Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7977
Gene name
LocationContig_92:14931..22635
Strand-
Gene length (bp)7704
Transcript length (bp)7506
Coding sequence length (bp)7506
Protein length (aa) 2502

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 5.2E-28 327 733
PF00668 Condensation Condensation domain 1.2E-07 934 1130
PF00668 Condensation Condensation domain 1.2E-16 1843 2136
PF00501 AMP-binding AMP-binding enzyme 2.1E-24 1153 1483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 274 2149 7.0E-178
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 298 2095 5.0E-127
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 298 1484 2.0E-125
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 934 2124 7.0E-84
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 757 2156 8.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 274 2149 7.0E-178
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 298 2095 5.0E-127
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 298 1484 2.0E-125
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 934 2124 7.0E-84
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 757 2156 8.0E-83
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 63 914 3.0E-78
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 934 2125 8.0E-75
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 764 2167 5.0E-73
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 764 2153 8.0E-73
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 764 2167 6.0E-72
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1107 2130 3.0E-67
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 771 1746 2.0E-64
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 762 1759 1.0E-61
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 292 844 1.0E-59
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1083 2130 2.0E-59
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1116 1752 7.0E-58
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 940 1755 8.0E-56
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1132 2118 7.0E-55
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1132 1746 1.0E-54
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1070 1755 2.0E-54
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 273 924 5.0E-54
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1102 1746 6.0E-54
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1117 1746 2.0E-53
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 298 974 3.0E-53
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1135 2118 7.0E-52
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1132 1753 2.0E-51
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 944 1752 5.0E-51
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1147 1911 7.0E-51
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1147 2147 3.0E-48
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1137 2115 2.0E-47
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 945 1752 8.0E-41
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1137 2157 4.0E-38
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1131 2079 5.0E-36
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1128 1769 3.0E-34
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 342 712 3.0E-31
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1689 2405 2.0E-30
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1394 2149 2.0E-30
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 950 1758 2.0E-30
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 935 2086 5.0E-30
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 935 2020 4.0E-29
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 985 1775 8.0E-29
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1006 2134 7.0E-27
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1109 1756 8.0E-26
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1006 2124 9.0E-26
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 934 1654 2.0E-25
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 946 2064 3.0E-25
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1077 1731 3.0E-25
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 950 1780 3.0E-25
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1066 1550 7.0E-25
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 935 1654 1.0E-24
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1137 1723 1.0E-24
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 935 1736 4.0E-24
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 934 2015 7.0E-24
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 934 2064 8.0E-24
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1006 2124 1.0E-23
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1008 1722 2.0E-23
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1008 1722 2.0E-23
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1066 2095 3.0E-23
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 256 827 8.0E-23
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 934 1722 8.0E-23
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1149 2000 9.0E-23
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 770 1764 1.0E-22
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1102 1775 1.0E-22
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 913 1743 1.0E-22
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 902 2064 2.0E-22
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1147 1743 4.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 950 1770 7.0E-22
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 974 1746 9.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 950 1737 1.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 934 1739 1.0E-21
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 946 1755 2.0E-21
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1066 2095 2.0E-21
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1102 1722 3.0E-21
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 936 1761 3.0E-20
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1172 1747 5.0E-20
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 944 1730 5.0E-20
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 950 1769 5.0E-20
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1147 1771 5.0E-20
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 934 1743 6.0E-20
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1147 1771 7.0E-20
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 944 1758 1.0E-19
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1149 1742 2.0E-19
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 256 827 2.0E-19
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 946 1722 2.0E-19
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1066 1731 5.0E-19
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1066 1722 7.0E-19
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1102 1756 1.0E-18
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1060 2136 2.0E-18
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 946 1746 2.0E-18
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1008 1654 2.0E-18
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1056 1736 2.0E-18
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1040 1752 2.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 251 779 3.0E-18
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 921 1722 3.0E-18
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1147 2149 4.0E-18
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1109 1722 4.0E-18
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 946 1654 4.0E-18
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1040 1752 5.0E-18
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1170 1746 5.0E-18
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 935 1737 1.0E-17
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 934 1746 2.0E-17
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1150 1752 3.0E-17
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1102 1722 6.0E-17
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 939 1722 9.0E-17
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1066 1743 2.0E-16
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1106 2124 2.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1171 2139 8.0E-16
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 286 716 9.0E-16
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 936 1756 2.0E-15
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1106 1746 3.0E-15
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1106 1746 4.0E-15
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 944 1722 6.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1146 2020 1.0E-14
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 944 2124 2.0E-14
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 298 827 2.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 256 827 4.0E-14
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1117 1731 4.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 300 827 5.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1171 1762 5.0E-14
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1147 1731 5.0E-14
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1149 1723 2.0E-13
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 301 716 2.0E-13
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1145 1747 2.0E-13
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1855 2149 5.0E-13
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1065 1746 6.0E-13
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1154 1746 7.0E-13
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1116 1752 3.0E-12
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1069 1541 3.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1843 2149 8.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 423 832 1.0E-11
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1142 1426 2.0E-11
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 404 620 3.0E-11
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 936 2105 3.0E-11
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 300 606 5.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1157 1752 7.0E-11
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 946 1654 1.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 300 606 2.0E-10
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 300 606 2.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1197 1748 2.0E-10
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 936 1757 3.0E-10
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 300 607 5.0E-10
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 936 1757 5.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 300 606 8.0E-10
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 299 764 8.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 300 606 1.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 946 1722 1.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 946 1722 1.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1172 1747 2.0E-09
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1146 1363 9.0E-09
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1146 1363 9.0E-09
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1169 1752 2.0E-08
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 345 606 3.0E-08
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 345 606 3.0E-08
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1146 1756 4.0E-08
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1151 1363 5.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1844 2126 7.0E-08
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 293 653 7.0E-08
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 299 716 9.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 299 643 1.0E-07
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1112 1551 2.0E-07
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1112 1551 3.0E-07
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1106 1551 3.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1145 1363 4.0E-07
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 338 606 6.0E-07
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 994 1383 1.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1840 2103 2.0E-06
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 299 606 3.0E-06
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1287 1541 5.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1851 2125 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 36 NRPS-like

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6743
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3938
Ophiocordyceps australis map64 (Brazil) OphauB2|7977 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7619

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7977
MSLGKEEEATESIHAEPNRISNDDMLSAIDTCAATFLSSESESSSLLQPSTRQNSQRNSTYQQLEDLLLSTSKVE
RVLAITPRAGSFEGQLVVLVAPVTKPPQGRSELSPNQELHLVPPREHEPDRQLIQELRTVVMEWGGTLPRPDVWV
LVQRLACDVRHAQTWVQNMTEHVVERVMMMQPPQPRQRHCGSQSGKKTCDEAENGVKWTSGEKRIRQIQPRKARQ
LRVNAASAAVAEAVDDGEGEGERCDQRQEHKQAAEAAAAAEAAEAAEATKATTHTSQQDEQKTGGDDDEGFFFPL
SPMQQLFFRTTVARSIEAACVAGTGFRFSQSILLRVRGNIPLADIEAAVAHLVARHSMLRAHFRLTPGGWAQTMA
SAATGKSHRFEHRYAAAELHVLAAMEQARRSLNLFNGPVFAAEHMRTADNSQLLFLVAHHLVVDLASWRILLSDL
NILLRDGVLASPLSTPFTHWVDLQSLELENHGSPSHALDVPDLAYWHLSGRSNCYGDTEQLNFSLDTHVAAALVS
RCNEPLRTQPSHILMASLIYSFSQVFPSQPVPIVWNQESARSSPRVQNTIGWFTTLCPVRVQADAETDLIQLVRL
VKDAHRAATQSHSSVFPYGVAHASQLSSVPIQVMFNCVETLHQLTPHNSLLEPTRSPDRDVETLTCDVGPQVGRI
SLFEMSVVLDESSVQVEFLFNAYTAHQDRIITWMNNFERAVAEATAQLLTMKAELTLADAPLLPTSYEALKTFAS
CRLAALGLTSVSNIESIGPVSSLQQEILIAQGQDQNCYSISSTYEFKIAAGLEFNQTRLYESWKKLIARHDCLRT
VFADTIADNGLFVKVLLSKVSPEMLFFDSPNPDKTLASVPPVKFVSSRPRHRLSVSRSSTEIYIRFDVSQALCDI
FTINRLFSQLEHEYSASNTRGYDDVLNEVPSCPKFCNTHGIEGSAVIKLAWGLVLRCFVAEDKVCFGYQVQRRGQ
DLLSKGAEPLGCLDAIIANVIDFSNLPNVGQVLCDIQKRSMRSYAQGAPPISEIEHALGLHGERLFNTSVSFGDS
ARHDLDGKFVSATFDANCDVSLCVTMVDDKLHCDMTYRGLTTGQAANVMGCFECAIEAIMHDPLQPVSDVDLLTK
DKLEEIAKPDWKRAPGELCALIDEMIMRQAKQQPHATAIVAWDGEFSYGQVDVYVEKLATSLVNLGVRPGILVPV
VLDKCRWSPIIMLAVLKAGACFVAIDSQDASSAKTLISQLDAPLVLVTESAWMQTSPLASNCLVIDQAKLDLVPP
QLTLGLHKRSPEQAACAFLSPGQSGPKGMFYTHRSLCSIMSAQGPVLGIGDGSRVLQLSAYNVDVALVEILETLL
HGGCVCIPSAHERINDLQGVITRMGVTWTYMTPVLARKMDPTALPNLRTVCFRTRNLDQLTYSPWLDGREVLLVY
GAPDICPLAISISRLSAPVKTDIVAPPLLGRFLILNPEDAHKMAPVGAVGELAVDSSVITPHKFVLGEPLVDPAS
LQGPTGKPRWRYLRTSHRAQFLDSGHVRFLGSVRDQAGVNGCATLIADAERQARLCLQPNQDIIIEPITTSDAMD
LLVAFIDLDGDLGLGSYDLRCLGPEVKNKLFMARRAIELELGKKSKIGKKLPWQCIPAAFVPLRGFPLSASLKVN
RRKLHKMVASMSCSQLMGLADGQYCGGPANDVAGQKPCLTAAQESMQRLWAGLLGITAANIRLDDSFIDAGGDVW
LSAQLAILCRQNGYHVSVHDIVGGASLLDICHAASATMDGQGGTTPSGQGHGDATTARLSAVGPRLGSISYHALV
KHVLSPQIGVSWMQVIGAAAVSSQQIVCLESSLYARRGDVCCLILDFNGPVMLHRLETACEELTRLHPVLRTVFA
THDCRAYQVVIASLKFRLAHRVCEARQVESAVDDIVHEANVLPLHLSRAMTRFTFVGDEQRGKLVVQFSTVQVSE
ACIPQLVHDLVQLYTEPERVSAKPTFLEYCHEARHNAPYSEGIQHWRKRLAGASMTRILPNQKPRGPAASISKLR
ETVDVSPLADLGIDFETVLKTAWALVLATLAGGDDVVFGHLVGSQRMALTKDRMDVASIVGPMERVVPVRIRFPI
TQTSPLQMMLQVQRDCLSSRRFEHLGAHTIIGQCTDWARWAGFSTVVCHGAQGPLDGSTTLNLGNTTFTYRLAEP
MACASPDMLVCSMPVHPGRVALSLAYPAGLVPVDFGVSTMRLLVGAVKTLACYETVSEPILPPSSEYKALVPRVP
LQESRRRDDADEMHHLSHEQHRALGDLIAATWRQVLLPQGCGNLLHPQEQEACFYDVAGCLLPAYMLSHHLNHGL
SRLGMTSFGAITLTPEDIIRHPTMAAQRNLVARKMHSLGLAAPAARRRTFSIMGHGVSEAIASPTQHKTTSSWGA
EAARGSWRAPKTRHGSMRELGSRAGDWMRHHVSMSRDKESKYNWHSGHEQWRLQRHQSQQPAALVLDDVSPLSSS
SPGGAWNSQRAAVSPLCNPCLNHAYM*
Coding >OphauB2|7977
ATGAGCCTTGGCAAGGAAGAAGAGGCTACAGAAAGCATCCATGCCGAGCCCAACCGCATCAGTAATGACGATATG
CTCTCCGCTATAGATACTTGTGCTGCAACCTTTCTCAGCAGTGAAAGTGAATCTAGCAGTCTGCTACAGCCATCA
ACGAGGCAAAACAGTCAGCGAAATAGCACGTACCAGCAACTAGAAGATCTGTTGCTATCCACGTCCAAGGTTGAA
CGCGTTCTTGCCATAACGCCAAGGGCAGGTTCCTTTGAGGGGCAACTCGTTGTTCTTGTGGCTCCAGTCACAAAG
CCGCCTCAGGGCCGTTCCGAGTTGTCCCCAAACCAAGAGCTGCACCTAGTGCCGCCCCGCGAACACGAGCCGGAC
CGGCAGCTGATCCAAGAACTGCGCACTGTAGTCATGGAATGGGGAGGCACATTGCCACGGCCCGACGTATGGGTG
CTGGTGCAAAGATTGGCGTGTGATGTGCGGCATGCGCAGACATGGGTGCAGAATATGACGGAGCATGTTGTGGAG
CGCGTCATGATGATGCAGCCGCCACAGCCAAGACAAAGGCATTGTGGCTCGCAGAGTGGGAAAAAGACGTGTGAC
GAGGCAGAAAATGGAGTGAAATGGACAAGTGGTGAGAAGCGCATCAGGCAAATCCAGCCCAGGAAAGCGCGACAG
TTGCGCGTGAATGCTGCTTCCGCAGCCGTGGCGGAGGCTGTTGATGATGGGGAAGGAGAAGGGGAAAGATGCGAT
CAAAGGCAGGAGCACAAGCAAGCAGCAGAAGCAGCAGCAGCAGCAGAAGCAGCAGAAGCAGCAGAAGCAACAAAA
GCAACAACACACACAAGCCAACAAGACGAGCAAAAGACAGGCGGCGACGACGACGAAGGCTTCTTCTTCCCCCTC
TCGCCAATGCAGCAACTCTTCTTCCGCACAACTGTCGCTCGCAGCATCGAGGCGGCGTGCGTGGCAGGCACCGGC
TTTCGCTTTAGCCAAAGCATTTTGTTGCGAGTCCGAGGCAACATTCCTCTGGCCGACATTGAGGCTGCAGTTGCC
CATCTTGTGGCCCGGCACTCGATGCTACGAGCCCACTTCCGCCTGACGCCTGGCGGCTGGGCTCAGACCATGGCC
TCGGCCGCCACGGGCAAGTCGCACCGCTTTGAGCATCGCTATGCAGCAGCCGAGTTGCATGTCCTGGCGGCCATG
GAGCAGGCTCGCCGCTCTCTCAATCTCTTCAATGGTCCCGTCTTTGCTGCCGAGCACATGCGCACCGCCGACAAT
TCGCAGCTTCTCTTTCTCGTCGCCCATCACCTTGTCGTCGACCTCGCCTCTTGGCGCATTCTGCTGAGCGATTTG
AATATACTGCTGCGTGACGGTGTCCTTGCTTCACCGCTATCCACGCCCTTTACTCATTGGGTAGATCTCCAGAGC
CTTGAGCTCGAAAATCATGGCTCCCCATCTCATGCCTTGGACGTTCCAGACTTGGCTTACTGGCATCTCAGCGGG
CGTTCCAACTGCTACGGCGACACGGAGCAGCTCAACTTCTCTCTTGATACTCATGTCGCCGCCGCTCTTGTTTCA
CGTTGCAATGAGCCGCTGCGAACCCAGCCATCTCATATTCTCATGGCCTCTCTGATTTATTCCTTTAGCCAGGTT
TTCCCCAGCCAGCCTGTACCTATTGTCTGGAACCAAGAGAGTGCTAGAAGCTCCCCTCGAGTCCAAAACACGATT
GGGTGGTTCACAACGTTGTGCCCCGTCCGTGTGCAGGCCGACGCAGAGACGGATCTGATCCAGCTCGTGAGGCTT
GTCAAGGATGCGCACAGAGCGGCTACGCAATCTCACAGCAGTGTCTTCCCTTATGGTGTCGCCCATGCGTCCCAA
CTTTCATCTGTACCTATCCAAGTCATGTTCAATTGTGTGGAAACCTTGCATCAACTGACTCCTCACAATTCGCTC
CTAGAGCCCACCAGATCGCCCGACCGCGACGTTGAAACACTGACCTGCGATGTCGGTCCCCAAGTCGGCCGCATC
TCTCTCTTTGAGATGTCAGTGGTTCTTGATGAGTCTAGTGTACAAGTTGAATTTCTCTTCAACGCTTACACGGCG
CACCAAGATCGCATCATTACCTGGATGAATAATTTTGAGCGTGCAGTGGCTGAAGCTACCGCTCAACTGCTCACT
ATGAAAGCCGAACTAACCCTGGCCGATGCTCCTCTGCTACCAACTTCGTATGAGGCTCTGAAAACGTTTGCATCT
TGTCGACTAGCAGCCCTTGGCCTTACCAGCGTTTCCAATATCGAGTCTATAGGCCCTGTGAGCTCGCTGCAGCAA
GAAATCTTGATCGCGCAGGGCCAAGATCAAAACTGCTATTCTATTAGCTCCACATACGAATTCAAGATTGCCGCT
GGCCTTGAATTCAACCAGACGAGATTATACGAATCGTGGAAGAAGCTCATCGCACGACACGATTGTCTGCGAACC
GTTTTTGCCGACACCATCGCCGACAATGGGCTTTTTGTCAAGGTCCTCCTCAGCAAGGTTTCTCCAGAAATGCTC
TTTTTTGACTCTCCAAATCCCGACAAGACGTTGGCATCAGTCCCGCCCGTCAAGTTTGTTTCATCGCGGCCGCGA
CACCGATTATCCGTGAGTAGATCATCGACTGAGATATATATAAGATTTGATGTCAGCCAGGCTCTCTGCGATATA
TTCACCATCAATCGCTTATTCTCCCAGCTTGAGCATGAATACTCGGCCAGCAACACACGCGGCTATGATGACGTA
CTCAACGAGGTCCCATCCTGTCCTAAGTTTTGCAACACTCATGGTATAGAAGGCTCGGCTGTCATCAAACTTGCC
TGGGGACTCGTCCTCCGCTGTTTTGTGGCCGAGGATAAAGTCTGCTTTGGCTATCAGGTTCAGCGACGCGGCCAA
GATTTACTGAGCAAAGGAGCAGAGCCCCTGGGGTGTTTGGACGCCATTATTGCCAATGTCATTGACTTTTCTAAC
CTGCCCAATGTCGGCCAAGTGCTTTGTGATATTCAAAAACGCTCAATGCGCTCGTATGCCCAGGGTGCACCCCCT
ATCTCGGAGATAGAGCATGCGTTGGGCTTGCATGGCGAGCGCCTCTTCAACACGAGCGTCTCATTTGGAGATTCT
GCCAGGCACGATTTGGATGGCAAGTTTGTATCTGCTACATTTGATGCAAACTGCGACGTCTCTCTTTGTGTCACC
ATGGTCGACGACAAGCTCCACTGCGACATGACCTATCGTGGTCTTACCACTGGACAAGCCGCCAATGTCATGGGC
TGCTTTGAGTGCGCTATTGAAGCCATCATGCATGATCCGCTACAGCCTGTCTCTGATGTCGACTTGTTGACTAAA
GACAAGCTTGAAGAAATTGCAAAGCCGGATTGGAAGAGGGCGCCCGGAGAGTTGTGCGCCTTGATTGACGAAATG
ATTATGCGTCAGGCAAAGCAACAGCCACATGCAACGGCAATTGTAGCTTGGGATGGTGAATTCTCTTACGGGCAG
GTGGATGTATACGTGGAAAAGCTCGCCACCTCTCTGGTCAACCTCGGGGTCAGGCCCGGCATTCTGGTGCCCGTG
GTGCTTGATAAGTGTCGCTGGTCTCCAATAATTATGCTTGCCGTTCTCAAGGCTGGCGCCTGTTTTGTTGCTATC
GACAGCCAAGACGCTTCATCGGCCAAGACTCTCATTAGCCAACTCGATGCGCCCTTGGTTCTTGTTACGGAATCA
GCATGGATGCAAACCAGTCCTCTAGCCAGCAACTGCCTCGTCATTGACCAGGCCAAGCTCGATTTAGTGCCACCG
CAATTAACACTGGGGCTGCACAAGAGATCACCTGAGCAGGCAGCATGTGCTTTTCTGTCCCCTGGTCAGTCTGGG
CCTAAAGGCATGTTTTATACACATCGGTCATTATGCTCTATTATGTCGGCCCAAGGCCCGGTACTGGGTATTGGC
GATGGTAGTCGAGTACTACAGCTGTCTGCCTACAACGTGGACGTTGCTCTGGTGGAGATTTTGGAAACTTTGCTA
CACGGTGGCTGTGTGTGCATTCCGTCTGCCCATGAGCGAATAAATGACCTGCAAGGCGTCATTACACGCATGGGC
GTCACCTGGACGTACATGACTCCTGTATTGGCACGGAAGATGGATCCCACTGCGTTGCCAAACCTCAGGACGGTG
TGCTTCAGGACTAGGAACCTTGACCAGCTAACTTACAGCCCGTGGCTTGATGGCCGAGAGGTTTTGCTTGTATAC
GGAGCGCCCGACATCTGTCCCCTGGCAATTTCCATCAGCAGACTATCAGCGCCAGTCAAGACAGACATTGTAGCC
CCGCCTCTGTTGGGCAGATTTTTGATCTTAAACCCTGAGGATGCGCACAAGATGGCACCGGTTGGAGCAGTGGGA
GAATTGGCAGTCGACAGCAGTGTCATCACACCACACAAGTTCGTTTTGGGTGAGCCTCTTGTTGACCCAGCAAGC
TTGCAAGGACCAACAGGCAAACCAAGATGGCGATATCTAAGGACCAGCCACCGTGCACAGTTCCTCGACAGCGGC
CATGTCCGCTTCCTGGGCAGCGTGAGGGACCAAGCGGGCGTCAATGGATGTGCCACTCTCATCGCCGACGCAGAA
CGGCAAGCTCGTTTATGCCTGCAGCCCAATCAAGACATTATTATTGAGCCTATAACGACGAGCGATGCCATGGAT
CTTCTTGTGGCGTTTATTGACCTTGATGGCGATCTCGGCCTGGGGTCCTATGATCTCAGGTGCTTGGGTCCCGAG
GTAAAGAATAAGCTATTCATGGCAAGAAGGGCTATTGAGTTGGAGCTTGGAAAGAAGAGCAAGATTGGCAAGAAA
TTGCCCTGGCAATGCATCCCAGCAGCCTTTGTGCCGCTTAGGGGGTTTCCTTTGTCGGCGTCACTCAAGGTCAAC
AGGCGCAAATTGCACAAAATGGTGGCCTCCATGTCTTGTTCCCAACTCATGGGGTTAGCTGATGGCCAATACTGT
GGGGGACCAGCAAACGACGTAGCTGGCCAGAAGCCTTGCTTGACGGCTGCACAAGAGTCGATGCAGCGTCTATGG
GCAGGCCTTCTCGGCATTACGGCGGCCAATATCCGACTGGATGACAGTTTTATTGATGCTGGAGGCGATGTATGG
CTGTCTGCACAATTGGCCATCTTGTGCAGACAGAATGGCTATCATGTGTCGGTTCATGACATTGTTGGAGGTGCA
AGCCTCTTGGACATTTGCCATGCTGCCTCGGCCACGATGGATGGCCAAGGAGGCACCACGCCTAGTGGTCAGGGC
CATGGAGATGCCACGACTGCCAGACTGTCAGCAGTAGGGCCCAGGCTGGGCAGCATTTCATACCACGCACTGGTC
AAGCATGTGCTGTCGCCCCAAATAGGAGTTTCTTGGATGCAGGTGATTGGTGCTGCAGCAGTGTCGTCTCAGCAG
ATTGTGTGTCTCGAGTCGAGTCTCTACGCACGGCGTGGAGATGTTTGTTGCTTGATTCTCGACTTCAATGGGCCC
GTCATGTTGCACCGTCTGGAAACAGCTTGCGAGGAACTGACAAGGCTGCACCCAGTGCTTCGGACCGTCTTTGCC
ACTCACGATTGCCGAGCCTATCAGGTTGTCATTGCATCGCTCAAGTTTAGGCTGGCCCACCGCGTATGCGAAGCA
CGTCAGGTCGAGAGCGCCGTTGACGATATTGTGCATGAGGCAAATGTGCTTCCACTGCATCTTAGTCGTGCAATG
ACGCGATTCACCTTTGTTGGGGATGAACAGCGAGGCAAGCTTGTTGTGCAGTTCAGCACGGTGCAGGTCAGCGAG
GCTTGCATTCCACAACTAGTTCATGACCTTGTCCAGCTGTACACGGAGCCTGAGAGGGTATCTGCTAAGCCCACG
TTTCTGGAATACTGTCACGAAGCAAGGCACAATGCTCCCTACAGTGAAGGCATCCAGCACTGGAGAAAGCGGCTG
GCTGGTGCAAGCATGACGCGTATACTGCCGAATCAGAAGCCTCGTGGTCCAGCGGCCAGCATATCGAAGCTGCGC
GAGACGGTGGATGTGTCACCGCTGGCAGACTTGGGCATCGATTTCGAAACGGTGCTCAAGACGGCCTGGGCCCTT
GTATTGGCGACTTTGGCAGGTGGTGACGATGTCGTCTTTGGCCATCTGGTGGGCAGCCAGCGCATGGCGCTCACC
AAGGACAGAATGGATGTAGCGTCCATTGTCGGCCCCATGGAGCGCGTGGTGCCTGTCAGGATTCGGTTTCCCATA
ACACAGACGTCGCCATTGCAAATGATGCTTCAGGTGCAGCGCGACTGTCTGTCATCTCGGCGGTTTGAGCATCTA
GGAGCTCACACCATTATTGGTCAATGTACCGACTGGGCTCGCTGGGCAGGCTTTAGCACTGTCGTTTGCCATGGT
GCTCAGGGGCCCCTTGACGGCTCAACAACACTCAATCTGGGCAACACGACTTTTACCTACCGACTGGCAGAACCC
ATGGCCTGCGCCAGTCCCGACATGCTCGTTTGCTCCATGCCAGTCCATCCAGGGCGTGTGGCTCTCAGCTTGGCA
TATCCGGCAGGACTCGTACCTGTCGATTTTGGTGTCTCCACGATGCGTCTTCTTGTGGGAGCCGTCAAGACGCTG
GCGTGTTATGAGACGGTCAGCGAGCCCATCCTGCCACCATCAAGCGAATACAAGGCTCTGGTGCCAAGGGTGCCC
CTACAAGAATCGCGTCGACGCGACGACGCTGACGAGATGCATCATCTCTCTCACGAGCAGCATCGCGCACTAGGT
GATCTCATCGCGGCGACATGGCGTCAAGTTCTCTTGCCTCAAGGGTGCGGCAATTTGCTGCATCCTCAAGAGCAA
GAGGCTTGCTTCTACGACGTGGCTGGCTGTCTGCTACCGGCGTACATGCTGTCACACCATTTGAACCATGGGCTG
AGCAGACTGGGAATGACGAGCTTTGGCGCCATTACATTGACACCCGAGGACATTATTCGCCATCCTACAATGGCG
GCTCAGCGGAATCTGGTGGCGCGCAAAATGCACAGCTTGGGACTCGCGGCACCAGCGGCCCGGCGAAGGACTTTT
AGCATCATGGGCCATGGCGTATCCGAGGCTATAGCATCGCCCACACAGCACAAGACCACTTCATCTTGGGGCGCT
GAAGCTGCACGTGGCTCATGGCGGGCTCCAAAGACGCGTCACGGCAGCATGAGAGAGCTGGGTTCCCGCGCAGGC
GACTGGATGCGTCACCACGTGAGCATGAGTCGCGACAAGGAGTCGAAATACAACTGGCACAGCGGGCACGAGCAA
TGGCGGCTGCAGCGGCACCAGAGCCAGCAGCCGGCTGCGCTCGTGCTCGATGACGTGAGCCCTCTGAGTAGCTCA
TCGCCGGGAGGGGCGTGGAACAGTCAAAGAGCAGCTGTATCTCCATTGTGCAACCCTTGCCTCAACCATGCCTAC
ATGTAG
Transcript >OphauB2|7977
ATGAGCCTTGGCAAGGAAGAAGAGGCTACAGAAAGCATCCATGCCGAGCCCAACCGCATCAGTAATGACGATATG
CTCTCCGCTATAGATACTTGTGCTGCAACCTTTCTCAGCAGTGAAAGTGAATCTAGCAGTCTGCTACAGCCATCA
ACGAGGCAAAACAGTCAGCGAAATAGCACGTACCAGCAACTAGAAGATCTGTTGCTATCCACGTCCAAGGTTGAA
CGCGTTCTTGCCATAACGCCAAGGGCAGGTTCCTTTGAGGGGCAACTCGTTGTTCTTGTGGCTCCAGTCACAAAG
CCGCCTCAGGGCCGTTCCGAGTTGTCCCCAAACCAAGAGCTGCACCTAGTGCCGCCCCGCGAACACGAGCCGGAC
CGGCAGCTGATCCAAGAACTGCGCACTGTAGTCATGGAATGGGGAGGCACATTGCCACGGCCCGACGTATGGGTG
CTGGTGCAAAGATTGGCGTGTGATGTGCGGCATGCGCAGACATGGGTGCAGAATATGACGGAGCATGTTGTGGAG
CGCGTCATGATGATGCAGCCGCCACAGCCAAGACAAAGGCATTGTGGCTCGCAGAGTGGGAAAAAGACGTGTGAC
GAGGCAGAAAATGGAGTGAAATGGACAAGTGGTGAGAAGCGCATCAGGCAAATCCAGCCCAGGAAAGCGCGACAG
TTGCGCGTGAATGCTGCTTCCGCAGCCGTGGCGGAGGCTGTTGATGATGGGGAAGGAGAAGGGGAAAGATGCGAT
CAAAGGCAGGAGCACAAGCAAGCAGCAGAAGCAGCAGCAGCAGCAGAAGCAGCAGAAGCAGCAGAAGCAACAAAA
GCAACAACACACACAAGCCAACAAGACGAGCAAAAGACAGGCGGCGACGACGACGAAGGCTTCTTCTTCCCCCTC
TCGCCAATGCAGCAACTCTTCTTCCGCACAACTGTCGCTCGCAGCATCGAGGCGGCGTGCGTGGCAGGCACCGGC
TTTCGCTTTAGCCAAAGCATTTTGTTGCGAGTCCGAGGCAACATTCCTCTGGCCGACATTGAGGCTGCAGTTGCC
CATCTTGTGGCCCGGCACTCGATGCTACGAGCCCACTTCCGCCTGACGCCTGGCGGCTGGGCTCAGACCATGGCC
TCGGCCGCCACGGGCAAGTCGCACCGCTTTGAGCATCGCTATGCAGCAGCCGAGTTGCATGTCCTGGCGGCCATG
GAGCAGGCTCGCCGCTCTCTCAATCTCTTCAATGGTCCCGTCTTTGCTGCCGAGCACATGCGCACCGCCGACAAT
TCGCAGCTTCTCTTTCTCGTCGCCCATCACCTTGTCGTCGACCTCGCCTCTTGGCGCATTCTGCTGAGCGATTTG
AATATACTGCTGCGTGACGGTGTCCTTGCTTCACCGCTATCCACGCCCTTTACTCATTGGGTAGATCTCCAGAGC
CTTGAGCTCGAAAATCATGGCTCCCCATCTCATGCCTTGGACGTTCCAGACTTGGCTTACTGGCATCTCAGCGGG
CGTTCCAACTGCTACGGCGACACGGAGCAGCTCAACTTCTCTCTTGATACTCATGTCGCCGCCGCTCTTGTTTCA
CGTTGCAATGAGCCGCTGCGAACCCAGCCATCTCATATTCTCATGGCCTCTCTGATTTATTCCTTTAGCCAGGTT
TTCCCCAGCCAGCCTGTACCTATTGTCTGGAACCAAGAGAGTGCTAGAAGCTCCCCTCGAGTCCAAAACACGATT
GGGTGGTTCACAACGTTGTGCCCCGTCCGTGTGCAGGCCGACGCAGAGACGGATCTGATCCAGCTCGTGAGGCTT
GTCAAGGATGCGCACAGAGCGGCTACGCAATCTCACAGCAGTGTCTTCCCTTATGGTGTCGCCCATGCGTCCCAA
CTTTCATCTGTACCTATCCAAGTCATGTTCAATTGTGTGGAAACCTTGCATCAACTGACTCCTCACAATTCGCTC
CTAGAGCCCACCAGATCGCCCGACCGCGACGTTGAAACACTGACCTGCGATGTCGGTCCCCAAGTCGGCCGCATC
TCTCTCTTTGAGATGTCAGTGGTTCTTGATGAGTCTAGTGTACAAGTTGAATTTCTCTTCAACGCTTACACGGCG
CACCAAGATCGCATCATTACCTGGATGAATAATTTTGAGCGTGCAGTGGCTGAAGCTACCGCTCAACTGCTCACT
ATGAAAGCCGAACTAACCCTGGCCGATGCTCCTCTGCTACCAACTTCGTATGAGGCTCTGAAAACGTTTGCATCT
TGTCGACTAGCAGCCCTTGGCCTTACCAGCGTTTCCAATATCGAGTCTATAGGCCCTGTGAGCTCGCTGCAGCAA
GAAATCTTGATCGCGCAGGGCCAAGATCAAAACTGCTATTCTATTAGCTCCACATACGAATTCAAGATTGCCGCT
GGCCTTGAATTCAACCAGACGAGATTATACGAATCGTGGAAGAAGCTCATCGCACGACACGATTGTCTGCGAACC
GTTTTTGCCGACACCATCGCCGACAATGGGCTTTTTGTCAAGGTCCTCCTCAGCAAGGTTTCTCCAGAAATGCTC
TTTTTTGACTCTCCAAATCCCGACAAGACGTTGGCATCAGTCCCGCCCGTCAAGTTTGTTTCATCGCGGCCGCGA
CACCGATTATCCGTGAGTAGATCATCGACTGAGATATATATAAGATTTGATGTCAGCCAGGCTCTCTGCGATATA
TTCACCATCAATCGCTTATTCTCCCAGCTTGAGCATGAATACTCGGCCAGCAACACACGCGGCTATGATGACGTA
CTCAACGAGGTCCCATCCTGTCCTAAGTTTTGCAACACTCATGGTATAGAAGGCTCGGCTGTCATCAAACTTGCC
TGGGGACTCGTCCTCCGCTGTTTTGTGGCCGAGGATAAAGTCTGCTTTGGCTATCAGGTTCAGCGACGCGGCCAA
GATTTACTGAGCAAAGGAGCAGAGCCCCTGGGGTGTTTGGACGCCATTATTGCCAATGTCATTGACTTTTCTAAC
CTGCCCAATGTCGGCCAAGTGCTTTGTGATATTCAAAAACGCTCAATGCGCTCGTATGCCCAGGGTGCACCCCCT
ATCTCGGAGATAGAGCATGCGTTGGGCTTGCATGGCGAGCGCCTCTTCAACACGAGCGTCTCATTTGGAGATTCT
GCCAGGCACGATTTGGATGGCAAGTTTGTATCTGCTACATTTGATGCAAACTGCGACGTCTCTCTTTGTGTCACC
ATGGTCGACGACAAGCTCCACTGCGACATGACCTATCGTGGTCTTACCACTGGACAAGCCGCCAATGTCATGGGC
TGCTTTGAGTGCGCTATTGAAGCCATCATGCATGATCCGCTACAGCCTGTCTCTGATGTCGACTTGTTGACTAAA
GACAAGCTTGAAGAAATTGCAAAGCCGGATTGGAAGAGGGCGCCCGGAGAGTTGTGCGCCTTGATTGACGAAATG
ATTATGCGTCAGGCAAAGCAACAGCCACATGCAACGGCAATTGTAGCTTGGGATGGTGAATTCTCTTACGGGCAG
GTGGATGTATACGTGGAAAAGCTCGCCACCTCTCTGGTCAACCTCGGGGTCAGGCCCGGCATTCTGGTGCCCGTG
GTGCTTGATAAGTGTCGCTGGTCTCCAATAATTATGCTTGCCGTTCTCAAGGCTGGCGCCTGTTTTGTTGCTATC
GACAGCCAAGACGCTTCATCGGCCAAGACTCTCATTAGCCAACTCGATGCGCCCTTGGTTCTTGTTACGGAATCA
GCATGGATGCAAACCAGTCCTCTAGCCAGCAACTGCCTCGTCATTGACCAGGCCAAGCTCGATTTAGTGCCACCG
CAATTAACACTGGGGCTGCACAAGAGATCACCTGAGCAGGCAGCATGTGCTTTTCTGTCCCCTGGTCAGTCTGGG
CCTAAAGGCATGTTTTATACACATCGGTCATTATGCTCTATTATGTCGGCCCAAGGCCCGGTACTGGGTATTGGC
GATGGTAGTCGAGTACTACAGCTGTCTGCCTACAACGTGGACGTTGCTCTGGTGGAGATTTTGGAAACTTTGCTA
CACGGTGGCTGTGTGTGCATTCCGTCTGCCCATGAGCGAATAAATGACCTGCAAGGCGTCATTACACGCATGGGC
GTCACCTGGACGTACATGACTCCTGTATTGGCACGGAAGATGGATCCCACTGCGTTGCCAAACCTCAGGACGGTG
TGCTTCAGGACTAGGAACCTTGACCAGCTAACTTACAGCCCGTGGCTTGATGGCCGAGAGGTTTTGCTTGTATAC
GGAGCGCCCGACATCTGTCCCCTGGCAATTTCCATCAGCAGACTATCAGCGCCAGTCAAGACAGACATTGTAGCC
CCGCCTCTGTTGGGCAGATTTTTGATCTTAAACCCTGAGGATGCGCACAAGATGGCACCGGTTGGAGCAGTGGGA
GAATTGGCAGTCGACAGCAGTGTCATCACACCACACAAGTTCGTTTTGGGTGAGCCTCTTGTTGACCCAGCAAGC
TTGCAAGGACCAACAGGCAAACCAAGATGGCGATATCTAAGGACCAGCCACCGTGCACAGTTCCTCGACAGCGGC
CATGTCCGCTTCCTGGGCAGCGTGAGGGACCAAGCGGGCGTCAATGGATGTGCCACTCTCATCGCCGACGCAGAA
CGGCAAGCTCGTTTATGCCTGCAGCCCAATCAAGACATTATTATTGAGCCTATAACGACGAGCGATGCCATGGAT
CTTCTTGTGGCGTTTATTGACCTTGATGGCGATCTCGGCCTGGGGTCCTATGATCTCAGGTGCTTGGGTCCCGAG
GTAAAGAATAAGCTATTCATGGCAAGAAGGGCTATTGAGTTGGAGCTTGGAAAGAAGAGCAAGATTGGCAAGAAA
TTGCCCTGGCAATGCATCCCAGCAGCCTTTGTGCCGCTTAGGGGGTTTCCTTTGTCGGCGTCACTCAAGGTCAAC
AGGCGCAAATTGCACAAAATGGTGGCCTCCATGTCTTGTTCCCAACTCATGGGGTTAGCTGATGGCCAATACTGT
GGGGGACCAGCAAACGACGTAGCTGGCCAGAAGCCTTGCTTGACGGCTGCACAAGAGTCGATGCAGCGTCTATGG
GCAGGCCTTCTCGGCATTACGGCGGCCAATATCCGACTGGATGACAGTTTTATTGATGCTGGAGGCGATGTATGG
CTGTCTGCACAATTGGCCATCTTGTGCAGACAGAATGGCTATCATGTGTCGGTTCATGACATTGTTGGAGGTGCA
AGCCTCTTGGACATTTGCCATGCTGCCTCGGCCACGATGGATGGCCAAGGAGGCACCACGCCTAGTGGTCAGGGC
CATGGAGATGCCACGACTGCCAGACTGTCAGCAGTAGGGCCCAGGCTGGGCAGCATTTCATACCACGCACTGGTC
AAGCATGTGCTGTCGCCCCAAATAGGAGTTTCTTGGATGCAGGTGATTGGTGCTGCAGCAGTGTCGTCTCAGCAG
ATTGTGTGTCTCGAGTCGAGTCTCTACGCACGGCGTGGAGATGTTTGTTGCTTGATTCTCGACTTCAATGGGCCC
GTCATGTTGCACCGTCTGGAAACAGCTTGCGAGGAACTGACAAGGCTGCACCCAGTGCTTCGGACCGTCTTTGCC
ACTCACGATTGCCGAGCCTATCAGGTTGTCATTGCATCGCTCAAGTTTAGGCTGGCCCACCGCGTATGCGAAGCA
CGTCAGGTCGAGAGCGCCGTTGACGATATTGTGCATGAGGCAAATGTGCTTCCACTGCATCTTAGTCGTGCAATG
ACGCGATTCACCTTTGTTGGGGATGAACAGCGAGGCAAGCTTGTTGTGCAGTTCAGCACGGTGCAGGTCAGCGAG
GCTTGCATTCCACAACTAGTTCATGACCTTGTCCAGCTGTACACGGAGCCTGAGAGGGTATCTGCTAAGCCCACG
TTTCTGGAATACTGTCACGAAGCAAGGCACAATGCTCCCTACAGTGAAGGCATCCAGCACTGGAGAAAGCGGCTG
GCTGGTGCAAGCATGACGCGTATACTGCCGAATCAGAAGCCTCGTGGTCCAGCGGCCAGCATATCGAAGCTGCGC
GAGACGGTGGATGTGTCACCGCTGGCAGACTTGGGCATCGATTTCGAAACGGTGCTCAAGACGGCCTGGGCCCTT
GTATTGGCGACTTTGGCAGGTGGTGACGATGTCGTCTTTGGCCATCTGGTGGGCAGCCAGCGCATGGCGCTCACC
AAGGACAGAATGGATGTAGCGTCCATTGTCGGCCCCATGGAGCGCGTGGTGCCTGTCAGGATTCGGTTTCCCATA
ACACAGACGTCGCCATTGCAAATGATGCTTCAGGTGCAGCGCGACTGTCTGTCATCTCGGCGGTTTGAGCATCTA
GGAGCTCACACCATTATTGGTCAATGTACCGACTGGGCTCGCTGGGCAGGCTTTAGCACTGTCGTTTGCCATGGT
GCTCAGGGGCCCCTTGACGGCTCAACAACACTCAATCTGGGCAACACGACTTTTACCTACCGACTGGCAGAACCC
ATGGCCTGCGCCAGTCCCGACATGCTCGTTTGCTCCATGCCAGTCCATCCAGGGCGTGTGGCTCTCAGCTTGGCA
TATCCGGCAGGACTCGTACCTGTCGATTTTGGTGTCTCCACGATGCGTCTTCTTGTGGGAGCCGTCAAGACGCTG
GCGTGTTATGAGACGGTCAGCGAGCCCATCCTGCCACCATCAAGCGAATACAAGGCTCTGGTGCCAAGGGTGCCC
CTACAAGAATCGCGTCGACGCGACGACGCTGACGAGATGCATCATCTCTCTCACGAGCAGCATCGCGCACTAGGT
GATCTCATCGCGGCGACATGGCGTCAAGTTCTCTTGCCTCAAGGGTGCGGCAATTTGCTGCATCCTCAAGAGCAA
GAGGCTTGCTTCTACGACGTGGCTGGCTGTCTGCTACCGGCGTACATGCTGTCACACCATTTGAACCATGGGCTG
AGCAGACTGGGAATGACGAGCTTTGGCGCCATTACATTGACACCCGAGGACATTATTCGCCATCCTACAATGGCG
GCTCAGCGGAATCTGGTGGCGCGCAAAATGCACAGCTTGGGACTCGCGGCACCAGCGGCCCGGCGAAGGACTTTT
AGCATCATGGGCCATGGCGTATCCGAGGCTATAGCATCGCCCACACAGCACAAGACCACTTCATCTTGGGGCGCT
GAAGCTGCACGTGGCTCATGGCGGGCTCCAAAGACGCGTCACGGCAGCATGAGAGAGCTGGGTTCCCGCGCAGGC
GACTGGATGCGTCACCACGTGAGCATGAGTCGCGACAAGGAGTCGAAATACAACTGGCACAGCGGGCACGAGCAA
TGGCGGCTGCAGCGGCACCAGAGCCAGCAGCCGGCTGCGCTCGTGCTCGATGACGTGAGCCCTCTGAGTAGCTCA
TCGCCGGGAGGGGCGTGGAACAGTCAAAGAGCAGCTGTATCTCCATTGTGCAACCCTTGCCTCAACCATGCCTAC
ATGTAG
Gene >OphauB2|7977
ATGAGCCTTGGCAAGGAAGAAGAGGCTACAGAAAGCATCCATGCCGAGCCCAACCGCATCAGTAATGACGATATG
CTCTCCGCTATAGATACTTGTGCTGCAACCTTTCTCAGCAGTGAAAGTGAATCTAGCAGTCTGCTACAGCCATCA
ACGAGGCAAAACAGTCAGCGAAATAGCACGTACCAGCAACTAGAAGATCTGTTGCTATCCACGTCCAAGGTTGAA
CGCGTTCTTGCCATAACGCCAAGGGCAGGTTCCTTTGAGGGGCAACTCGTTGTTCTTGTGGCTCCAGTCACAAAG
CCGCCTCAGGGCCGTTCCGAGTTGTCCCCAAACCAAGAGCTGCACCTAGTGCCGCCCCGCGAACACGAGCCGGAC
CGGCAGCTGATCCAAGAACTGCGCACTGTAGTCATGGAATGGGGAGGCACATTGCCACGGCCCGACGTATGGGTG
CTGGTGCAAAGATTGGCGTGTGATGTGCGGCATGCGCAGACATGGGTGCAGAATATGACGGAGCATGTTGTGGAG
CGCGTCATGATGATGCAGCCGCCACAGCCAAGACAAAGGCATTGTGGCTCGCAGAGTGGGAAAAAGACGTGTGAC
GAGGCAGAAAATGGAGTGAAATGGACAAGTGGTGAGAAGCGCATCAGGCAAATCCAGCCCAGGAAAGCGCGACAG
TTGCGCGTGAATGCTGCTTCCGCAGCCGTGGCGGAGGCTGTTGATGATGGGGAAGGAGAAGGGGAAAGATGCGAT
CAAAGGCAGGAGCACAAGCAAGCAGCAGAAGCAGCAGCAGCAGCAGAAGCAGCAGAAGCAGCAGAAGCAACAAAA
GCAACAACACACACAAGCCAACAAGACGAGCAAAAGACAGGCGGCGACGACGACGAAGGCTTCTTCTTCCCCCTC
TCGCCAATGCAGCAACTCTTCTTCCGCACAACTGTCGCTCGCAGCATCGAGGCGGCGTGCGTGGCAGGCACCGGC
TTTCGCTTTAGCCAAAGCATTTTGTTGCGAGTCCGAGGCAACATTCCTCTGGCCGACATTGAGGCTGCAGTTGCC
CATCTTGTGGCCCGGCACTCGATGCTACGAGCCCACTTCCGCCTGACGCCTGGCGGCTGGGCTCAGACCATGGCC
TCGGCCGCCACGGGCAAGTCGCACCGCTTTGAGCATCGCTATGCAGCAGCCGAGTTGCATGTCCTGGCGGCCATG
GAGCAGGCTCGCCGCTCTCTCAATCTCTTCAATGGTCCCGTCTTTGCTGCCGAGCACATGCGCACCGCCGACAAT
TCGCAGCTTCTCTTTCTCGTCGCCCATCACCTTGTCGTCGACCTCGCCTCTTGGCGCATTCTGCTGAGCGATTTG
AATATACTGCTGCGTGACGGTGTCCTTGCTTCACCGCTATCCACGCCCTTTACTCATTGGGTAGATCTCCAGAGC
CTTGAGCTCGAAAATCATGGCTCCCCATCTCATGCCTTGGACGTTCCAGACTTGGCTTACTGGCATCTCAGCGGG
CGTTCCAACTGCTACGGCGACACGGAGCAGCTCAACTTCTCTCTTGATACTCATGTCGCCGCCGCTCTTGTTTCA
CGTTGCAATGAGCCGCTGCGAACCCAGCCATCTCATATTCTCATGGCCTCTCTGATTTATTCCTTTAGCCAGGTT
TTCCCCAGCCAGCCTGTACCTATTGTCTGGAACCAAGAGAGTGCTAGAAGCTCCCCTCGAGTCCAAAACACGATT
GGGTGGTTCACAACGTTGTGCCCCGTCCGTGTGCAGGCCGACGCAGAGACGGATCTGATCCAGCTCGTGAGGCTT
GTCAAGGATGCGCACAGAGCGGCTACGCAATCTCACAGCAGTGTCTTCCCTTATGGTGTCGCCCATGCGTCCCAA
CTTTCATCTGTACCTATCCAAGTCATGTTCAATTGTGTGGAAACCTTGCATCAACTGACTCCTCACAATTCGCTC
CTAGAGCCCACCAGATCGCCCGACCGCGACGTTGAAACACTGACCTGCGATGTCGGTCCCCAAGTCGGCCGCATC
TCTCTCTTTGAGATGTCAGTGGTTCTTGATGAGTCTAGTGTACAAGTTGAATTTCTCTTCAACGCTTACACGGCG
CACCAAGATCGCATCATTACCTGGATGAATAATTTTGAGCGTGCAGTGGCTGAAGCTACCGCTCAACTGCTCACT
ATGAAAGCCGAACTAACCCTGGCCGATGCTCCTCTGCTACCAACTTCGTATGAGGCTCTGAAAACGTTTGCATCT
TGTCGACTAGCAGCCCTTGGCCTTACCAGCGTTTCCAATATCGAGTCTATAGGCCCTGTGAGCTCGCTGCAGCAA
GAAATCTTGATCGCGCAGGGCCAAGATCAAAACTGCTATTCTATTAGCTCCACATACGAATTCAAGATTGCCGCT
GGCCTTGAATTCAACCAGACGAGATTATACGAATCGTGGAAGAAGCTCATCGCACGACACGATTGTCTGCGAACC
GTTTTTGCCGACACCATCGCCGACAATGGGCTTTTTGTCAAGGTCCTCCTCAGCAAGGTTTCTCCAGAAATGCTC
TTTTTTGACTCTCCAAATCCCGACAAGACGTTGGCATCAGTCCCGCCCGTCAAGTTTGTTTCATCGCGGCCGCGA
CACCGATTATCCGTGAGTAGATCATCGACTGAGATATATATAAGATTTGATGTCAGCCAGGCTCTCTGCGATGCA
AGTCTCATCATCTTCTAGCTTTATTTTTATCATTCTAACATTGGTTTGTAGATATTCACCATCAATCGCTTATTC
TCCCAGCTTGAGCATGAATACTCGGCCAGCAACACACGCGGCTATGATGACGTACTCAACGAGGTCCCATCCTGT
CCTGTCAGTAACCCCCCGCTACTGGGTGCCTGGATAGCCGATTTGTCAGGAGCAAGGCCATGCATCTTTCCACGC
CTCGTGCGACAAGAGACGAGGCGACTACATGTTCAAGCTTTCAACCTTGCTACCAGCCGTCTAAGCCTTCAGAAG
TTTTGCAACACTCATGGTATAGAAGGCTCGGCTGTCATCAAACTTGCCTGGGGACTCGTCCTCCGCTGTTTTGTG
GCCGAGGATAAAGTCTGCTTTGGCTATCAGGTTCAGCGACGCGGCCAAGATTTACTGAGCAAAGGAGCAGAGCCC
CTGGGGTGTTTGGACGCCATTATTGCCAATGTCATTGACTTTTCTAACCTGCCCAATGTCGGCCAAGTGCTTTGT
GATATTCAAAAACGCTCAATGCGCTCGTATGCCCAGGGTGCACCCCCTATCTCGGAGATAGAGCATGCGTTGGGC
TTGCATGGCGAGCGCCTCTTCAACACGAGCGTCTCATTTGGAGATTCTGCCAGGCACGATTTGGATGGCAAGTTT
GTATCTGCTACATTTGATGCAAACTGCGACGTCTCTCTTTGTGTCACCATGGTCGACGACAAGCTCCACTGCGAC
ATGACCTATCGTGGTCTTACCACTGGACAAGCCGCCAATGTCATGGGCTGCTTTGAGTGCGCTATTGAAGCCATC
ATGCATGATCCGCTACAGCCTGTCTCTGATGTCGACTTGTTGACTAAAGACAAGCTTGAAGAAATTGCAAAGCCG
GATTGGAAGAGGGCGCCCGGAGAGTTGTGCGCCTTGATTGACGAAATGATTATGCGTCAGGCAAAGCAACAGCCA
CATGCAACGGCAATTGTAGCTTGGGATGGTGAATTCTCTTACGGGCAGGTGGATGTATACGTGGAAAAGCTCGCC
ACCTCTCTGGTCAACCTCGGGGTCAGGCCCGGCATTCTGGTGCCCGTGGTGCTTGATAAGTGTCGCTGGTCTCCA
ATAATTATGCTTGCCGTTCTCAAGGCTGGCGCCTGTTTTGTTGCTATCGACAGCCAAGACGCTTCATCGGCCAAG
ACTCTCATTAGCCAACTCGATGCGCCCTTGGTTCTTGTTACGGAATCAGCATGGATGCAAACCAGTCCTCTAGCC
AGCAACTGCCTCGTCATTGACCAGGCCAAGCTCGATTTAGTGCCACCGCAATTAACACTGGGGCTGCACAAGAGA
TCACCTGAGCAGGCAGCATGTGCTTTTCTGTCCCCTGGTCAGTCTGGGCCTAAAGGCATGTTTTATACACATCGG
TCATTATGCTCTATTATGTCGGCCCAAGGCCCGGTACTGGGTATTGGCGATGGTAGTCGAGTACTACAGCTGTCT
GCCTACAACGTGGACGTTGCTCTGGTGGAGATTTTGGAAACTTTGCTACACGGTGGCTGTGTGTGCATTCCGTCT
GCCCATGAGCGAATAAATGACCTGCAAGGCGTCATTACACGCATGGGCGTCACCTGGACGTACATGACTCCTGTA
TTGGCACGGAAGATGGATCCCACTGCGTTGCCAAACCTCAGGACGGTGTGCTTCAGGACTAGGAACCTTGACCAG
CTAACTTACAGCCCGTGGCTTGATGGCCGAGAGGTTTTGCTTGTATACGGAGCGCCCGACATCTGTCCCCTGGCA
ATTTCCATCAGCAGACTATCAGCGCCAGTCAAGACAGACATTGTAGCCCCGCCTCTGTTGGGCAGATTTTTGATC
TTAAACCCTGAGGATGCGCACAAGATGGCACCGGTTGGAGCAGTGGGAGAATTGGCAGTCGACAGCAGTGTCATC
ACACCACACAAGTTCGTTTTGGGTGAGCCTCTTGTTGACCCAGCAAGCTTGCAAGGACCAACAGGCAAACCAAGA
TGGCGATATCTAAGGACCAGCCACCGTGCACAGTTCCTCGACAGCGGCCATGTCCGCTTCCTGGGCAGCGTGAGG
GACCAAGCGGGCGTCAATGGATGTGCCACTCTCATCGCCGACGCAGAACGGCAAGCTCGTTTATGCCTGCAGCCC
AATCAAGACATTATTATTGAGCCTATAACGACGAGCGATGCCATGGATCTTCTTGTGGCGTTTATTGACCTTGAT
GGCGATCTCGGCCTGGGGTCCTATGATCTCAGGTGCTTGGGTCCCGAGGTAAAGAATAAGCTATTCATGGCAAGA
AGGGCTATTGAGTTGGAGCTTGGAAAGAAGAGCAAGATTGGCAAGAAATTGCCCTGGCAATGCATCCCAGCAGCC
TTTGTGCCGCTTAGGGGGTTTCCTTTGTCGGCGTCACTCAAGGTCAACAGGCGCAAATTGCACAAAATGGTGGCC
TCCATGTCTTGTTCCCAACTCATGGGGTTAGCTGATGGCCAATACTGTGGGGGACCAGCAAACGACGTAGCTGGC
CAGAAGCCTTGCTTGACGGCTGCACAAGAGTCGATGCAGCGTCTATGGGCAGGCCTTCTCGGCATTACGGCGGCC
AATATCCGACTGGATGACAGTTTTATTGATGCTGGAGGCGATGTATGGCTGTCTGCACAATTGGCCATCTTGTGC
AGACAGAATGGCTATCATGTGTCGGTTCATGACATTGTTGGAGGTGCAAGCCTCTTGGACATTTGCCATGCTGCC
TCGGCCACGATGGATGGCCAAGGAGGCACCACGCCTAGTGGTCAGGGCCATGGAGATGCCACGACTGCCAGACTG
TCAGCAGTAGGGCCCAGGCTGGGCAGCATTTCATACCACGCACTGGTCAAGCATGTGCTGTCGCCCCAAATAGGA
GTTTCTTGGATGCAGGTGATTGGTGCTGCAGCAGTGTCGTCTCAGCAGATTGTGTGTCTCGAGTCGAGTCTCTAC
GCACGGCGTGGAGATGTTTGTTGCTTGATTCTCGACTTCAATGGGCCCGTCATGTTGCACCGTCTGGAAACAGCT
TGCGAGGAACTGACAAGGCTGCACCCAGTGCTTCGGACCGTCTTTGCCACTCACGATTGCCGAGCCTATCAGGTT
GTCATTGCATCGCTCAAGTTTAGGCTGGCCCACCGCGTATGCGAAGCACGTCAGGTCGAGAGCGCCGTTGACGAT
ATTGTGCATGAGGCAAATGTGCTTCCACTGCATCTTAGTCGTGCAATGACGCGATTCACCTTTGTTGGGGATGAA
CAGCGAGGCAAGCTTGTTGTGCAGTTCAGCACGGTGCAGGTCAGCGAGGCTTGCATTCCACAACTAGTTCATGAC
CTTGTCCAGCTGTACACGGAGCCTGAGAGGGTATCTGCTAAGCCCACGTTTCTGGAATACTGTCACGAAGCAAGG
CACAATGCTCCCTACAGTGAAGGCATCCAGCACTGGAGAAAGCGGCTGGCTGGTGCAAGCATGACGCGTATACTG
CCGAATCAGAAGCCTCGTGGTCCAGCGGCCAGCATATCGAAGCTGCGCGAGACGGTGGATGTGTCACCGCTGGCA
GACTTGGGCATCGATTTCGAAACGGTGCTCAAGACGGCCTGGGCCCTTGTATTGGCGACTTTGGCAGGTGGTGAC
GATGTCGTCTTTGGCCATCTGGTGGGCAGCCAGCGCATGGCGCTCACCAAGGACAGAATGGATGTAGCGTCCATT
GTCGGCCCCATGGAGCGCGTGGTGCCTGTCAGGATTCGGTTTCCCATAACACAGACGTCGCCATTGCAAATGATG
CTTCAGGTGCAGCGCGACTGTCTGTCATCTCGGCGGTTTGAGCATCTAGGAGCTCACACCATTATTGGTCAATGT
ACCGACTGGGCTCGCTGGGCAGGCTTTAGCACTGTCGTTTGCCATGGTGCTCAGGGGCCCCTTGACGGCTCAACA
ACACTCAATCTGGGCAACACGACTTTTACCTACCGACTGGCAGAACCCATGGCCTGCGCCAGTCCCGACATGCTC
GTTTGCTCCATGCCAGTCCATCCAGGGCGTGTGGCTCTCAGCTTGGCATATCCGGCAGGACTCGTACCTGTCGAT
TTTGGTGTCTCCACGATGCGTCTTCTTGTGGGAGCCGTCAAGACGCTGGCGTGTTATGAGACGGTCAGCGAGCCC
ATCCTGCCACCATCAAGCGAATACAAGGCTCTGGTGCCAAGGGTGCCCCTACAAGAATCGCGTCGACGCGACGAC
GCTGACGAGATGCATCATCTCTCTCACGAGCAGCATCGCGCACTAGGTGATCTCATCGCGGCGACATGGCGTCAA
GTTCTCTTGCCTCAAGGGTGCGGCAATTTGCTGCATCCTCAAGAGCAAGAGGCTTGCTTCTACGACGTGGCTGGC
TGTCTGCTACCGGCGTACATGCTGTCACACCATTTGAACCATGGGCTGAGCAGACTGGGAATGACGAGCTTTGGC
GCCATTACATTGACACCCGAGGACATTATTCGCCATCCTACAATGGCGGCTCAGCGGAATCTGGTGGCGCGCAAA
ATGCACAGCTTGGGACTCGCGGCACCAGCGGCCCGGCGAAGGACTTTTAGCATCATGGGCCATGGCGTATCCGAG
GCTATAGCATCGCCCACACAGCACAAGACCACTTCATCTTGGGGCGCTGAAGCTGCACGTGGCTCATGGCGGGCT
CCAAAGACGCGTCACGGCAGCATGAGAGAGCTGGGTTCCCGCGCAGGCGACTGGATGCGTCACCACGTGAGCATG
AGTCGCGACAAGGAGTCGAAATACAACTGGCACAGCGGGCACGAGCAATGGCGGCTGCAGCGGCACCAGAGCCAG
CAGCCGGCTGCGCTCGTGCTCGATGACGTGAGCCCTCTGAGTAGCTCATCGCCGGGAGGGGCGTGGAACAGTCAA
AGAGCAGCTGTATCTCCATTGTGCAACCCTTGCCTCAACCATGCCTACATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail