACAAGAGGAAGCGACTCAAGACGCTACTGTTCAAGATCAAATCAGCCAGGCTCAG
CGCCCACGTCTGGTGACTAATAAGACTTCCAACAGGCCACGGCGCAAGTCGCAGCGTGAGCCTAGACAGTCATCT
GCCTTTCCATTTATGCAGCCTCAAACGGCGGTAGTCATTGACGACATTGACGAAGACGAGGATGACTTTGAAGAT
GCCAGCGATGGAGCGGATGCGGAGCAGCTCAAAATACAGCAGCGTACCTTTGAATTCAAGTTTACAGTTGATGTT
CTCAAGGGATCGCTTTATAGAAGCGACGCAGACAAGAGACTGCCTGATGCTCTCCTTGTGGAAATGGTGGCTGAG
CGCTTTGATCTCGACTTTTACACGAGAAGATTTGACATGGCGGCCGAGGTGTCACTCGGCTCCGTTGCCGTGGAA
GACTTTGTCGACAGCCCCTCTGCAGAGTTCAAGTCGATTGTCTCATCTGGGGATAGCGAAGACTTGCAATCTGGG
CGAAGCCTCGTCCACGTTAAACTGGTCAGGGTCAACAAGCAGTCACCCGAGTTTATGCCAGTATACGAGGGCGTG
GAGACGAATGTCACGGCTGCGATATCCACCATCAACATCATTGTCACAAGGAAAACACTGCTCACGCTCCTCGAC
TTTGTTCTCATTACCTTTACCGGAGGCGATGATTGGGAAGAGCAGCAAAGACAGCCAGCGCTTCCGGATGCAGAG
CAAGGCGGCAGCGCTTCAACTGACGACACGGTGGCTCGACAGGCCCCAAGCACCGCCTCGATACGTGTCAAGGTG
GACCTCAAGACTATCCGGCTCATCCTCAATAACGACGGGATTCGGCTGGCGACACTATCCTTCAACCATGCTGAC
GCTGGCATCTTCTTGCGTGCTAAGACTATGCGCATCTCGGTCAGACTGGGCGACGTCTCGCTTGTCGACGACGTC
AATCTGGGTGTTTCTGAGGAATCAAATCTGCGCAAACTCGTCACCATTCAGGGGGACGACTTGGCCGACTTTCGC
TACGAGACATTTGATCCGTCCAACCACAAGGCATACCCTGGTTATGACAGCTCAGTCTACCTCCGTGCTGGGTCT
GTCAAGGTCAACTTTGTGGAGGAGCCATTTCGCAAAATCATTGACTTCTTGGTCAAATTTGGCAAAATGCAGGCT
CTATACAACGCTGCTAGACAGGCGGCCGTTTCGCGTGCAAACCAAATGCAACAGAGTCCGAGCAGATTCAAGTTT
GATGTCGTGGTCAAGACGCCCATTGTTGTTTTCCCACGAATGATGTTTGCTGGACGGCCTAGCCGTGATTTAGTA
ACGGCCTTTTTGGGCGAGATATACGCACAAAACAAGTTTGCACCTCTGGACGACTCGGAACAGTCGGACATTGCC
ATGAAGATTTCCATGGGCATACGCAATGTGCGATTGACTTCCAACTTTGAGTATGACAATGAGTGGTCGGAAGAA
CTGGAGATGATTGATCACGTTGATCTCGGCTTCAATATTACTTATGCCGAGCACAAGAATGGAGCACAGCGCCCG
GATCTGGAGATTGAAGGCTCGCTGTCCGACATCAAGCTTCGACTGACGCAGCATCAGCTCAGATTTCTACTCGAG
ATTTCCAAGTCTGTACCGGCGGCCTTTGCTGGCGACGGGGCGGATGGCGATGAAGAGGCTGCCCGTCTAGTCGGG
GAGGAGACGTTGCAACGTGCCAAGACCATGTCTTGGGACGGGGGCAAGAGCAGCGACGAGCATCATGTCGACCTT
TCCCCAGAGCTCAGTGTAGCCGAGAATTGCTGGACCAAGCTGGACCTGGTTTTTCGCGTCGACACCATAGGACTT
GAACTCATCATGGCGCCACAAAACGGCCCGGTGGGAGACTTGGATGCGTCGAGCCTGTCGCGATTTTCGCTCGAT
GACACCAAGGTCAAGACGCGCATGCTTTCCGACGGCTCGCTCGAGGCCGAGTTGCTGGTTGGCTCATTCACCATT
TACGATAGTCGGCCGAGGGAGACGAACAAGTTTCGTCGCATCATGACATCGTCCAACACGGACTCGCAGCAGCTC
ATGGCTAGTCTGAGCATGTCGGGGGGCCATGACAAGAGCCTCATCGCCATGGCTACTATTGACAGCCCTCGAGTC
ATTTTTGCCCTCGACTACTTGTTTGCTCTGCACAAGTTTGCTATCGAGGGCCTGGTGCTCGACACGACGACGCCC
ATGGACGACGAGAGCTTGAACGAGACGCCCGAGGAATCGGACGCCGACTCGATGCAAGTGACGTACACGACGCCA
GGACAAGGAGCCTCTGGGCAAAAGCGGGCGGCGGAGCTCCAAGAGCAAACTTGGCCAGCCATGAGTGTTGGTTTT
AGAGTGAATCTGGTGGACGCACAGGTTATTCTCATTGCCAACCCGCTCACTCCCAGTTCAGAGGCGATTGTCTTG
AGCATTCGTCAGATGCTTCTATCTCAACAACATGCACTCACCTTTCACATTTCCCAAGTGGGCATGTTTTTATGC
CGCATGGACAAGTTTGAAACTTCGCATTTGAGAATCATTGACGACTTTTCGATACAGCTAAACATGGACAGTTCT
CAGGCCAAAGTGGTGAGCATGCACATTGACGTGGAGCCTTTGATTTTGCGACTGTCACTGCGAGATATTCTGCTG
GCGCTGCAAATCTTTGCAAGGGCGGGCGAGTTGTCTGGGGGCGACGCGACGACGCAGGAGCCCAAGCAATCGCAG
GCAGACAAGAAGGCGCGGCAGCTGGGAGATGGGGGCACGAGGAACAAGTCCCTGAGTGGGCGTGGACGAGGCCAG
TCGACCATTGCCAAGGCTAGAGGAGGCGAAGGATCGAGCGTTGGAGGAAACAAGGAGCCAGGGCGAGCGACTCTT
GGCATGACGCGGCAAGAATTGACGGCGACGATTGAGGGCATGCGCATCGTCTTGATTGGCGATGTGCACGAGCTT
CCCATTTTGGACGTGGGAGTCAAGCAGTTCACGGCAACGGCGGAGAATTGGTCGTGGGCTCTCAAGGCAGAGGCG
GCGATTGAGTTTTACTCCAACGTGTACAACTTCTCCAAGTCTAGCTGGGAGCCGCTGCTGGAGCCGTGGCAGGTG
GGCTTTGGAGTTGCCAAGGAGGCGGATAGCGGGCTGCTGGCTGTCGAGGTGGCGTCGCAAAAGACGTTTGACGTG
ACGATTACAACGGCGACGATTGCGCTGGCGTCCAAGTCGTTTGATTTTTTGACGACGGAGCAGGACGTGCTGGGC
AAGCCACGGGGAGGCGAGGCTCCGTATCGCATCCGGAACCACACGGGCTTCGACGTTGAGCTCGAGGGCAAGGCG
TCGACGAGCGAGGAGCCCCTGAGGCTGAGACTGGACGACGGGCAAGAGGGCCCGTGGAGCTTTGAGCACTGGGAG
AAGATGCGGGAGAATCTCTTGACAGAGTCGGGGCAAAACGACGTGTGTGTCAAGATGGAGGGCAGCGGCTTCGAC
ATGGTGAAGAATGTGCGACTGAGCCGCGAGGGCGAGTTTCTGTACAGCCTGCGGCCCAAGGCGGACAATGTGCTG
CACCGGCTGTGCGTCGAGGTGAGGCTGGGTGCGGACAATGTCAAGAGGGTGACGCTGCGTTCGCCGCTGCTGGTG
GAAAACGCAACGCAGATTCCCGTGGAGCTGGGCGTTTATGACGCGGACGAGGGCCATTTGCTCAAGATTGAGAAG
ATTGCGCCGGGCGACTCGCGGCCACTGCCCGTGGGGGCCGTGTACGAGAAGCGAGCGCTGGTGCGTCCAGATGGC
GGCTTTGGCTACCAGTGGAGCCAAGATGAGGTGTGGTGGCGGGAGCTGCTCAAGCGGCCAACTCGGCAGCTTCTG
TGCAGGGCGGAGAATGGGGAGCCCTTTTTCTTTCAGCTGCACGCGCAGTTTGACAGGGCGAATCCCATGTGCAAG
GCCTATCCGTACATGAGAGTTAAGCTCTCGGCGCCCGTGACGCTCGAGAACCTGCTGCCATACGACTTCAAGTAC
CGCATCTACGACAAGAACAGCAAAAAGGACTGGAGCAACTTTTTGCGCAAGGGCGGCGTCAGCCCGGTGCATGCG
GTGGAGCTGTCGCATCTGCTGCTGCTCAGCATCGACATGCAGGACAGCGTCTTCAAGCCCAGCGACTTTGGCATC
ATCAACGCGGGCAGCAGCGACGACTTCCGCAAGGAGACGCGGCTGCTGCTCAAGGACGACGAGGGCCTGGCGCTG
CACCTCAGCCTGCACTACTTCAAGACGGCCAACAGCGGAGGCGCCTTCAAGGTGGCGGTGTACAGCCCCTACATT
GTGCTCAACAAGACGGGCCTGGACCTGCGCATCCGGGCCAAGAGCTTCCTCCAGCAGGCCAGGGCGGCAGCGGGC
CAGTTCCCGCGGCTGCCAACGGGCGACTCGGAGCGGCCCAAGGCGCTGCCTCTCATGTTCTCGTTTGGCAACGAT
GACCATAGGAACAGGGCCATGCTCAAGGTGGACGAGTCTGAGTGGAGCAAGCCGCAGAGCTTCGACGCCATTGGC
AGCACGTCGGAAGTGGTGGTCATGTCGGCGTCGCGGCAGCGCGAGATGCACCTGGGCCTGACGGTGCAGTCGGGC
GACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGCCGCGCTTCATTGTGGTGAACAAGGTGGGCGAGCAA
ATGCTGGTGCGCGAGTCGACGTCGCCCGGCTACATGACGCTGCGAGGCGGCGCGCTGCAGCCGCTGCACTTTATG
CAAAAGTCGCCCGTCAAGCAGCTGTGCCTGTGCTATCCCGGCGTCGACAACCACTGGTCGGCGCCCTTCAACATT
GCCCATCTGGGCACGACGCACGTCAAGATTGCCCGTGCCCGCCAGCGCCAGCGCCTGGTGCGCGTCGAGACGCTC
ATGGAGGAGTCCACCATTTTCCTGCACCTGAGCATGGAGAGCAACAACTGGCCCTTTTCCATGCGCAACGAGAGC
GACGTCGAGTTTACCTTTTGGCAGGCCAACCCCACGCTCGACGAGGCCGATGTCGAGGACTATAGCGGCTGGAAG
CCCATTCGCTATCGCCTGCCGCGCCGCAGCATCATGCCCTATGCCTGGGACTTTCCCGCCGCCAAGTTTCGCGAG
GTGGTGATTGCCGCCCACGCCAAGGAGCGCCACGTCAAGCTGGCCGAGATTGGCAACCAGGTGCCCATGAAGATT
GTGGCGCGCGACGGCCAGCCGCAAATCATTGACATCAACGTGGCGGCCGACGGGCCCACCCAGACGCTGATTCTG
AGCAACTTCCGCCCCAGCAAGAGCATGTACAAGCCCAAGCCGCTGTCGCGCACCAGCAGCGGCCCCGACGCCTTT
GAGGTCAAGCAGCAGGAGACGGGCGCCACCCTGCGCGCCCAGCTCAAGCTCTCGGGCATTGGCATCTCCCTCATC
AATGCCCAGCTCAAGGAGCTGGCCTACATTACCTTTCGCCACGTGCAGCTGCGCTTCATGGACTCGCCCCTCATC
CAGACGCTGTCGCTGGCCGTCAAGTGGATCCAGATTGACAACCAGCTCTATGGCGGCATCTTCCCCATTGTCCTC
TACCCCAGCGTCGTGCCCAAGCGCGCCAACGAGGTCGAGGCCCACCCCTCGCTGCACGCCATGGTTAGCCGCGTC
AAGGACGACTCGTACGGCGTCGTCTACTTCAAGTACGCCACCGTGCTGGTGCAGCAGATGACGCTCGACCTGGAC
GAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCGACGTGCCCGGCGCCAGCTGGACTCTTGTCCACCACGACGGC
AAGCTGTGCGACCAGGACCTCGACATCCCCGAGCCCTCGCAGCACCAGTCGGGCCACGACATTTACTTTGAGCTG
CTCAACATCCAGCCCACGCAGCTCGACCTGAGCTTCATGCGCACAGAGCGCGTCAATGCCCAGGACAAGACGTCG
ACGCGCAACCCCATCATGTTCTTCCTCAACGTCATGACCATGGCCATTGGCAACGTCAACGACGCCCCCATAAGA
TTCAACGCCTTGATGCTCGACAATGTCCGCGTCACCATTCCCGTCCTCATGCAAAACATCTCCAACCACTACAGC
CAAGAGGTCATGTACCAGATCCACAAGATTCTCGGCTCCGCCGACTTTTTGGGCAACCCCGTCGGCCTCTTCAAC
AACATCTCGTCGGGCGTCACCGACATCTTTTACGAGCCCTACCAGGGCCTGATCCTCTCGGACAGGCCCGAGGAG
TTTGGCATTGGCATTGCCAAGGGCGCCGCCTCGTTTGCCAAGAAGACTGTCTATGGCTTCAGCGACAGCTTCTCC
AAGTTTACCGGCAGCTTGAGCAAGGGCCTGGCCGCCGCCTCGCTCGACAAGCAGTTCCAGGACCGCCGCCGCATC
ACCAGGGCCCGCAACAGGCCCAAGCACGCCCTCTACGGCGTCACAGCCGGAGCCAACTCGCTCTTCACCAGCGTC
GCCTCTGGCGTTGGCGGCCTGGCCCGCAAGCCCCTCGAGGGTGCCGAGCAGGAGGGCGCCCTCGGCTTCTTCAAG
GGCGTCGGCAAGGGCGTGCTTGGCCTGGCCACCAAGCCCGCCGTTGGCGTCCTCGACATGGCCAGCAACGTGAGC
GAGGGCATTCGCAACACAACCACTGTCTTTGACGGCTCCGAGCTGGACCGCGCCCGCTACCCGCGCTTCATTCCA
AACGACGGCATCGTGCGCCCCTATAATGCCCGCGAGGCTCTGGGGCAGTACTGGCTCAAGCAGGTGGACAATGGC
CGCTACTTTGACGAGCAGTACATTGGCCACCTCGAGCTGCCCAAGGAGGACATGGTGGTCATGGTGACGTATGCG
CGCATTCTGCTTATCCGCTCGAGGCGCCTGACGAGCGAGTGGGACGTGCCGCTCAAGGATGTGCAGACCATTGCC
AAGGAGCGCACAGGCGTCAGCCTGGTGCTGCGAGGAGGGGCTAATGGACCCTTTATCCCGGTCGGCGGTGGCAGC
GAGAGGAGCTTCTTGTACCGCATGGTGGGCGTTGCAGTGGAAGAGTTCAACCGGCGCTTCAGAGGCGGCGACTAA
Gene >OphauB2|7982
ATGCTCGAGGGACTCGTCGCAGGCCTGCTCAACCGCTTCCTGGGAATGTATGTCAAAAACTTTGACCCCACGCAG
CTCAAGGTGGGCATATGGTCTGGTGATGTCAAACTTCGCAATCTCGAGCTTCGCCGCGAAGCCCTCGACCAGCTT
AAGTTACCCATCAACGTCATCGAGGGCCATCTTGGCGACCTCACTCTTGTCATTCCTTGGTCAAATCTGCGAGGC
GCTCCCGTCAAGGTCTTTATCGAAGATGTCTTTCTTCTCGCTAGCCCCAAGGAAGAGGCCGAATATGACGAGGCC
GAAGAGGAGCGCAGAAGGCAGCGTCTCAAAATGGAAAAGTTGGACAGCGCCGAGCTTCTCAAGGAGCGCAACCGC
GACGGCATGAGCCAAGAGGAGCAAAAGAAAAACCAGAGTTTCACGCAGAGCCTCGTCACCAAGGTTGTCGACAAC
CTTCAAGTTACTGTAAAAAATATACACGTGCGCTACGAAGACTCAATATCTGCCCCAGGCCATCCATTTGCTCTG
GGCCTGACTCTCCAAGAGTTTTCTGCCGTCAGCACGGATGGAAATTGGACTCCAACCTTTATACAAGATTCTTCA
TCCGTCACCCATAAGCTCGCCACACTGGGTGCTCTGGCTGTCTACTGGAACACTGACTCGGAGCTCTTTGGCAGC
GGCCGCGAGGCTCAGCCACCTCCCGAGGAAGCCATGTCGCACCATGACATGGTGGACCGGTTCAAGGCCATGATT
GTATCCACGAGTGCGGCCGACGCCAACAACCAGTTTATCCTCAAGCCTGTCAGTGGCCAGGCCAAGATTGAACTC
GACAAGTCTGGAGACATACGTGTGCCCAAGTTCAAGGCCAACTTGCTGTTCGAGGAGATTGGCCTTGTGCTCGAT
GACAATCAATATCGCGATGCCCTCATGATGGTAGATCTCTTTCACTATTTTATTCGCCACCAGGAATACAAGGCT
CTGAAGCCCAAGGGCGTTCGCCCAAGCCAAGACCCCAAGGCATGGCTTCAGTTTGCTGGAAACGCCGTCTTGGGC
AAAATACACGAAAAGAACCGCCAGTGGTCCTGGGACTATTTTCGACAACGGCGCGACGATCGCATTAGTTATATA
GAACTGTTCAAGAAGAAGAAACAGCAACAGCAACTGTCTCCTGACGATGTGGAACGTCTTGGCAATCTCGAATGG
AAATTGAGCTACGAGGACCTGCGCTTCTGGAGGTCTTTGGCCCGCAACCAGTTGAAGAAGGAAAACGCGGCGGCA
TTGAAGAAACAGTCGGAGACACAGGACCAGCAAGGATGGCTGGCCTGGATGTGGGGCTCCAAGCCTCAGGGACGC
ATCGAGAAGAATGAAGAAAACACCCAGATGACTGAGGAGCAGCGCAAGGAGCTGTATGACATGATTGACTGGGAC
GAAAAGACGGCCCTGGCAGACGAGGTCGATATGCCTCGCGAGGCTGTGAAGCTGTGTCTGGAGGCCTCGCTGGGC
ACTGGAAGCTTCACCTTGAAAAAGAGCCCTCACGGAGACGCACGAGACCTTTTGAGCCTTCATTTTGACCTCTTC
AAGGCCAAGGCACTGCAACGTAAAGACTCCCTGCTTGCCAATGTGAGCCTGGGGGGCCTTCGAGTCAACGACGGC
ACCACGCCCAACAGCCTCTACCCCGAGATTGTGCGCGTCAAGGATGCCCCCAAAACCAAGGAGCAAAGGCGTCTT
TCCCTCATGGAGCTGGAGAGCAGCAATGGCGAGCCATTTTTCCAGTTTGAAGTGGAGCAAAATCCAATCGAGCGC
GCGGGGGATATTGCTGTTGTTGGCAAATTGAAGCCGCTCGAGGTTGTCTGGAACCCAAATTTTGTCGTGGGAATC
GTCGACTTTTTTCGACCCCCAGAGAGACACATGGAGTCTATTACGGCTCTCATGGAAAGCGCCGGCGCCACCGTA
GAAGGTATTCGAGAGCAGACTCGTGCTGGGCTAGAATTTGCGTTGGAAGAACATCGCACAGTCAATGCCGAGCTA
GACTTGCAAGCACCTCTCATCATTGTCCCTGTCAGCATCACTACCAGCAAGTCGACGTGCCTCATTATTGACGCG
GGACACATTCATGTCAATAGCCAACTGGTGGATGAGCAGACGATGAAGGAGATTCAGTCCCGACAGCGGCTTTCT
GATAGTGAAAAGGACTTCAAGCGACTAGAGTCGGTCATGTACGACAAGTTTGTCGTCAAGCTCACATCGACTCAA
GTTCTCATTGGACCTTCAATTGCCGAGACCAAGGCAGAACTTGGCTACAAGTCCGAGGGCTCTCAGCTGCACGTT
GTCGAGCAGATTAATGTTGACTTTGTTGTGGAGACATCAATTTTGCCAAAGGCGCCCAATTTGACGAGATTCAAA
GTCTCGGGCCACTTGCCAATGCTTCACGTTACCGTCTCGGATACCAAGTACAAAAATCTGATGAAAATCATTGAT
GTCGCTATTCCCAAGCTCGGACAAGAGGAAGCGACTCAAGACGCTACTGTTCAAGATCAAATCAGCCAGGCTCAG
CGCCCACGTCTGGTGACTAATAAGACTTCCAACAGGCCACGGCGCAAGTCGCAGCGTGAGCCTAGACAGTCATCT
GCCTTTCCATTTATGCAGCCTCAAACGGCGGTAGTCATTGACGACATTGACGAAGACGAGGATGACTTTGAAGAT
GCCAGCGATGGAGCGGATGCGGAGCAGCTCAAAATACAGCAGCGTACCTTTGAATTCAAGTTTACAGTTGATGTT
CTCAAGGGATCGCTTTATAGAAGCGACGCAGACAAGAGACTGCCTGATGCTCTCCTTGTGGAAATGGTGGCTGAG
CGCTTTGATCTCGACTTTTACACGAGAAGATTTGACATGGCGGCCGAGGTGTCACTCGGCTCCGTTGCCGTGGAA
GACTTTGTCGACAGCCCCTCTGCAGAGTTCAAGTCGATTGTCTCATCTGGGGATAGCGAAGACTTGCAATCTGGG
CGAAGCCTCGTCCACGTTAAACTGGTCAGGGTCAACAAGCAGTCACCCGAGTTTATGCCAGTATACGAGGGCGTG
GAGACGAATGTCACGGCTGCGATATCCACCATCAACATCATTGTCACAAGGAAAACACTGCTCACGCTCCTCGAC
TTTGTTCTCATTACCTTTACCGGAGGCGATGATTGGGAAGAGCAGCAAAGACAGCCAGCGCTTCCGGATGCAGAG
CAAGGCGGCAGCGCTTCAACTGACGACACGGTGGCTCGACAGGCCCCAAGCACCGCCTCGATACGTGTCAAGGTG
GACCTCAAGACTATCCGGCTCATCCTCAATAACGACGGGATTCGGCTGGCGACACTATCCTTCAACCATGCTGAC
GCTGGCATCTTCTTGCGTGCTAAGACTATGCGCATCTCGGTCAGACTGGGCGACGTCTCGCTTGTCGACGACGTC
AATCTGGGTGTTTCTGAGGAATCAAATCTGCGCAAACTCGTCACCATTCAGGGGGACGACTTGGCCGACTTTCGC
TACGAGACATTTGATCCGTCCAACCACAAGGCATACCCTGGTTATGACAGCTCAGTCTACCTCCGTGCTGGGTCT
GTCAAGGTCAACTTTGTGGAGGAGCCATTTCGCAAAATCATTGACTTCTTGGTCAAATTTGGCAAAATGCAGGCT
CTATACAACGCTGCTAGACAGGCGGCCGTTTCGCGTGCAAACCAAATGCAACAGAGTCCGAGCAGATTCAAGTTT
GATGTCGTGGTCAAGACGCCCATTGTTGTTTTCCCACGAATGATGTTTGCTGGACGGCCTAGCCGTGATTTAGTA
ACGGCCTTTTTGGGCGAGATATACGCACAAAACAAGTTTGCACCTCTGGACGACTCGGAACAGTCGGACATTGCC
ATGAAGATTTCCATGGGCATACGCAATGTGCGATTGACTTCCAACTTTGAGTATGACAATGAGTGGTCGGAAGAA
CTGGAGATGATTGATCACGTTGATCTCGGCTTCAATATTACTTATGCCGAGCACAAGAATGGAGCACAGCGCCCG
GATCTGGAGATTGAAGGCTCGCTGTCCGACATCAAGCTTCGACTGACGCAGCATCAGCTCAGATTTCTACTCGAG
ATTTCCAAGTCTGTACCGGCGGCCTTTGCTGGCGACGGGGCGGATGGCGATGAAGAGGCTGCCCGTCTAGTCGGG
GAGGAGACGTTGCAACGTGCCAAGACCATGTCTTGGGACGGGGGCAAGAGCAGCGACGAGCATCATGTCGACCTT
TCCCCAGAGCTCAGTGTAGCCGAGAATTGCTGGACCAAGCTGGACCTGGTTTTTCGCGTCGACACCATAGGACTT
GAACTCATCATGGCGCCACAAAACGGCCCGGTGGGAGACTTGGATGCGTCGAGCCTGTCGCGATTTTCGCTCGAT
GACACCAAGGTCAAGACGCGCATGCTTTCCGACGGCTCGCTCGAGGCCGAGTTGCTGGTTGGCTCATTCACCATT
TACGATAGTCGGCCGAGGGAGACGAACAAGTTTCGTCGCATCATGACATCGTCCAACACGGACTCGCAGCAGCTC
ATGGCTAGTCTGAGCATGTCGGGGGGCCATGACAAGAGCCTCATCGCCATGGCTACTATTGACAGCCCTCGAGTC
ATTTTTGCCCTCGACTACTTGTTTGCTCTGCACAAGTTTGCTATCGAGGGCCTGGTGCTCGACACGACGACGCCC
ATGGACGACGAGAGCTTGAACGAGACGCCCGAGGAATCGGACGCCGACTCGATGCAAGTGACGTACACGACGCCA
GGACAAGGAGCCTCTGGGCAAAAGCGGGCGGCGGAGCTCCAAGAGCAAACTTGGCCAGCCATGAGTGTTGGTTTT
AGAGTGAATCTGGTGGACGCACAGGTTATTCTCATTGCCAACCCGCTCACTCCCAGTTCAGAGGCGATTGTCTTG
AGCATTCGTCAGATGCTTCTATCTCAACAACATGCACTCACCTTTCACATTTCCCAAGTGGGCATGTTTTTATGC
CGCATGGACAAGTTTGAAACTTCGCATTTGAGAATCATTGACGACTTTTCGATACAGCTAAACATGGACAGTTCT
CAGGCCAAAGTGGTGAGCATGCACATTGACGTGGAGCCTTTGATTTTGCGACTGTCACTGCGAGATATTCTGCTG
GCGCTGCAAATCTTTGCAAGGGCGGGCGAGTTGTCTGGGGGCGACGCGACGACGCAGGAGCCCAAGCAATCGCAG
GCAGACAAGAAGGCGCGGCAGCTGGGAGATGGGGGCACGAGGAACAAGTCCCTGAGTGGGCGTGGACGAGGCCAG
TCGACCATTGCCAAGGCTAGAGGAGGCGAAGGATCGAGCGTTGGAGGAAACAAGGAGCCAGGGCGAGCGACTCTT
GGCATGACGCGGCAAGAATTGACGGCGACGATTGAGGGCATGCGCATCGTCTTGATTGGCGATGTGCACGAGCTT
CCCATTTTGGACGTGGGAGTCAAGCAGTTCACGGCAACGGCGGAGAATTGGTCGTGGGCTCTCAAGGCAGAGGCG
GCGATTGAGTTTTACTCCAACGTGTACAACTTCTCCAAGTCTAGCTGGGAGCCGCTGCTGGAGCCGTGGCAGGTG
GGCTTTGGAGTTGCCAAGGAGGCGGATAGCGGGCTGCTGGCTGTCGAGGTGGCGTCGCAAAAGACGTTTGACGTG
ACGATTACAACGGCGACGATTGCGCTGGCGTCCAAGTCGTTTGATTTTTTGACGACGGAGCAGGACGTGCTGGGC
AAGCCACGGGGAGGCGAGGCTCCGTATCGCATCCGGAACCACACGGGCTTCGACGTTGAGCTCGAGGGCAAGGCG
TCGACGAGCGAGGAGCCCCTGAGGCTGAGACTGGACGACGGGCAAGAGGGCCCGTGGAGCTTTGAGCACTGGGAG
AAGATGCGGGAGAATCTCTTGACAGAGTCGGGGCAAAACGACGTGTGTGTCAAGATGGAGGGCAGCGGCTTCGAC
ATGGTGAAGAATGTGCGACTGAGCCGCGAGGGCGAGTTTCTGTACAGCCTGCGGCCCAAGGCGGACAATGTGCTG
CACCGGCTGTGCGTCGAGGTGAGGCTGGGTGCGGACAATGTCAAGAGGGTGACGCTGCGTTCGCCGCTGCTGGTG
GAAAACGCAACGCAGATTCCCGTGGAGCTGGGCGTTTATGACGCGGACGAGGGCCATTTGCTCAAGATTGAGAAG
ATTGCGCCGGGCGACTCGCGGCCACTGCCCGTGGGGGCCGTGTACGAGAAGCGAGCGCTGGTGCGTCCAGATGGC
GGCTTTGGCTACCAGTGGAGCCAAGATGAGGTGTGGTGGCGGGAGCTGCTCAAGCGGCCAACTCGGCAGCTTCTG
TGCAGGGCGGAGAATGGGGAGCCCTTTTTCTTTCAGCTGCACGCGCAGTTTGACAGGGCGAATCCCATGTGCAAG
TGAGGCCTCCTTTTTTTTTTTCTCCCCTTTTTCCTCCCCTCCATTTTTCCTCTCCTTTTTCCTCCTCTTTTTATG
GTTTCCCCCTCGCTTGTTTGTCTCTCTCTCTCTCTCTCTTTGTGGCTTGTGTGTTTGTCTCTCTCTTTCTCTCTC
TCTTTGTGGCTGACGACGGGACACGCCCCAGGGCCTATCCGTACATGAGAGTTAAGCTCTCGGCGCCCGTGACGC
TCGAGAACCTGCTGCCATACGACTTCAAGTACCGCATCTACGACAAGAACAGCAAAAAGGACTGGAGCAACTTTT
TGCGCAAGGGCGGCGTCAGCCCGGTGCATGCGGTGGAGCTGTCGCATCTGCTGCTGCTCAGCATCGACATGCAGG
ACAGCGTCTTCAAGCCCAGCGACTTTGGCATCATCAACGCGGGCAGCAGCGACGACTTCCGCAAGGAGACGCGGC
TGCTGCTCAAGGACGACGAGGGCCTGGCGCTGCACCTCAGCCTGCACTACTTCAAGACGGCCAACAGCGGAGGCG
CCTTCAAGGTGGCGGTGTACAGCCCCTACATTGTGCTCAACAAGACGGGCCTGGACCTGCGCATCCGGGCCAAGA
GCTTCCTCCAGCAGGCCAGGGCGGCAGCGGGCCAGTTCCCGCGGCTGCCAACGGGCGACTCGGAGCGGCCCAAGG
CGCTGCCTCTCATGTTCTCGTTTGGCAACGATGACCATAGGAACAGGGCCATGCTCAAGGTGGACGAGTCTGAGT
GGAGCAAGCCGCAGAGCTTCGACGCCATTGGCAGCACGTCGGAAGTGGTGGTCATGTCGGCGTCGCGGCAGCGCG
AGATGCACCTGGGCCTGACGGTGCAGTCGGGCGACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGCCGC
GCTTCATTGTGGTGAACAAGGTGGGCGAGCAAATGCTGGTGCGCGAGTCGACGTCGCCCGGCTACATGACGCTGC
GAGGCGGCGCGCTGCAGCCGCTGCACTTTATGCAAAAGTCGCCCGTCAAGCAGCTGTGCCTGTGCTATCCCGGCG
TCGACAACCACTGGTCGGCGCCCTTCAACATTGCCCATCTGGGCACGACGCACGTCAAGATTGCCCGTGCCCGCC
AGCGCCAGCGCCTGGTGCGCGTCGAGACGCTCATGGAGGAGTCCACCATTTTCCTGCACCTGAGCATGGAGAGCA
ACAACTGGCCCTTTTCCATGCGCAACGAGAGCGACGTCGAGTTTACCTTTTGGCAGGCCAACCCCACGCTCGACG
AGGCCGATGTCGAGGACTATAGCGGCTGGAAGCCCATTCGCTATCGCCTGCCGCGCCGCAGCATCATGCCCTATG
CCTGGGACTTTCCCGCCGCCAAGTTTCGCGAGGTGGTGATTGCCGCCCACGCCAAGGAGCGCCACGTCAAGCTGG
CCGAGATTGGCAACCAGGTGCCCATGAAGATTGTGGCGCGCGACGGCCAGCCGCAAATCATTGACATCAACGTGG
CGGCCGACGGGCCCACCCAGACGCTGATTCTGAGCAACTTCCGCCCCAGCAAGAGCATGTACAAGCCCAAGCCGC
TGTCGCGCACCAGCAGCGGCCCCGACGCCTTTGAGGTCAAGCAGCAGGAGACGGGCGCCACCCTGCGCGCCCAGC
TCAAGCTCTCGGGCATTGGCATCTCCCTCATCAATGCCCAGCTCAAGGAGCTGGCCTACATTACCTTTCGCCACG
TGCAGCTGCGCTTCATGGACTCGCCCCTCATCCAGACGCTGTCGCTGGCCGTCAAGTGGATCCAGATTGACAACC
AGCTCTATGGCGGCATCTTCCCCATTGTCCTCTACCCCAGCGTCGTGCCCAAGCGCGCCAACGAGGTCGAGGCCC
ACCCCTCGCTGCACGCCATGGTTAGCCGCGTCAAGGACGACTCGTACGGCGTCGTCTACTTCAAGTACGCCACCG
TGCTGGTGCAGCAGATGACGCTCGACCTGGACGAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCGACGTGCCCG
GCGCCAGCTGGACTCTTGTCCACCACGACGGCAAGCTGTGCGACCAGGACCTCGACATCCCCGAGCCCTCGCAGC
ACCAGTCGGGCCACGACATTTACTTTGAGCTGCTCAACATCCAGCCCACGCAGCTCGACCTGAGCTTCATGCGCA
CAGAGCGCGTCAATGCCCAGGACAAGACGTCGACGCGCAACCCCATCATGTTCTTCCTCAACGTCATGACCATGG
CCATTGGCAACGTCAACGACGCCCCCATAAGATTCAACGCCTTGATGCTCGACAATGTCCGCGTCACCATTCCCG
TCCTCATGCAAAACATCTCCAACCACTACAGCCAAGAGGTCATGTACCAGATCCACAAGATTCTCGGCTCCGCCG
ACTTTTTGGGCAACCCCGTCGGCCTCTTCAACAACATCTCGTCGGGCGTCACCGACATCTTTTACGAGCCCTACC
AGGGCCTGATCCTCTCGGACAGGCCCGAGGAGTTTGGCATTGGCATTGCCAAGGGCGCCGCCTCGTTTGCCAAGA
AGACTGTCTATGGCTTCAGCGACAGCTTCTCCAAGTTTACCGGCAGCTTGAGCAAGGGCCTGGCCGCCGCCTCGC
TCGACAAGCAGTTCCAGGACCGCCGCCGCATCACCAGGGCCCGCAACAGGCCCAAGCACGCCCTCTACGGCGTCA
CAGCCGGAGCCAACTCGCTCTTCACCAGCGTCGCCTCTGGCGTTGGCGGCCTGGCCCGCAAGCCCCTCGAGGGTG
CCGAGCAGGAGGGCGCCCTCGGCTTCTTCAAGGGCGTCGGCAAGGGCGTGCTTGGCCTGGCCACCAAGCCCGCCG
TTGGCGTCCTCGACATGGCCAGCAACGTGAGCGAGGGCATTCGCAACACAACCACTGTCTTTGACGGCTCCGAGC
TGGACCGCGCCCGCTACCCGCGCTTCATTCCAAACGACGGCATCGTGCGCCCCTATAATGCCCGCGAGGCTCTGG
GGCAGTACTGGCTCAAGCAGGTGGACAATGGCCGCTACTTTGACGAGCAGTACATTGGCCACCTCGAGCTGCCCA
AGGAGGACATGGTGGTCATGGTGACGTATGCGCGCATTCTGCTTATCCGCTCGAGGCGCCTGACGAGCGAGTGGG
ACGTGCCGCTCAAGGATGTGCAGACCATTGCCAAGGAGCGCACAGGCGTCAGCCTGGTGCTGCGAGGAGGGGCTA
ATGGACCCTTTATCCCGGTCGGCGGTGGCAGCGAGAGGAGCTTCTTGTACCGCATGGTGGGCGTTGCAGTGGAAG
AGTTCAACCGGCGCTTCAGAGGCGGCGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail