Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7979
Gene name
LocationContig_92:29532..31908
Strand-
Gene length (bp)2376
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07842 GCFC GC-rich sequence DNA-binding factor-like protein 2.7E-64 470 742
PF01585 G-patch G-patch domain 5.1E-13 231 272
PF12457 TIP_N Tuftelin interacting protein N terminal 3.7E-10 41 117
PF12656 G-patch_2 G-patch domain 3.3E-07 231 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK6|YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.03c PE=3 SV=1 196 789 6.0E-45
sp|Q66J74|TFP11_XENLA Tuftelin-interacting protein 11 OS=Xenopus laevis GN=tfip11 PE=2 SV=1 39 789 5.0E-30
sp|Q6DI35|TFP11_DANRE Tuftelin-interacting protein 11 OS=Danio rerio GN=tfip11 PE=1 SV=1 232 789 7.0E-30
sp|Q0IIX9|TFP11_XENTR Tuftelin-interacting protein 11 OS=Xenopus tropicalis GN=tfip11 PE=2 SV=2 39 789 6.0E-28
sp|Q9SHG6|STIP1_ARATH Septin and tuftelin-interacting protein 1 homolog 1 OS=Arabidopsis thaliana GN=STIPL1 PE=2 SV=1 232 788 7.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK6|YKR3_SCHPO G-patch domain-containing protein C1486.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.03c PE=3 SV=1 196 789 6.0E-45
sp|Q66J74|TFP11_XENLA Tuftelin-interacting protein 11 OS=Xenopus laevis GN=tfip11 PE=2 SV=1 39 789 5.0E-30
sp|Q6DI35|TFP11_DANRE Tuftelin-interacting protein 11 OS=Danio rerio GN=tfip11 PE=1 SV=1 232 789 7.0E-30
sp|Q0IIX9|TFP11_XENTR Tuftelin-interacting protein 11 OS=Xenopus tropicalis GN=tfip11 PE=2 SV=2 39 789 6.0E-28
sp|Q9SHG6|STIP1_ARATH Septin and tuftelin-interacting protein 1 homolog 1 OS=Arabidopsis thaliana GN=STIPL1 PE=2 SV=1 232 788 7.0E-27
sp|Q06AK6|TFP11_PIG Tuftelin-interacting protein 11 OS=Sus scrofa GN=TFIP11 PE=2 SV=1 215 789 2.0E-25
sp|Q9SLC6|STIP2_ARATH Septin and tuftelin-interacting protein 1 homolog 2 OS=Arabidopsis thaliana GN=STIPL2 PE=2 SV=1 232 787 5.0E-25
sp|Q5ZII9|TFP11_CHICK Tuftelin-interacting protein 11 OS=Gallus gallus GN=TFIP11 PE=2 SV=1 215 789 1.0E-24
sp|Q5R5K8|TFP11_PONAB Tuftelin-interacting protein 11 OS=Pongo abelii GN=TFIP11 PE=2 SV=1 215 789 1.0E-24
sp|Q9UBB9|TFP11_HUMAN Tuftelin-interacting protein 11 OS=Homo sapiens GN=TFIP11 PE=1 SV=1 215 789 2.0E-24
sp|A1XD95|TFP11_MACFA Tuftelin-interacting protein 11 OS=Macaca fascicularis GN=TFIP11 PE=2 SV=1 215 789 3.0E-24
sp|A1XD93|TFP11_PANTR Tuftelin-interacting protein 11 OS=Pan troglodytes GN=TFIP11 PE=2 SV=1 215 789 3.0E-24
sp|A1XD94|TFP11_MACMU Tuftelin-interacting protein 11 OS=Macaca mulatta GN=TFIP11 PE=2 SV=1 215 789 3.0E-24
sp|Q5U2Y6|TFP11_RAT Tuftelin-interacting protein 11 OS=Rattus norvegicus GN=Tfip11 PE=1 SV=1 215 789 5.0E-24
sp|Q9ERA6|TFP11_MOUSE Tuftelin-interacting protein 11 OS=Mus musculus GN=Tfip11 PE=1 SV=1 215 789 7.0E-24
sp|A4UMC6|TFP11_MONDO Tuftelin-interacting protein 11 OS=Monodelphis domestica GN=TFIP11 PE=2 SV=1 232 789 2.0E-23
sp|Q9Y103|TFP11_DROME Septin-interacting protein 1 OS=Drosophila melanogaster GN=sip1 PE=1 SV=1 232 789 2.0E-23
sp|A4UMC5|TFP11_RABIT Tuftelin-interacting protein 11 OS=Oryctolagus cuniculus GN=TFIP11 PE=2 SV=1 215 789 4.0E-23
sp|A1XD97|TFP11_CANLF Tuftelin-interacting protein 11 OS=Canis lupus familiaris GN=TFIP11 PE=2 SV=1 215 789 6.0E-22
sp|Q29RR5|TFP11_BOVIN Tuftelin-interacting protein 11 OS=Bos taurus GN=TFIP11 PE=2 SV=2 215 789 7.0E-21
sp|Q17784|TFP11_CAEEL Septin and tuftelin-interacting protein 1 homolog OS=Caenorhabditis elegans GN=stip-1 PE=1 SV=2 235 785 3.0E-20
sp|A1XDC0|TFP11_DICDI Septin and tuftelin-interacting protein 1 homolog OS=Dictyostelium discoideum GN=stip-1 PE=2 SV=1 545 791 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7979
MEHFRSGYAFDPSRLNKATAADGSSSDSEDEDDHVLPGVGDDDDFADLNPRKRRRIGGNSKEKAALGIFGSDSDD
DGPGKAWKRKSLRKKGVDFVTTATPTVNSDNDEHDSEQDSPDLSGQNTRLVQDESEDSQGDSQEDDGGIGLGFST
KKQGMAWQARAKMPTKDNSPVRPPAATIKTTFDGTSVLGRGFVPSSSNIPTLKADDSTASIPRNKPQPSAFGTKG
KINATSFGARMMAKMGYVEGKGLGKEGQGRNIVIEANLRPQGVGLGAVKEKSEQERQEEKRQARLRGEEVIDSEE
DKKQQRKARNRALKSAANSANTTPRRRKTKYLTAEQFKATAPGLHIPDALAPILDMTGPEGKTLTSASGIMTPSS
TLPEPSELVEARKLVRRAHADLQAFSEEWQSLQERKKWLDQELRERQEQLDDTKSDFEGLETFATLVANELTPES
DWFRVVGCLEKAVSLGAVNTETAYLAVAAIHPFLKSSEWDPLAEPKRFASELRPLSKLFTTWEGENKGRSVDGWN
WTAAQTNGIYRRHRKTASPYESMMHKLWLPRMLAAVRDWDALKPGPMLKVVESWKDVLPGFVQEQLMDSIARKLE
STLSEWNPRKKRQSHQLPHTWLFPWLQYMPAYHVDPKGTGLVSEVRRKFKHLIDMWQFERGVVPGLMQWQDVMGE
QWRSLIMSHVLPSMGKYLRANFRVDPADQEPYLPVLEGVLGWHELLGDAVMGEVVGKNVLPLWHAKLQEWLALDE
ADVGEVADWYEWWRAVVLKKLAETEGVGRELDKGLQMMNLV*
Coding >OphauB2|7979
ATGGAGCATTTTCGGTCAGGCTATGCTTTTGATCCTTCTCGCCTCAACAAAGCTACTGCCGCGGATGGCTCGTCA
TCAGATTCCGAAGATGAGGACGACCACGTCTTGCCTGGTGTTGGCGATGACGATGATTTCGCCGACTTGAATCCT
CGAAAGCGGCGACGAATCGGAGGCAACAGTAAAGAAAAAGCGGCACTTGGCATCTTCGGCTCTGACAGCGATGAT
GATGGGCCTGGCAAGGCGTGGAAGCGAAAAAGTCTCAGGAAAAAGGGCGTTGACTTCGTAACAACAGCCACTCCG
ACTGTAAACTCCGATAATGACGAGCACGATTCGGAGCAGGATTCTCCCGACTTGAGCGGCCAAAATACGAGACTA
GTGCAAGATGAAAGTGAAGACTCACAAGGCGACTCACAAGAAGATGATGGCGGTATTGGCCTGGGCTTCAGCACT
AAGAAGCAAGGTATGGCGTGGCAAGCAAGAGCAAAAATGCCAACAAAAGATAATTCTCCAGTTCGACCGCCAGCA
GCAACCATCAAGACGACGTTTGATGGGACAAGCGTTCTCGGCAGAGGCTTTGTACCCTCTTCGTCAAATATACCG
ACATTGAAGGCGGACGACAGCACTGCTTCGATTCCCCGCAACAAGCCTCAGCCAAGTGCTTTTGGGACCAAGGGC
AAGATCAATGCAACGTCATTCGGGGCTCGTATGATGGCAAAGATGGGCTATGTTGAGGGCAAGGGTCTCGGGAAA
GAGGGCCAGGGTCGGAATATTGTCATCGAGGCCAATTTGCGGCCACAAGGTGTCGGCTTAGGAGCAGTCAAGGAG
AAGTCGGAACAGGAGCGTCAAGAAGAGAAGCGCCAAGCCCGGCTGCGAGGCGAGGAAGTCATTGATTCGGAGGAA
GACAAGAAGCAGCAGCGAAAAGCGAGGAACAGAGCCCTGAAAAGTGCTGCTAACAGCGCAAACACCACTCCGCGA
AGGCGCAAGACTAAGTACTTGACAGCTGAGCAATTCAAGGCTACCGCGCCTGGCTTGCACATTCCAGATGCTCTT
GCGCCGATACTCGACATGACAGGCCCGGAAGGAAAAACGCTCACTTCAGCCAGTGGTATCATGACACCATCTTCA
ACTCTGCCAGAACCAAGCGAATTAGTCGAGGCGAGGAAGCTCGTCAGACGGGCACATGCAGATTTACAAGCTTTC
TCTGAGGAGTGGCAGAGCCTACAGGAGCGCAAAAAGTGGCTTGATCAAGAGCTGAGAGAGCGACAAGAGCAACTT
GACGACACAAAATCTGACTTTGAGGGCCTTGAAACTTTTGCGACCTTGGTTGCCAACGAGCTGACGCCAGAATCG
GACTGGTTTCGGGTCGTTGGCTGTCTCGAAAAGGCTGTCTCACTCGGCGCAGTGAACACAGAGACGGCATATTTG
GCAGTTGCGGCTATCCATCCCTTTCTCAAGAGTTCAGAGTGGGATCCTTTGGCTGAGCCTAAACGGTTTGCTTCA
GAACTGCGGCCCCTTTCAAAACTTTTCACAACTTGGGAAGGAGAGAACAAAGGCCGATCTGTTGACGGATGGAAC
TGGACAGCAGCACAAACAAACGGCATCTACCGCCGACACCGCAAAACAGCATCGCCCTACGAAAGTATGATGCAC
AAACTCTGGCTGCCGCGGATGCTGGCAGCAGTTCGGGATTGGGATGCGCTCAAGCCGGGTCCCATGCTCAAAGTG
GTGGAGAGCTGGAAAGATGTTTTGCCCGGTTTTGTGCAGGAGCAGCTCATGGACAGTATTGCGCGCAAGCTCGAG
TCGACCTTGTCTGAATGGAATCCACGGAAAAAGCGCCAGAGCCATCAGCTGCCCCACACATGGCTCTTTCCCTGG
TTGCAATACATGCCAGCATATCATGTGGATCCGAAGGGAACGGGACTGGTGTCCGAGGTGAGGAGGAAGTTCAAG
CACCTCATTGACATGTGGCAGTTTGAGCGAGGAGTAGTGCCGGGGCTGATGCAGTGGCAAGACGTCATGGGGGAG
CAGTGGCGCTCCTTGATCATGTCGCATGTACTGCCATCCATGGGCAAGTATCTGCGGGCCAACTTTCGCGTCGAC
CCGGCTGATCAGGAGCCCTACCTGCCGGTGCTGGAAGGCGTGCTAGGATGGCATGAGCTGCTGGGGGATGCTGTG
ATGGGCGAGGTGGTGGGGAAGAACGTGTTGCCACTGTGGCACGCCAAGTTGCAAGAGTGGCTGGCGCTTGATGAA
GCCGACGTGGGAGAAGTGGCGGATTGGTACGAGTGGTGGCGAGCGGTGGTGCTCAAGAAGCTGGCAGAGACGGAG
GGGGTTGGCAGGGAGCTGGACAAGGGGCTCCAGATGATGAATCTTGTATAG
Transcript >OphauB2|7979
ATGGAGCATTTTCGGTCAGGCTATGCTTTTGATCCTTCTCGCCTCAACAAAGCTACTGCCGCGGATGGCTCGTCA
TCAGATTCCGAAGATGAGGACGACCACGTCTTGCCTGGTGTTGGCGATGACGATGATTTCGCCGACTTGAATCCT
CGAAAGCGGCGACGAATCGGAGGCAACAGTAAAGAAAAAGCGGCACTTGGCATCTTCGGCTCTGACAGCGATGAT
GATGGGCCTGGCAAGGCGTGGAAGCGAAAAAGTCTCAGGAAAAAGGGCGTTGACTTCGTAACAACAGCCACTCCG
ACTGTAAACTCCGATAATGACGAGCACGATTCGGAGCAGGATTCTCCCGACTTGAGCGGCCAAAATACGAGACTA
GTGCAAGATGAAAGTGAAGACTCACAAGGCGACTCACAAGAAGATGATGGCGGTATTGGCCTGGGCTTCAGCACT
AAGAAGCAAGGTATGGCGTGGCAAGCAAGAGCAAAAATGCCAACAAAAGATAATTCTCCAGTTCGACCGCCAGCA
GCAACCATCAAGACGACGTTTGATGGGACAAGCGTTCTCGGCAGAGGCTTTGTACCCTCTTCGTCAAATATACCG
ACATTGAAGGCGGACGACAGCACTGCTTCGATTCCCCGCAACAAGCCTCAGCCAAGTGCTTTTGGGACCAAGGGC
AAGATCAATGCAACGTCATTCGGGGCTCGTATGATGGCAAAGATGGGCTATGTTGAGGGCAAGGGTCTCGGGAAA
GAGGGCCAGGGTCGGAATATTGTCATCGAGGCCAATTTGCGGCCACAAGGTGTCGGCTTAGGAGCAGTCAAGGAG
AAGTCGGAACAGGAGCGTCAAGAAGAGAAGCGCCAAGCCCGGCTGCGAGGCGAGGAAGTCATTGATTCGGAGGAA
GACAAGAAGCAGCAGCGAAAAGCGAGGAACAGAGCCCTGAAAAGTGCTGCTAACAGCGCAAACACCACTCCGCGA
AGGCGCAAGACTAAGTACTTGACAGCTGAGCAATTCAAGGCTACCGCGCCTGGCTTGCACATTCCAGATGCTCTT
GCGCCGATACTCGACATGACAGGCCCGGAAGGAAAAACGCTCACTTCAGCCAGTGGTATCATGACACCATCTTCA
ACTCTGCCAGAACCAAGCGAATTAGTCGAGGCGAGGAAGCTCGTCAGACGGGCACATGCAGATTTACAAGCTTTC
TCTGAGGAGTGGCAGAGCCTACAGGAGCGCAAAAAGTGGCTTGATCAAGAGCTGAGAGAGCGACAAGAGCAACTT
GACGACACAAAATCTGACTTTGAGGGCCTTGAAACTTTTGCGACCTTGGTTGCCAACGAGCTGACGCCAGAATCG
GACTGGTTTCGGGTCGTTGGCTGTCTCGAAAAGGCTGTCTCACTCGGCGCAGTGAACACAGAGACGGCATATTTG
GCAGTTGCGGCTATCCATCCCTTTCTCAAGAGTTCAGAGTGGGATCCTTTGGCTGAGCCTAAACGGTTTGCTTCA
GAACTGCGGCCCCTTTCAAAACTTTTCACAACTTGGGAAGGAGAGAACAAAGGCCGATCTGTTGACGGATGGAAC
TGGACAGCAGCACAAACAAACGGCATCTACCGCCGACACCGCAAAACAGCATCGCCCTACGAAAGTATGATGCAC
AAACTCTGGCTGCCGCGGATGCTGGCAGCAGTTCGGGATTGGGATGCGCTCAAGCCGGGTCCCATGCTCAAAGTG
GTGGAGAGCTGGAAAGATGTTTTGCCCGGTTTTGTGCAGGAGCAGCTCATGGACAGTATTGCGCGCAAGCTCGAG
TCGACCTTGTCTGAATGGAATCCACGGAAAAAGCGCCAGAGCCATCAGCTGCCCCACACATGGCTCTTTCCCTGG
TTGCAATACATGCCAGCATATCATGTGGATCCGAAGGGAACGGGACTGGTGTCCGAGGTGAGGAGGAAGTTCAAG
CACCTCATTGACATGTGGCAGTTTGAGCGAGGAGTAGTGCCGGGGCTGATGCAGTGGCAAGACGTCATGGGGGAG
CAGTGGCGCTCCTTGATCATGTCGCATGTACTGCCATCCATGGGCAAGTATCTGCGGGCCAACTTTCGCGTCGAC
CCGGCTGATCAGGAGCCCTACCTGCCGGTGCTGGAAGGCGTGCTAGGATGGCATGAGCTGCTGGGGGATGCTGTG
ATGGGCGAGGTGGTGGGGAAGAACGTGTTGCCACTGTGGCACGCCAAGTTGCAAGAGTGGCTGGCGCTTGATGAA
GCCGACGTGGGAGAAGTGGCGGATTGGTACGAGTGGTGGCGAGCGGTGGTGCTCAAGAAGCTGGCAGAGACGGAG
GGGGTTGGCAGGGAGCTGGACAAGGGGCTCCAGATGATGAATCTTGTATAG
Gene >OphauB2|7979
ATGGAGCATTTTCGGTCAGGCTATGCTTTTGATCCTTCTCGCCTCAACAAAGCTACTGCCGCGGATGGCTCGTCA
TCAGATTCCGAAGATGAGGACGACCACGTCTTGCCTGGTGTTGGCGATGACGATGATTTCGCCGACTTGAATCCT
CGAAAGCGGCGACGAATCGGAGGCAACAGTAAAGAAAAAGCGGCACTTGGCATCTTCGGCTCTGACAGCGATGAT
GATGGGCCTGGCAAGGCGTGGAAGCGAAAAAGTCTCAGGAAAAAGGGCGTTGACTTCGTAACAACAGCCACTCCG
ACTGTAAACTCCGATAATGACGAGCACGATTCGGAGCAGGATTCTCCCGACTTGAGCGGCCAAAATACGAGACTA
GTGCAAGATGAAAGTGAAGACTCACAAGGCGACTCACAAGAAGATGATGGCGGTATTGGCCTGGGCTTCAGCACT
AAGAAGCAAGGTATGGCGTGGCAAGCAAGAGCAAAAATGCCAACAAAAGATAATTCTCCAGTTCGACCGCCAGCA
GCAACCATCAAGACGACGTTTGATGGGACAAGCGTTCTCGGCAGAGGCTTTGTACCCTCTTCGTCAAATATACCG
ACATTGAAGGCGGACGACAGCACTGCTTCGATTCCCCGCAACAAGCCTCAGCCAAGTGCTTTTGGGACCAAGGGC
AAGATCAATGCAACGTCATTCGGGGCTCGTATGATGGCAAAGATGGGCTATGTTGAGGGCAAGGGTCTCGGGAAA
GAGGGCCAGGGTCGGAATATTGTCATCGAGGCCAATTTGCGGCCACAAGGTGTCGGCTTAGGAGCAGTCAAGGAG
AAGTCGGAACAGGAGCGTCAAGAAGAGAAGCGCCAAGCCCGGCTGCGAGGCGAGGAAGTCATTGATTCGGAGGAA
GACAAGAAGCAGCAGCGAAAAGCGAGGAACAGAGCCCTGAAAAGTGCTGCTAACAGCGCAAACACCACTCCGCGA
AGGCGCAAGACTAAGTACTTGACAGCTGAGCAATTCAAGGCTACCGCGCCTGGCTTGCACATTCCAGATGCTCTT
GCGCCGATACTCGACATGACAGGCCCGGAAGGAAAAACGCTCACTTCAGCCAGTGGTATCATGACACCATCTTCA
ACTCTGCCAGAACCAAGCGAATTAGTCGAGGCGAGGAAGCTCGTCAGACGGGCACATGCAGATTTACAAGCTTTC
TCTGAGGAGTGGCAGAGCCTACAGGAGCGCAAAAAGTGGCTTGATCAAGAGCTGAGAGAGCGACAAGAGCAACTT
GACGACACAAAATCTGACTTTGAGGGCCTTGAAACTTTTGCGACCTTGGTTGCCAACGAGCTGACGCCAGAATCG
GACTGGTTTCGGGTCGTTGGCTGTCTCGAAAAGGCTGTCTCACTCGGCGCAGTGAACACAGAGACGGCATATTTG
GCAGTTGCGGCTATCCATCCCTTTCTCAAGAGTTCAGAGTGGGATCCTTTGGCTGAGCCTAAACGGTTTGCTTCA
GAACTGCGGCCCCTTTCAAAACTTTTCACAACTTGGGAAGGAGAGAACAAAGGCCGATCTGTTGACGGATGGAAC
TGGACAGCAGCACAAACAAACGGCATCTACCGCCGACACCGCAAAACAGCATCGCCCTACGAAAGTATGATGCAC
AAACTCTGGCTGCCGCGGATGCTGGCAGCAGTTCGGGATTGGGATGCGCTCAAGCCGGGTCCCATGCTCAAAGTG
GTGGAGAGCTGGAAAGATGTTTTGCCCGGTTTTGTGCAGGAGCAGCTCATGGACAGTATTGCGCGCAAGCTCGAG
TCGACCTTGTCTGAATGGAATCCACGGAAAAAGCGCCAGAGCCATCAGCTGCCCCACACATGGCTCTTTCCCTGG
TTGCAATACATGCCAGCATATCATGTGGATCCGAAGGGAACGGGACTGGTGTCCGAGGTGAGGAGGAAGTTCAAG
CACCTCATTGACATGTGGCAGTTTGAGCGAGGAGTAGTGCCGGGGCTGATGCAGTGGCAAGACGTCATGGGGGAG
CAGTGGCGCTCCTTGATCATGTCGCATGTACTGCCATCCATGGGCAAGTATCTGCGGGCCAACTTTCGCGTCGAC
CCGGCTGATCAGGAGCCCTACCTGCCGGTGCTGGAAGGCGTGCTAGGATGGCATGAGCTGCTGGGGGATGCTGTG
ATGGGCGAGGTGGTGGGGAAGAACGTGTTGCCACTGTGGCACGCCAAGTTGCAAGAGTGGCTGGCGCTTGATGAA
GCCGACGTGGGAGAAGTGGCGGATTGGTACGAGTGGTGGCGAGCGGTGGTGCTCAAGAAGCTGGCAGAGACGGAG
GGGGTTGGCAGGGAGCTGGACAAGGGGCTCCAGATGATGAATCTTGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail