Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7977
Gene name
LocationContig_92:14931..22635
Strand-
Gene length (bp)7704
Transcript length (bp)7506
Coding sequence length (bp)7506
Protein length (aa) 2502

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00668 Condensation Condensation domain 4.8E-28 327 733
PF00668 Condensation Condensation domain 1.1E-07 934 1130
PF00668 Condensation Condensation domain 1.1E-16 1843 2136
PF00501 AMP-binding AMP-binding enzyme 1.7E-24 1153 1483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 274 2149 7.0E-178
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 298 2095 5.0E-127
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 298 1484 2.0E-125
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 934 2124 7.0E-84
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 757 2156 8.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 274 2149 7.0E-178
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 298 2095 5.0E-127
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 298 1484 2.0E-125
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 934 2124 7.0E-84
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 757 2156 8.0E-83
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 63 914 3.0E-78
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 934 2125 8.0E-75
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 764 2167 5.0E-73
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 764 2153 8.0E-73
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 764 2167 6.0E-72
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1107 2130 3.0E-67
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 771 1746 2.0E-64
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 762 1759 1.0E-61
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 292 844 1.0E-59
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1083 2130 2.0E-59
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1116 1752 7.0E-58
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 940 1755 8.0E-56
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1132 2118 7.0E-55
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1132 1746 1.0E-54
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1070 1755 2.0E-54
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 273 924 5.0E-54
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1102 1746 6.0E-54
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1117 1746 2.0E-53
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 298 974 3.0E-53
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1135 2118 7.0E-52
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1132 1753 2.0E-51
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 944 1752 5.0E-51
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1147 1911 7.0E-51
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1147 2147 3.0E-48
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1137 2115 2.0E-47
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 945 1752 8.0E-41
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1137 2157 4.0E-38
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1131 2079 5.0E-36
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1128 1769 3.0E-34
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 342 712 3.0E-31
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1394 2149 2.0E-30
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 950 1758 2.0E-30
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1689 2405 2.0E-30
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 935 2086 5.0E-30
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 935 2020 4.0E-29
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 985 1775 8.0E-29
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1006 2134 7.0E-27
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1109 1756 8.0E-26
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 1006 2124 9.0E-26
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 934 1654 2.0E-25
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 946 2064 3.0E-25
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1077 1731 3.0E-25
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 950 1780 3.0E-25
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1066 1550 7.0E-25
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 935 1654 1.0E-24
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1137 1723 1.0E-24
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 935 1736 4.0E-24
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 934 2015 7.0E-24
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 934 2064 8.0E-24
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1006 2124 1.0E-23
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1008 1722 2.0E-23
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1008 1722 2.0E-23
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1066 2095 3.0E-23
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 256 827 8.0E-23
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 934 1722 8.0E-23
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1149 2000 9.0E-23
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 770 1764 1.0E-22
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1102 1775 1.0E-22
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 913 1743 1.0E-22
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 902 2064 2.0E-22
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1147 1743 4.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 950 1770 7.0E-22
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 974 1746 9.0E-22
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 950 1737 1.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 934 1739 1.0E-21
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 946 1755 2.0E-21
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1066 2095 2.0E-21
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1102 1722 3.0E-21
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 936 1761 3.0E-20
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1172 1747 5.0E-20
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 944 1730 5.0E-20
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 950 1769 5.0E-20
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1147 1771 5.0E-20
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 934 1743 6.0E-20
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1147 1771 7.0E-20
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 944 1758 1.0E-19
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1149 1742 2.0E-19
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 256 827 2.0E-19
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 946 1722 2.0E-19
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1066 1731 5.0E-19
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1066 1722 7.0E-19
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1102 1756 1.0E-18
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1060 2136 2.0E-18
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 946 1746 2.0E-18
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1008 1654 2.0E-18
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1056 1736 2.0E-18
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1040 1752 2.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 251 779 3.0E-18
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 921 1722 3.0E-18
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1147 2149 4.0E-18
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1109 1722 4.0E-18
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 946 1654 4.0E-18
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1040 1752 5.0E-18
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1170 1746 5.0E-18
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 935 1737 1.0E-17
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 934 1746 2.0E-17
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 1150 1752 3.0E-17
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 1102 1722 6.0E-17
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 939 1722 9.0E-17
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1066 1743 2.0E-16
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1106 2124 2.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1171 2139 8.0E-16
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 286 716 9.0E-16
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 936 1756 2.0E-15
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1106 1746 3.0E-15
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1106 1746 4.0E-15
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 944 1722 6.0E-15
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1146 2020 1.0E-14
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 944 2124 2.0E-14
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 298 827 2.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 256 827 4.0E-14
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1117 1731 4.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 300 827 5.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1171 1762 5.0E-14
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1147 1731 5.0E-14
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1149 1723 2.0E-13
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 301 716 2.0E-13
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1145 1747 2.0E-13
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1855 2149 5.0E-13
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1065 1746 6.0E-13
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1154 1746 7.0E-13
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1116 1752 3.0E-12
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1069 1541 3.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1843 2149 8.0E-12
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 423 832 1.0E-11
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1142 1426 2.0E-11
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 404 620 3.0E-11
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 936 2105 3.0E-11
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 300 606 5.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1157 1752 7.0E-11
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 946 1654 1.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 300 606 2.0E-10
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 300 606 2.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1197 1748 2.0E-10
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 936 1757 3.0E-10
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 300 607 5.0E-10
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 936 1757 5.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 300 606 8.0E-10
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 299 764 8.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 300 606 1.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 946 1722 1.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 946 1722 1.0E-09
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1172 1747 2.0E-09
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1146 1363 9.0E-09
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1146 1363 9.0E-09
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1169 1752 2.0E-08
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 345 606 3.0E-08
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 345 606 3.0E-08
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1146 1756 4.0E-08
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1151 1363 5.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1844 2126 7.0E-08
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 293 653 7.0E-08
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 299 716 9.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 299 643 1.0E-07
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1112 1551 2.0E-07
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1112 1551 3.0E-07
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1106 1551 3.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1145 1363 4.0E-07
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 338 606 6.0E-07
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 994 1383 1.0E-06
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1840 2103 2.0E-06
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 299 606 3.0E-06
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1287 1541 5.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1851 2125 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7977
MSLGKEEEATESIHAEPNRISNDDMLSAIDTCAATFLSSESESSSLLQPSTRQNSQRNSTYQQLEDLLLSTSKVE
RVLAITPRAGSFEGQLVVLVAPVTKPPQGRSELSPNQELHLVPPREHEPDRQLIQELRTVVMEWGGTLPRPDVWV
LVQRLACDVRHAQTWVQNMTEHVVERVMMMQPPQPRQRHCGSQSGKKTCDEAENGVKWTSGEKRIRQIQPRKARQ
LRVNAASAAVAEAVDDGEGEGERCDQRQEHKQAAEAAAAAEAAEAAEATKATTHTSQQDEQKTGGDDDEGFFFPL
SPMQQLFFRTTVARSIEAACVAGTGFRFSQSILLRVRGNIPLADIEAAVAHLVARHSMLRAHFRLTPGGWAQTMA
SAATGKSHRFEHRYAAAELHVLAAMEQARRSLNLFNGPVFAAEHMRTADNSQLLFLVAHHLVVDLASWRILLSDL
NILLRDGVLASPLSTPFTHWVDLQSLELENHGSPSHALDVPDLAYWHLSGRSNCYGDTEQLNFSLDTHVAAALVS
RCNEPLRTQPSHILMASLIYSFSQVFPSQPVPIVWNQESARSSPRVQNTIGWFTTLCPVRVQADAETDLIQLVRL
VKDAHRAATQSHSSVFPYGVAHASQLSSVPIQVMFNCVETLHQLTPHNSLLEPTRSPDRDVETLTCDVGPQVGRI
SLFEMSVVLDESSVQVEFLFNAYTAHQDRIITWMNNFERAVAEATAQLLTMKAELTLADAPLLPTSYEALKTFAS
CRLAALGLTSVSNIESIGPVSSLQQEILIAQGQDQNCYSISSTYEFKIAAGLEFNQTRLYESWKKLIARHDCLRT
VFADTIADNGLFVKVLLSKVSPEMLFFDSPNPDKTLASVPPVKFVSSRPRHRLSVSRSSTEIYIRFDVSQALCDI
FTINRLFSQLEHEYSASNTRGYDDVLNEVPSCPKFCNTHGIEGSAVIKLAWGLVLRCFVAEDKVCFGYQVQRRGQ
DLLSKGAEPLGCLDAIIANVIDFSNLPNVGQVLCDIQKRSMRSYAQGAPPISEIEHALGLHGERLFNTSVSFGDS
ARHDLDGKFVSATFDANCDVSLCVTMVDDKLHCDMTYRGLTTGQAANVMGCFECAIEAIMHDPLQPVSDVDLLTK
DKLEEIAKPDWKRAPGELCALIDEMIMRQAKQQPHATAIVAWDGEFSYGQVDVYVEKLATSLVNLGVRPGILVPV
VLDKCRWSPIIMLAVLKAGACFVAIDSQDASSAKTLISQLDAPLVLVTESAWMQTSPLASNCLVIDQAKLDLVPP
QLTLGLHKRSPEQAACAFLSPGQSGPKGMFYTHRSLCSIMSAQGPVLGIGDGSRVLQLSAYNVDVALVEILETLL
HGGCVCIPSAHERINDLQGVITRMGVTWTYMTPVLARKMDPTALPNLRTVCFRTRNLDQLTYSPWLDGREVLLVY
GAPDICPLAISISRLSAPVKTDIVAPPLLGRFLILNPEDAHKMAPVGAVGELAVDSSVITPHKFVLGEPLVDPAS
LQGPTGKPRWRYLRTSHRAQFLDSGHVRFLGSVRDQAGVNGCATLIADAERQARLCLQPNQDIIIEPITTSDAMD
LLVAFIDLDGDLGLGSYDLRCLGPEVKNKLFMARRAIELELGKKSKIGKKLPWQCIPAAFVPLRGFPLSASLKVN
RRKLHKMVASMSCSQLMGLADGQYCGGPANDVAGQKPCLTAAQESMQRLWAGLLGITAANIRLDDSFIDAGGDVW
LSAQLAILCRQNGYHVSVHDIVGGASLLDICHAASATMDGQGGTTPSGQGHGDATTARLSAVGPRLGSISYHALV
KHVLSPQIGVSWMQVIGAAAVSSQQIVCLESSLYARRGDVCCLILDFNGPVMLHRLETACEELTRLHPVLRTVFA
THDCRAYQVVIASLKFRLAHRVCEARQVESAVDDIVHEANVLPLHLSRAMTRFTFVGDEQRGKLVVQFSTVQVSE
ACIPQLVHDLVQLYTEPERVSAKPTFLEYCHEARHNAPYSEGIQHWRKRLAGASMTRILPNQKPRGPAASISKLR
ETVDVSPLADLGIDFETVLKTAWALVLATLAGGDDVVFGHLVGSQRMALTKDRMDVASIVGPMERVVPVRIRFPI
TQTSPLQMMLQVQRDCLSSRRFEHLGAHTIIGQCTDWARWAGFSTVVCHGAQGPLDGSTTLNLGNTTFTYRLAEP
MACASPDMLVCSMPVHPGRVALSLAYPAGLVPVDFGVSTMRLLVGAVKTLACYETVSEPILPPSSEYKALVPRVP
LQESRRRDDADEMHHLSHEQHRALGDLIAATWRQVLLPQGCGNLLHPQEQEACFYDVAGCLLPAYMLSHHLNHGL
SRLGMTSFGAITLTPEDIIRHPTMAAQRNLVARKMHSLGLAAPAARRRTFSIMGHGVSEAIASPTQHKTTSSWGA
EAARGSWRAPKTRHGSMRELGSRAGDWMRHHVSMSRDKESKYNWHSGHEQWRLQRHQSQQPAALVLDDVSPLSSS
SPGGAWNSQRAAVSPLCNPCLNHAYM*
Coding >OphauB2|7977
ATGAGCCTTGGCAAGGAAGAAGAGGCTACAGAAAGCATCCATGCCGAGCCCAACCGCATCAGTAATGACGATATG
CTCTCCGCTATAGATACTTGTGCTGCAACCTTTCTCAGCAGTGAAAGTGAATCTAGCAGTCTGCTACAGCCATCA
ACGAGGCAAAACAGTCAGCGAAATAGCACGTACCAGCAACTAGAAGATCTGTTGCTATCCACGTCCAAGGTTGAA
CGCGTTCTTGCCATAACGCCAAGGGCAGGTTCCTTTGAGGGGCAACTCGTTGTTCTTGTGGCTCCAGTCACAAAG
CCGCCTCAGGGCCGTTCCGAGTTGTCCCCAAACCAAGAGCTGCACCTAGTGCCGCCCCGCGAACACGAGCCGGAC
CGGCAGCTGATCCAAGAACTGCGCACTGTAGTCATGGAATGGGGAGGCACATTGCCACGGCCCGACGTATGGGTG
CTGGTGCAAAGATTGGCGTGTGATGTGCGGCATGCGCAGACATGGGTGCAGAATATGACGGAGCATGTTGTGGAG
CGCGTCATGATGATGCAGCCGCCACAGCCAAGACAAAGGCATTGTGGCTCGCAGAGTGGGAAAAAGACGTGTGAC
GAGGCAGAAAATGGAGTGAAATGGACAAGTGGTGAGAAGCGCATCAGGCAAATCCAGCCCAGGAAAGCGCGACAG
TTGCGCGTGAATGCTGCTTCCGCAGCCGTGGCGGAGGCTGTTGATGATGGGGAAGGAGAAGGGGAAAGATGCGAT
CAAAGGCAGGAGCACAAGCAAGCAGCAGAAGCAGCAGCAGCAGCAGAAGCAGCAGAAGCAGCAGAAGCAACAAAA
GCAACAACACACACAAGCCAACAAGACGAGCAAAAGACAGGCGGCGACGACGACGAAGGCTTCTTCTTCCCCCTC
TCGCCAATGCAGCAACTCTTCTTCCGCACAACTGTCGCTCGCAGCATCGAGGCGGCGTGCGTGGCAGGCACCGGC
TTTCGCTTTAGCCAAAGCATTTTGTTGCGAGTCCGAGGCAACATTCCTCTGGCCGACATTGAGGCTGCAGTTGCC
CATCTTGTGGCCCGGCACTCGATGCTACGAGCCCACTTCCGCCTGACGCCTGGCGGCTGGGCTCAGACCATGGCC
TCGGCCGCCACGGGCAAGTCGCACCGCTTTGAGCATCGCTATGCAGCAGCCGAGTTGCATGTCCTGGCGGCCATG
GAGCAGGCTCGCCGCTCTCTCAATCTCTTCAATGGTCCCGTCTTTGCTGCCGAGCACATGCGCACCGCCGACAAT
TCGCAGCTTCTCTTTCTCGTCGCCCATCACCTTGTCGTCGACCTCGCCTCTTGGCGCATTCTGCTGAGCGATTTG
AATATACTGCTGCGTGACGGTGTCCTTGCTTCACCGCTATCCACGCCCTTTACTCATTGGGTAGATCTCCAGAGC
CTTGAGCTCGAAAATCATGGCTCCCCATCTCATGCCTTGGACGTTCCAGACTTGGCTTACTGGCATCTCAGCGGG
CGTTCCAACTGCTACGGCGACACGGAGCAGCTCAACTTCTCTCTTGATACTCATGTCGCCGCCGCTCTTGTTTCA
CGTTGCAATGAGCCGCTGCGAACCCAGCCATCTCATATTCTCATGGCCTCTCTGATTTATTCCTTTAGCCAGGTT
TTCCCCAGCCAGCCTGTACCTATTGTCTGGAACCAAGAGAGTGCTAGAAGCTCCCCTCGAGTCCAAAACACGATT
GGGTGGTTCACAACGTTGTGCCCCGTCCGTGTGCAGGCCGACGCAGAGACGGATCTGATCCAGCTCGTGAGGCTT
GTCAAGGATGCGCACAGAGCGGCTACGCAATCTCACAGCAGTGTCTTCCCTTATGGTGTCGCCCATGCGTCCCAA
CTTTCATCTGTACCTATCCAAGTCATGTTCAATTGTGTGGAAACCTTGCATCAACTGACTCCTCACAATTCGCTC
CTAGAGCCCACCAGATCGCCCGACCGCGACGTTGAAACACTGACCTGCGATGTCGGTCCCCAAGTCGGCCGCATC
TCTCTCTTTGAGATGTCAGTGGTTCTTGATGAGTCTAGTGTACAAGTTGAATTTCTCTTCAACGCTTACACGGCG
CACCAAGATCGCATCATTACCTGGATGAATAATTTTGAGCGTGCAGTGGCTGAAGCTACCGCTCAACTGCTCACT
ATGAAAGCCGAACTAACCCTGGCCGATGCTCCTCTGCTACCAACTTCGTATGAGGCTCTGAAAACGTTTGCATCT
TGTCGACTAGCAGCCCTTGGCCTTACCAGCGTTTCCAATATCGAGTCTATAGGCCCTGTGAGCTCGCTGCAGCAA
GAAATCTTGATCGCGCAGGGCCAAGATCAAAACTGCTATTCTATTAGCTCCACATACGAATTCAAGATTGCCGCT
GGCCTTGAATTCAACCAGACGAGATTATACGAATCGTGGAAGAAGCTCATCGCACGACACGATTGTCTGCGAACC
GTTTTTGCCGACACCATCGCCGACAATGGGCTTTTTGTCAAGGTCCTCCTCAGCAAGGTTTCTCCAGAAATGCTC
TTTTTTGACTCTCCAAATCCCGACAAGACGTTGGCATCAGTCCCGCCCGTCAAGTTTGTTTCATCGCGGCCGCGA
CACCGATTATCCGTGAGTAGATCATCGACTGAGATATATATAAGATTTGATGTCAGCCAGGCTCTCTGCGATATA
TTCACCATCAATCGCTTATTCTCCCAGCTTGAGCATGAATACTCGGCCAGCAACACACGCGGCTATGATGACGTA
CTCAACGAGGTCCCATCCTGTCCTAAGTTTTGCAACACTCATGGTATAGAAGGCTCGGCTGTCATCAAACTTGCC
TGGGGACTCGTCCTCCGCTGTTTTGTGGCCGAGGATAAAGTCTGCTTTGGCTATCAGGTTCAGCGACGCGGCCAA
GATTTACTGAGCAAAGGAGCAGAGCCCCTGGGGTGTTTGGACGCCATTATTGCCAATGTCATTGACTTTTCTAAC
CTGCCCAATGTCGGCCAAGTGCTTTGTGATATTCAAAAACGCTCAATGCGCTCGTATGCCCAGGGTGCACCCCCT
ATCTCGGAGATAGAGCATGCGTTGGGCTTGCATGGCGAGCGCCTCTTCAACACGAGCGTCTCATTTGGAGATTCT
GCCAGGCACGATTTGGATGGCAAGTTTGTATCTGCTACATTTGATGCAAACTGCGACGTCTCTCTTTGTGTCACC
ATGGTCGACGACAAGCTCCACTGCGACATGACCTATCGTGGTCTTACCACTGGACAAGCCGCCAATGTCATGGGC
TGCTTTGAGTGCGCTATTGAAGCCATCATGCATGATCCGCTACAGCCTGTCTCTGATGTCGACTTGTTGACTAAA
GACAAGCTTGAAGAAATTGCAAAGCCGGATTGGAAGAGGGCGCCCGGAGAGTTGTGCGCCTTGATTGACGAAATG
ATTATGCGTCAGGCAAAGCAACAGCCACATGCAACGGCAATTGTAGCTTGGGATGGTGAATTCTCTTACGGGCAG
GTGGATGTATACGTGGAAAAGCTCGCCACCTCTCTGGTCAACCTCGGGGTCAGGCCCGGCATTCTGGTGCCCGTG
GTGCTTGATAAGTGTCGCTGGTCTCCAATAATTATGCTTGCCGTTCTCAAGGCTGGCGCCTGTTTTGTTGCTATC
GACAGCCAAGACGCTTCATCGGCCAAGACTCTCATTAGCCAACTCGATGCGCCCTTGGTTCTTGTTACGGAATCA
GCATGGATGCAAACCAGTCCTCTAGCCAGCAACTGCCTCGTCATTGACCAGGCCAAGCTCGATTTAGTGCCACCG
CAATTAACACTGGGGCTGCACAAGAGATCACCTGAGCAGGCAGCATGTGCTTTTCTGTCCCCTGGTCAGTCTGGG
CCTAAAGGCATGTTTTATACACATCGGTCATTATGCTCTATTATGTCGGCCCAAGGCCCGGTACTGGGTATTGGC
GATGGTAGTCGAGTACTACAGCTGTCTGCCTACAACGTGGACGTTGCTCTGGTGGAGATTTTGGAAACTTTGCTA
CACGGTGGCTGTGTGTGCATTCCGTCTGCCCATGAGCGAATAAATGACCTGCAAGGCGTCATTACACGCATGGGC
GTCACCTGGACGTACATGACTCCTGTATTGGCACGGAAGATGGATCCCACTGCGTTGCCAAACCTCAGGACGGTG
TGCTTCAGGACTAGGAACCTTGACCAGCTAACTTACAGCCCGTGGCTTGATGGCCGAGAGGTTTTGCTTGTATAC
GGAGCGCCCGACATCTGTCCCCTGGCAATTTCCATCAGCAGACTATCAGCGCCAGTCAAGACAGACATTGTAGCC
CCGCCTCTGTTGGGCAGATTTTTGATCTTAAACCCTGAGGATGCGCACAAGATGGCACCGGTTGGAGCAGTGGGA
GAATTGGCAGTCGACAGCAGTGTCATCACACCACACAAGTTCGTTTTGGGTGAGCCTCTTGTTGACCCAGCAAGC
TTGCAAGGACCAACAGGCAAACCAAGATGGCGATATCTAAGGACCAGCCACCGTGCACAGTTCCTCGACAGCGGC
CATGTCCGCTTCCTGGGCAGCGTGAGGGACCAAGCGGGCGTCAATGGATGTGCCACTCTCATCGCCGACGCAGAA
CGGCAAGCTCGTTTATGCCTGCAGCCCAATCAAGACATTATTATTGAGCCTATAACGACGAGCGATGCCATGGAT
CTTCTTGTGGCGTTTATTGACCTTGATGGCGATCTCGGCCTGGGGTCCTATGATCTCAGGTGCTTGGGTCCCGAG
GTAAAGAATAAGCTATTCATGGCAAGAAGGGCTATTGAGTTGGAGCTTGGAAAGAAGAGCAAGATTGGCAAGAAA
TTGCCCTGGCAATGCATCCCAGCAGCCTTTGTGCCGCTTAGGGGGTTTCCTTTGTCGGCGTCACTCAAGGTCAAC
AGGCGCAAATTGCACAAAATGGTGGCCTCCATGTCTTGTTCCCAACTCATGGGGTTAGCTGATGGCCAATACTGT
GGGGGACCAGCAAACGACGTAGCTGGCCAGAAGCCTTGCTTGACGGCTGCACAAGAGTCGATGCAGCGTCTATGG
GCAGGCCTTCTCGGCATTACGGCGGCCAATATCCGACTGGATGACAGTTTTATTGATGCTGGAGGCGATGTATGG
CTGTCTGCACAATTGGCCATCTTGTGCAGACAGAATGGCTATCATGTGTCGGTTCATGACATTGTTGGAGGTGCA
AGCCTCTTGGACATTTGCCATGCTGCCTCGGCCACGATGGATGGCCAAGGAGGCACCACGCCTAGTGGTCAGGGC
CATGGAGATGCCACGACTGCCAGACTGTCAGCAGTAGGGCCCAGGCTGGGCAGCATTTCATACCACGCACTGGTC
AAGCATGTGCTGTCGCCCCAAATAGGAGTTTCTTGGATGCAGGTGATTGGTGCTGCAGCAGTGTCGTCTCAGCAG
ATTGTGTGTCTCGAGTCGAGTCTCTACGCACGGCGTGGAGATGTTTGTTGCTTGATTCTCGACTTCAATGGGCCC
GTCATGTTGCACCGTCTGGAAACAGCTTGCGAGGAACTGACAAGGCTGCACCCAGTGCTTCGGACCGTCTTTGCC
ACTCACGATTGCCGAGCCTATCAGGTTGTCATTGCATCGCTCAAGTTTAGGCTGGCCCACCGCGTATGCGAAGCA
CGTCAGGTCGAGAGCGCCGTTGACGATATTGTGCATGAGGCAAATGTGCTTCCACTGCATCTTAGTCGTGCAATG
ACGCGATTCACCTTTGTTGGGGATGAACAGCGAGGCAAGCTTGTTGTGCAGTTCAGCACGGTGCAGGTCAGCGAG
GCTTGCATTCCACAACTAGTTCATGACCTTGTCCAGCTGTACACGGAGCCTGAGAGGGTATCTGCTAAGCCCACG
TTTCTGGAATACTGTCACGAAGCAAGGCACAATGCTCCCTACAGTGAAGGCATCCAGCACTGGAGAAAGCGGCTG
GCTGGTGCAAGCATGACGCGTATACTGCCGAATCAGAAGCCTCGTGGTCCAGCGGCCAGCATATCGAAGCTGCGC
GAGACGGTGGATGTGTCACCGCTGGCAGACTTGGGCATCGATTTCGAAACGGTGCTCAAGACGGCCTGGGCCCTT
GTATTGGCGACTTTGGCAGGTGGTGACGATGTCGTCTTTGGCCATCTGGTGGGCAGCCAGCGCATGGCGCTCACC
AAGGACAGAATGGATGTAGCGTCCATTGTCGGCCCCATGGAGCGCGTGGTGCCTGTCAGGATTCGGTTTCCCATA
ACACAGACGTCGCCATTGCAAATGATGCTTCAGGTGCAGCGCGACTGTCTGTCATCTCGGCGGTTTGAGCATCTA
GGAGCTCACACCATTATTGGTCAATGTACCGACTGGGCTCGCTGGGCAGGCTTTAGCACTGTCGTTTGCCATGGT
GCTCAGGGGCCCCTTGACGGCTCAACAACACTCAATCTGGGCAACACGACTTTTACCTACCGACTGGCAGAACCC
ATGGCCTGCGCCAGTCCCGACATGCTCGTTTGCTCCATGCCAGTCCATCCAGGGCGTGTGGCTCTCAGCTTGGCA
TATCCGGCAGGACTCGTACCTGTCGATTTTGGTGTCTCCACGATGCGTCTTCTTGTGGGAGCCGTCAAGACGCTG
GCGTGTTATGAGACGGTCAGCGAGCCCATCCTGCCACCATCAAGCGAATACAAGGCTCTGGTGCCAAGGGTGCCC
CTACAAGAATCGCGTCGACGCGACGACGCTGACGAGATGCATCATCTCTCTCACGAGCAGCATCGCGCACTAGGT
GATCTCATCGCGGCGACATGGCGTCAAGTTCTCTTGCCTCAAGGGTGCGGCAATTTGCTGCATCCTCAAGAGCAA
GAGGCTTGCTTCTACGACGTGGCTGGCTGTCTGCTACCGGCGTACATGCTGTCACACCATTTGAACCATGGGCTG
AGCAGACTGGGAATGACGAGCTTTGGCGCCATTACATTGACACCCGAGGACATTATTCGCCATCCTACAATGGCG
GCTCAGCGGAATCTGGTGGCGCGCAAAATGCACAGCTTGGGACTCGCGGCACCAGCGGCCCGGCGAAGGACTTTT
AGCATCATGGGCCATGGCGTATCCGAGGCTATAGCATCGCCCACACAGCACAAGACCACTTCATCTTGGGGCGCT
GAAGCTGCACGTGGCTCATGGCGGGCTCCAAAGACGCGTCACGGCAGCATGAGAGAGCTGGGTTCCCGCGCAGGC
GACTGGATGCGTCACCACGTGAGCATGAGTCGCGACAAGGAGTCGAAATACAACTGGCACAGCGGGCACGAGCAA
TGGCGGCTGCAGCGGCACCAGAGCCAGCAGCCGGCTGCGCTCGTGCTCGATGACGTGAGCCCTCTGAGTAGCTCA
TCGCCGGGAGGGGCGTGGAACAGTCAAAGAGCAGCTGTATCTCCATTGTGCAACCCTTGCCTCAACCATGCCTAC
ATGTAG
Transcript >OphauB2|7977
ATGAGCCTTGGCAAGGAAGAAGAGGCTACAGAAAGCATCCATGCCGAGCCCAACCGCATCAGTAATGACGATATG
CTCTCCGCTATAGATACTTGTGCTGCAACCTTTCTCAGCAGTGAAAGTGAATCTAGCAGTCTGCTACAGCCATCA
ACGAGGCAAAACAGTCAGCGAAATAGCACGTACCAGCAACTAGAAGATCTGTTGCTATCCACGTCCAAGGTTGAA
CGCGTTCTTGCCATAACGCCAAGGGCAGGTTCCTTTGAGGGGCAACTCGTTGTTCTTGTGGCTCCAGTCACAAAG
CCGCCTCAGGGCCGTTCCGAGTTGTCCCCAAACCAAGAGCTGCACCTAGTGCCGCCCCGCGAACACGAGCCGGAC
CGGCAGCTGATCCAAGAACTGCGCACTGTAGTCATGGAATGGGGAGGCACATTGCCACGGCCCGACGTATGGGTG
CTGGTGCAAAGATTGGCGTGTGATGTGCGGCATGCGCAGACATGGGTGCAGAATATGACGGAGCATGTTGTGGAG
CGCGTCATGATGATGCAGCCGCCACAGCCAAGACAAAGGCATTGTGGCTCGCAGAGTGGGAAAAAGACGTGTGAC
GAGGCAGAAAATGGAGTGAAATGGACAAGTGGTGAGAAGCGCATCAGGCAAATCCAGCCCAGGAAAGCGCGACAG
TTGCGCGTGAATGCTGCTTCCGCAGCCGTGGCGGAGGCTGTTGATGATGGGGAAGGAGAAGGGGAAAGATGCGAT
CAAAGGCAGGAGCACAAGCAAGCAGCAGAAGCAGCAGCAGCAGCAGAAGCAGCAGAAGCAGCAGAAGCAACAAAA
GCAACAACACACACAAGCCAACAAGACGAGCAAAAGACAGGCGGCGACGACGACGAAGGCTTCTTCTTCCCCCTC
TCGCCAATGCAGCAACTCTTCTTCCGCACAACTGTCGCTCGCAGCATCGAGGCGGCGTGCGTGGCAGGCACCGGC
TTTCGCTTTAGCCAAAGCATTTTGTTGCGAGTCCGAGGCAACATTCCTCTGGCCGACATTGAGGCTGCAGTTGCC
CATCTTGTGGCCCGGCACTCGATGCTACGAGCCCACTTCCGCCTGACGCCTGGCGGCTGGGCTCAGACCATGGCC
TCGGCCGCCACGGGCAAGTCGCACCGCTTTGAGCATCGCTATGCAGCAGCCGAGTTGCATGTCCTGGCGGCCATG
GAGCAGGCTCGCCGCTCTCTCAATCTCTTCAATGGTCCCGTCTTTGCTGCCGAGCACATGCGCACCGCCGACAAT
TCGCAGCTTCTCTTTCTCGTCGCCCATCACCTTGTCGTCGACCTCGCCTCTTGGCGCATTCTGCTGAGCGATTTG
AATATACTGCTGCGTGACGGTGTCCTTGCTTCACCGCTATCCACGCCCTTTACTCATTGGGTAGATCTCCAGAGC
CTTGAGCTCGAAAATCATGGCTCCCCATCTCATGCCTTGGACGTTCCAGACTTGGCTTACTGGCATCTCAGCGGG
CGTTCCAACTGCTACGGCGACACGGAGCAGCTCAACTTCTCTCTTGATACTCATGTCGCCGCCGCTCTTGTTTCA
CGTTGCAATGAGCCGCTGCGAACCCAGCCATCTCATATTCTCATGGCCTCTCTGATTTATTCCTTTAGCCAGGTT
TTCCCCAGCCAGCCTGTACCTATTGTCTGGAACCAAGAGAGTGCTAGAAGCTCCCCTCGAGTCCAAAACACGATT
GGGTGGTTCACAACGTTGTGCCCCGTCCGTGTGCAGGCCGACGCAGAGACGGATCTGATCCAGCTCGTGAGGCTT
GTCAAGGATGCGCACAGAGCGGCTACGCAATCTCACAGCAGTGTCTTCCCTTATGGTGTCGCCCATGCGTCCCAA
CTTTCATCTGTACCTATCCAAGTCATGTTCAATTGTGTGGAAACCTTGCATCAACTGACTCCTCACAATTCGCTC
CTAGAGCCCACCAGATCGCCCGACCGCGACGTTGAAACACTGACCTGCGATGTCGGTCCCCAAGTCGGCCGCATC
TCTCTCTTTGAGATGTCAGTGGTTCTTGATGAGTCTAGTGTACAAGTTGAATTTCTCTTCAACGCTTACACGGCG
CACCAAGATCGCATCATTACCTGGATGAATAATTTTGAGCGTGCAGTGGCTGAAGCTACCGCTCAACTGCTCACT
ATGAAAGCCGAACTAACCCTGGCCGATGCTCCTCTGCTACCAACTTCGTATGAGGCTCTGAAAACGTTTGCATCT
TGTCGACTAGCAGCCCTTGGCCTTACCAGCGTTTCCAATATCGAGTCTATAGGCCCTGTGAGCTCGCTGCAGCAA
GAAATCTTGATCGCGCAGGGCCAAGATCAAAACTGCTATTCTATTAGCTCCACATACGAATTCAAGATTGCCGCT
GGCCTTGAATTCAACCAGACGAGATTATACGAATCGTGGAAGAAGCTCATCGCACGACACGATTGTCTGCGAACC
GTTTTTGCCGACACCATCGCCGACAATGGGCTTTTTGTCAAGGTCCTCCTCAGCAAGGTTTCTCCAGAAATGCTC
TTTTTTGACTCTCCAAATCCCGACAAGACGTTGGCATCAGTCCCGCCCGTCAAGTTTGTTTCATCGCGGCCGCGA
CACCGATTATCCGTGAGTAGATCATCGACTGAGATATATATAAGATTTGATGTCAGCCAGGCTCTCTGCGATATA
TTCACCATCAATCGCTTATTCTCCCAGCTTGAGCATGAATACTCGGCCAGCAACACACGCGGCTATGATGACGTA
CTCAACGAGGTCCCATCCTGTCCTAAGTTTTGCAACACTCATGGTATAGAAGGCTCGGCTGTCATCAAACTTGCC
TGGGGACTCGTCCTCCGCTGTTTTGTGGCCGAGGATAAAGTCTGCTTTGGCTATCAGGTTCAGCGACGCGGCCAA
GATTTACTGAGCAAAGGAGCAGAGCCCCTGGGGTGTTTGGACGCCATTATTGCCAATGTCATTGACTTTTCTAAC
CTGCCCAATGTCGGCCAAGTGCTTTGTGATATTCAAAAACGCTCAATGCGCTCGTATGCCCAGGGTGCACCCCCT
ATCTCGGAGATAGAGCATGCGTTGGGCTTGCATGGCGAGCGCCTCTTCAACACGAGCGTCTCATTTGGAGATTCT
GCCAGGCACGATTTGGATGGCAAGTTTGTATCTGCTACATTTGATGCAAACTGCGACGTCTCTCTTTGTGTCACC
ATGGTCGACGACAAGCTCCACTGCGACATGACCTATCGTGGTCTTACCACTGGACAAGCCGCCAATGTCATGGGC
TGCTTTGAGTGCGCTATTGAAGCCATCATGCATGATCCGCTACAGCCTGTCTCTGATGTCGACTTGTTGACTAAA
GACAAGCTTGAAGAAATTGCAAAGCCGGATTGGAAGAGGGCGCCCGGAGAGTTGTGCGCCTTGATTGACGAAATG
ATTATGCGTCAGGCAAAGCAACAGCCACATGCAACGGCAATTGTAGCTTGGGATGGTGAATTCTCTTACGGGCAG
GTGGATGTATACGTGGAAAAGCTCGCCACCTCTCTGGTCAACCTCGGGGTCAGGCCCGGCATTCTGGTGCCCGTG
GTGCTTGATAAGTGTCGCTGGTCTCCAATAATTATGCTTGCCGTTCTCAAGGCTGGCGCCTGTTTTGTTGCTATC
GACAGCCAAGACGCTTCATCGGCCAAGACTCTCATTAGCCAACTCGATGCGCCCTTGGTTCTTGTTACGGAATCA
GCATGGATGCAAACCAGTCCTCTAGCCAGCAACTGCCTCGTCATTGACCAGGCCAAGCTCGATTTAGTGCCACCG
CAATTAACACTGGGGCTGCACAAGAGATCACCTGAGCAGGCAGCATGTGCTTTTCTGTCCCCTGGTCAGTCTGGG
CCTAAAGGCATGTTTTATACACATCGGTCATTATGCTCTATTATGTCGGCCCAAGGCCCGGTACTGGGTATTGGC
GATGGTAGTCGAGTACTACAGCTGTCTGCCTACAACGTGGACGTTGCTCTGGTGGAGATTTTGGAAACTTTGCTA
CACGGTGGCTGTGTGTGCATTCCGTCTGCCCATGAGCGAATAAATGACCTGCAAGGCGTCATTACACGCATGGGC
GTCACCTGGACGTACATGACTCCTGTATTGGCACGGAAGATGGATCCCACTGCGTTGCCAAACCTCAGGACGGTG
TGCTTCAGGACTAGGAACCTTGACCAGCTAACTTACAGCCCGTGGCTTGATGGCCGAGAGGTTTTGCTTGTATAC
GGAGCGCCCGACATCTGTCCCCTGGCAATTTCCATCAGCAGACTATCAGCGCCAGTCAAGACAGACATTGTAGCC
CCGCCTCTGTTGGGCAGATTTTTGATCTTAAACCCTGAGGATGCGCACAAGATGGCACCGGTTGGAGCAGTGGGA
GAATTGGCAGTCGACAGCAGTGTCATCACACCACACAAGTTCGTTTTGGGTGAGCCTCTTGTTGACCCAGCAAGC
TTGCAAGGACCAACAGGCAAACCAAGATGGCGATATCTAAGGACCAGCCACCGTGCACAGTTCCTCGACAGCGGC
CATGTCCGCTTCCTGGGCAGCGTGAGGGACCAAGCGGGCGTCAATGGATGTGCCACTCTCATCGCCGACGCAGAA
CGGCAAGCTCGTTTATGCCTGCAGCCCAATCAAGACATTATTATTGAGCCTATAACGACGAGCGATGCCATGGAT
CTTCTTGTGGCGTTTATTGACCTTGATGGCGATCTCGGCCTGGGGTCCTATGATCTCAGGTGCTTGGGTCCCGAG
GTAAAGAATAAGCTATTCATGGCAAGAAGGGCTATTGAGTTGGAGCTTGGAAAGAAGAGCAAGATTGGCAAGAAA
TTGCCCTGGCAATGCATCCCAGCAGCCTTTGTGCCGCTTAGGGGGTTTCCTTTGTCGGCGTCACTCAAGGTCAAC
AGGCGCAAATTGCACAAAATGGTGGCCTCCATGTCTTGTTCCCAACTCATGGGGTTAGCTGATGGCCAATACTGT
GGGGGACCAGCAAACGACGTAGCTGGCCAGAAGCCTTGCTTGACGGCTGCACAAGAGTCGATGCAGCGTCTATGG
GCAGGCCTTCTCGGCATTACGGCGGCCAATATCCGACTGGATGACAGTTTTATTGATGCTGGAGGCGATGTATGG
CTGTCTGCACAATTGGCCATCTTGTGCAGACAGAATGGCTATCATGTGTCGGTTCATGACATTGTTGGAGGTGCA
AGCCTCTTGGACATTTGCCATGCTGCCTCGGCCACGATGGATGGCCAAGGAGGCACCACGCCTAGTGGTCAGGGC
CATGGAGATGCCACGACTGCCAGACTGTCAGCAGTAGGGCCCAGGCTGGGCAGCATTTCATACCACGCACTGGTC
AAGCATGTGCTGTCGCCCCAAATAGGAGTTTCTTGGATGCAGGTGATTGGTGCTGCAGCAGTGTCGTCTCAGCAG
ATTGTGTGTCTCGAGTCGAGTCTCTACGCACGGCGTGGAGATGTTTGTTGCTTGATTCTCGACTTCAATGGGCCC
GTCATGTTGCACCGTCTGGAAACAGCTTGCGAGGAACTGACAAGGCTGCACCCAGTGCTTCGGACCGTCTTTGCC
ACTCACGATTGCCGAGCCTATCAGGTTGTCATTGCATCGCTCAAGTTTAGGCTGGCCCACCGCGTATGCGAAGCA
CGTCAGGTCGAGAGCGCCGTTGACGATATTGTGCATGAGGCAAATGTGCTTCCACTGCATCTTAGTCGTGCAATG
ACGCGATTCACCTTTGTTGGGGATGAACAGCGAGGCAAGCTTGTTGTGCAGTTCAGCACGGTGCAGGTCAGCGAG
GCTTGCATTCCACAACTAGTTCATGACCTTGTCCAGCTGTACACGGAGCCTGAGAGGGTATCTGCTAAGCCCACG
TTTCTGGAATACTGTCACGAAGCAAGGCACAATGCTCCCTACAGTGAAGGCATCCAGCACTGGAGAAAGCGGCTG
GCTGGTGCAAGCATGACGCGTATACTGCCGAATCAGAAGCCTCGTGGTCCAGCGGCCAGCATATCGAAGCTGCGC
GAGACGGTGGATGTGTCACCGCTGGCAGACTTGGGCATCGATTTCGAAACGGTGCTCAAGACGGCCTGGGCCCTT
GTATTGGCGACTTTGGCAGGTGGTGACGATGTCGTCTTTGGCCATCTGGTGGGCAGCCAGCGCATGGCGCTCACC
AAGGACAGAATGGATGTAGCGTCCATTGTCGGCCCCATGGAGCGCGTGGTGCCTGTCAGGATTCGGTTTCCCATA
ACACAGACGTCGCCATTGCAAATGATGCTTCAGGTGCAGCGCGACTGTCTGTCATCTCGGCGGTTTGAGCATCTA
GGAGCTCACACCATTATTGGTCAATGTACCGACTGGGCTCGCTGGGCAGGCTTTAGCACTGTCGTTTGCCATGGT
GCTCAGGGGCCCCTTGACGGCTCAACAACACTCAATCTGGGCAACACGACTTTTACCTACCGACTGGCAGAACCC
ATGGCCTGCGCCAGTCCCGACATGCTCGTTTGCTCCATGCCAGTCCATCCAGGGCGTGTGGCTCTCAGCTTGGCA
TATCCGGCAGGACTCGTACCTGTCGATTTTGGTGTCTCCACGATGCGTCTTCTTGTGGGAGCCGTCAAGACGCTG
GCGTGTTATGAGACGGTCAGCGAGCCCATCCTGCCACCATCAAGCGAATACAAGGCTCTGGTGCCAAGGGTGCCC
CTACAAGAATCGCGTCGACGCGACGACGCTGACGAGATGCATCATCTCTCTCACGAGCAGCATCGCGCACTAGGT
GATCTCATCGCGGCGACATGGCGTCAAGTTCTCTTGCCTCAAGGGTGCGGCAATTTGCTGCATCCTCAAGAGCAA
GAGGCTTGCTTCTACGACGTGGCTGGCTGTCTGCTACCGGCGTACATGCTGTCACACCATTTGAACCATGGGCTG
AGCAGACTGGGAATGACGAGCTTTGGCGCCATTACATTGACACCCGAGGACATTATTCGCCATCCTACAATGGCG
GCTCAGCGGAATCTGGTGGCGCGCAAAATGCACAGCTTGGGACTCGCGGCACCAGCGGCCCGGCGAAGGACTTTT
AGCATCATGGGCCATGGCGTATCCGAGGCTATAGCATCGCCCACACAGCACAAGACCACTTCATCTTGGGGCGCT
GAAGCTGCACGTGGCTCATGGCGGGCTCCAAAGACGCGTCACGGCAGCATGAGAGAGCTGGGTTCCCGCGCAGGC
GACTGGATGCGTCACCACGTGAGCATGAGTCGCGACAAGGAGTCGAAATACAACTGGCACAGCGGGCACGAGCAA
TGGCGGCTGCAGCGGCACCAGAGCCAGCAGCCGGCTGCGCTCGTGCTCGATGACGTGAGCCCTCTGAGTAGCTCA
TCGCCGGGAGGGGCGTGGAACAGTCAAAGAGCAGCTGTATCTCCATTGTGCAACCCTTGCCTCAACCATGCCTAC
ATGTAG
Gene >OphauB2|7977
ATGAGCCTTGGCAAGGAAGAAGAGGCTACAGAAAGCATCCATGCCGAGCCCAACCGCATCAGTAATGACGATATG
CTCTCCGCTATAGATACTTGTGCTGCAACCTTTCTCAGCAGTGAAAGTGAATCTAGCAGTCTGCTACAGCCATCA
ACGAGGCAAAACAGTCAGCGAAATAGCACGTACCAGCAACTAGAAGATCTGTTGCTATCCACGTCCAAGGTTGAA
CGCGTTCTTGCCATAACGCCAAGGGCAGGTTCCTTTGAGGGGCAACTCGTTGTTCTTGTGGCTCCAGTCACAAAG
CCGCCTCAGGGCCGTTCCGAGTTGTCCCCAAACCAAGAGCTGCACCTAGTGCCGCCCCGCGAACACGAGCCGGAC
CGGCAGCTGATCCAAGAACTGCGCACTGTAGTCATGGAATGGGGAGGCACATTGCCACGGCCCGACGTATGGGTG
CTGGTGCAAAGATTGGCGTGTGATGTGCGGCATGCGCAGACATGGGTGCAGAATATGACGGAGCATGTTGTGGAG
CGCGTCATGATGATGCAGCCGCCACAGCCAAGACAAAGGCATTGTGGCTCGCAGAGTGGGAAAAAGACGTGTGAC
GAGGCAGAAAATGGAGTGAAATGGACAAGTGGTGAGAAGCGCATCAGGCAAATCCAGCCCAGGAAAGCGCGACAG
TTGCGCGTGAATGCTGCTTCCGCAGCCGTGGCGGAGGCTGTTGATGATGGGGAAGGAGAAGGGGAAAGATGCGAT
CAAAGGCAGGAGCACAAGCAAGCAGCAGAAGCAGCAGCAGCAGCAGAAGCAGCAGAAGCAGCAGAAGCAACAAAA
GCAACAACACACACAAGCCAACAAGACGAGCAAAAGACAGGCGGCGACGACGACGAAGGCTTCTTCTTCCCCCTC
TCGCCAATGCAGCAACTCTTCTTCCGCACAACTGTCGCTCGCAGCATCGAGGCGGCGTGCGTGGCAGGCACCGGC
TTTCGCTTTAGCCAAAGCATTTTGTTGCGAGTCCGAGGCAACATTCCTCTGGCCGACATTGAGGCTGCAGTTGCC
CATCTTGTGGCCCGGCACTCGATGCTACGAGCCCACTTCCGCCTGACGCCTGGCGGCTGGGCTCAGACCATGGCC
TCGGCCGCCACGGGCAAGTCGCACCGCTTTGAGCATCGCTATGCAGCAGCCGAGTTGCATGTCCTGGCGGCCATG
GAGCAGGCTCGCCGCTCTCTCAATCTCTTCAATGGTCCCGTCTTTGCTGCCGAGCACATGCGCACCGCCGACAAT
TCGCAGCTTCTCTTTCTCGTCGCCCATCACCTTGTCGTCGACCTCGCCTCTTGGCGCATTCTGCTGAGCGATTTG
AATATACTGCTGCGTGACGGTGTCCTTGCTTCACCGCTATCCACGCCCTTTACTCATTGGGTAGATCTCCAGAGC
CTTGAGCTCGAAAATCATGGCTCCCCATCTCATGCCTTGGACGTTCCAGACTTGGCTTACTGGCATCTCAGCGGG
CGTTCCAACTGCTACGGCGACACGGAGCAGCTCAACTTCTCTCTTGATACTCATGTCGCCGCCGCTCTTGTTTCA
CGTTGCAATGAGCCGCTGCGAACCCAGCCATCTCATATTCTCATGGCCTCTCTGATTTATTCCTTTAGCCAGGTT
TTCCCCAGCCAGCCTGTACCTATTGTCTGGAACCAAGAGAGTGCTAGAAGCTCCCCTCGAGTCCAAAACACGATT
GGGTGGTTCACAACGTTGTGCCCCGTCCGTGTGCAGGCCGACGCAGAGACGGATCTGATCCAGCTCGTGAGGCTT
GTCAAGGATGCGCACAGAGCGGCTACGCAATCTCACAGCAGTGTCTTCCCTTATGGTGTCGCCCATGCGTCCCAA
CTTTCATCTGTACCTATCCAAGTCATGTTCAATTGTGTGGAAACCTTGCATCAACTGACTCCTCACAATTCGCTC
CTAGAGCCCACCAGATCGCCCGACCGCGACGTTGAAACACTGACCTGCGATGTCGGTCCCCAAGTCGGCCGCATC
TCTCTCTTTGAGATGTCAGTGGTTCTTGATGAGTCTAGTGTACAAGTTGAATTTCTCTTCAACGCTTACACGGCG
CACCAAGATCGCATCATTACCTGGATGAATAATTTTGAGCGTGCAGTGGCTGAAGCTACCGCTCAACTGCTCACT
ATGAAAGCCGAACTAACCCTGGCCGATGCTCCTCTGCTACCAACTTCGTATGAGGCTCTGAAAACGTTTGCATCT
TGTCGACTAGCAGCCCTTGGCCTTACCAGCGTTTCCAATATCGAGTCTATAGGCCCTGTGAGCTCGCTGCAGCAA
GAAATCTTGATCGCGCAGGGCCAAGATCAAAACTGCTATTCTATTAGCTCCACATACGAATTCAAGATTGCCGCT
GGCCTTGAATTCAACCAGACGAGATTATACGAATCGTGGAAGAAGCTCATCGCACGACACGATTGTCTGCGAACC
GTTTTTGCCGACACCATCGCCGACAATGGGCTTTTTGTCAAGGTCCTCCTCAGCAAGGTTTCTCCAGAAATGCTC
TTTTTTGACTCTCCAAATCCCGACAAGACGTTGGCATCAGTCCCGCCCGTCAAGTTTGTTTCATCGCGGCCGCGA
CACCGATTATCCGTGAGTAGATCATCGACTGAGATATATATAAGATTTGATGTCAGCCAGGCTCTCTGCGATGCA
AGTCTCATCATCTTCTAGCTTTATTTTTATCATTCTAACATTGGTTTGTAGATATTCACCATCAATCGCTTATTC
TCCCAGCTTGAGCATGAATACTCGGCCAGCAACACACGCGGCTATGATGACGTACTCAACGAGGTCCCATCCTGT
CCTGTCAGTAACCCCCCGCTACTGGGTGCCTGGATAGCCGATTTGTCAGGAGCAAGGCCATGCATCTTTCCACGC
CTCGTGCGACAAGAGACGAGGCGACTACATGTTCAAGCTTTCAACCTTGCTACCAGCCGTCTAAGCCTTCAGAAG
TTTTGCAACACTCATGGTATAGAAGGCTCGGCTGTCATCAAACTTGCCTGGGGACTCGTCCTCCGCTGTTTTGTG
GCCGAGGATAAAGTCTGCTTTGGCTATCAGGTTCAGCGACGCGGCCAAGATTTACTGAGCAAAGGAGCAGAGCCC
CTGGGGTGTTTGGACGCCATTATTGCCAATGTCATTGACTTTTCTAACCTGCCCAATGTCGGCCAAGTGCTTTGT
GATATTCAAAAACGCTCAATGCGCTCGTATGCCCAGGGTGCACCCCCTATCTCGGAGATAGAGCATGCGTTGGGC
TTGCATGGCGAGCGCCTCTTCAACACGAGCGTCTCATTTGGAGATTCTGCCAGGCACGATTTGGATGGCAAGTTT
GTATCTGCTACATTTGATGCAAACTGCGACGTCTCTCTTTGTGTCACCATGGTCGACGACAAGCTCCACTGCGAC
ATGACCTATCGTGGTCTTACCACTGGACAAGCCGCCAATGTCATGGGCTGCTTTGAGTGCGCTATTGAAGCCATC
ATGCATGATCCGCTACAGCCTGTCTCTGATGTCGACTTGTTGACTAAAGACAAGCTTGAAGAAATTGCAAAGCCG
GATTGGAAGAGGGCGCCCGGAGAGTTGTGCGCCTTGATTGACGAAATGATTATGCGTCAGGCAAAGCAACAGCCA
CATGCAACGGCAATTGTAGCTTGGGATGGTGAATTCTCTTACGGGCAGGTGGATGTATACGTGGAAAAGCTCGCC
ACCTCTCTGGTCAACCTCGGGGTCAGGCCCGGCATTCTGGTGCCCGTGGTGCTTGATAAGTGTCGCTGGTCTCCA
ATAATTATGCTTGCCGTTCTCAAGGCTGGCGCCTGTTTTGTTGCTATCGACAGCCAAGACGCTTCATCGGCCAAG
ACTCTCATTAGCCAACTCGATGCGCCCTTGGTTCTTGTTACGGAATCAGCATGGATGCAAACCAGTCCTCTAGCC
AGCAACTGCCTCGTCATTGACCAGGCCAAGCTCGATTTAGTGCCACCGCAATTAACACTGGGGCTGCACAAGAGA
TCACCTGAGCAGGCAGCATGTGCTTTTCTGTCCCCTGGTCAGTCTGGGCCTAAAGGCATGTTTTATACACATCGG
TCATTATGCTCTATTATGTCGGCCCAAGGCCCGGTACTGGGTATTGGCGATGGTAGTCGAGTACTACAGCTGTCT
GCCTACAACGTGGACGTTGCTCTGGTGGAGATTTTGGAAACTTTGCTACACGGTGGCTGTGTGTGCATTCCGTCT
GCCCATGAGCGAATAAATGACCTGCAAGGCGTCATTACACGCATGGGCGTCACCTGGACGTACATGACTCCTGTA
TTGGCACGGAAGATGGATCCCACTGCGTTGCCAAACCTCAGGACGGTGTGCTTCAGGACTAGGAACCTTGACCAG
CTAACTTACAGCCCGTGGCTTGATGGCCGAGAGGTTTTGCTTGTATACGGAGCGCCCGACATCTGTCCCCTGGCA
ATTTCCATCAGCAGACTATCAGCGCCAGTCAAGACAGACATTGTAGCCCCGCCTCTGTTGGGCAGATTTTTGATC
TTAAACCCTGAGGATGCGCACAAGATGGCACCGGTTGGAGCAGTGGGAGAATTGGCAGTCGACAGCAGTGTCATC
ACACCACACAAGTTCGTTTTGGGTGAGCCTCTTGTTGACCCAGCAAGCTTGCAAGGACCAACAGGCAAACCAAGA
TGGCGATATCTAAGGACCAGCCACCGTGCACAGTTCCTCGACAGCGGCCATGTCCGCTTCCTGGGCAGCGTGAGG
GACCAAGCGGGCGTCAATGGATGTGCCACTCTCATCGCCGACGCAGAACGGCAAGCTCGTTTATGCCTGCAGCCC
AATCAAGACATTATTATTGAGCCTATAACGACGAGCGATGCCATGGATCTTCTTGTGGCGTTTATTGACCTTGAT
GGCGATCTCGGCCTGGGGTCCTATGATCTCAGGTGCTTGGGTCCCGAGGTAAAGAATAAGCTATTCATGGCAAGA
AGGGCTATTGAGTTGGAGCTTGGAAAGAAGAGCAAGATTGGCAAGAAATTGCCCTGGCAATGCATCCCAGCAGCC
TTTGTGCCGCTTAGGGGGTTTCCTTTGTCGGCGTCACTCAAGGTCAACAGGCGCAAATTGCACAAAATGGTGGCC
TCCATGTCTTGTTCCCAACTCATGGGGTTAGCTGATGGCCAATACTGTGGGGGACCAGCAAACGACGTAGCTGGC
CAGAAGCCTTGCTTGACGGCTGCACAAGAGTCGATGCAGCGTCTATGGGCAGGCCTTCTCGGCATTACGGCGGCC
AATATCCGACTGGATGACAGTTTTATTGATGCTGGAGGCGATGTATGGCTGTCTGCACAATTGGCCATCTTGTGC
AGACAGAATGGCTATCATGTGTCGGTTCATGACATTGTTGGAGGTGCAAGCCTCTTGGACATTTGCCATGCTGCC
TCGGCCACGATGGATGGCCAAGGAGGCACCACGCCTAGTGGTCAGGGCCATGGAGATGCCACGACTGCCAGACTG
TCAGCAGTAGGGCCCAGGCTGGGCAGCATTTCATACCACGCACTGGTCAAGCATGTGCTGTCGCCCCAAATAGGA
GTTTCTTGGATGCAGGTGATTGGTGCTGCAGCAGTGTCGTCTCAGCAGATTGTGTGTCTCGAGTCGAGTCTCTAC
GCACGGCGTGGAGATGTTTGTTGCTTGATTCTCGACTTCAATGGGCCCGTCATGTTGCACCGTCTGGAAACAGCT
TGCGAGGAACTGACAAGGCTGCACCCAGTGCTTCGGACCGTCTTTGCCACTCACGATTGCCGAGCCTATCAGGTT
GTCATTGCATCGCTCAAGTTTAGGCTGGCCCACCGCGTATGCGAAGCACGTCAGGTCGAGAGCGCCGTTGACGAT
ATTGTGCATGAGGCAAATGTGCTTCCACTGCATCTTAGTCGTGCAATGACGCGATTCACCTTTGTTGGGGATGAA
CAGCGAGGCAAGCTTGTTGTGCAGTTCAGCACGGTGCAGGTCAGCGAGGCTTGCATTCCACAACTAGTTCATGAC
CTTGTCCAGCTGTACACGGAGCCTGAGAGGGTATCTGCTAAGCCCACGTTTCTGGAATACTGTCACGAAGCAAGG
CACAATGCTCCCTACAGTGAAGGCATCCAGCACTGGAGAAAGCGGCTGGCTGGTGCAAGCATGACGCGTATACTG
CCGAATCAGAAGCCTCGTGGTCCAGCGGCCAGCATATCGAAGCTGCGCGAGACGGTGGATGTGTCACCGCTGGCA
GACTTGGGCATCGATTTCGAAACGGTGCTCAAGACGGCCTGGGCCCTTGTATTGGCGACTTTGGCAGGTGGTGAC
GATGTCGTCTTTGGCCATCTGGTGGGCAGCCAGCGCATGGCGCTCACCAAGGACAGAATGGATGTAGCGTCCATT
GTCGGCCCCATGGAGCGCGTGGTGCCTGTCAGGATTCGGTTTCCCATAACACAGACGTCGCCATTGCAAATGATG
CTTCAGGTGCAGCGCGACTGTCTGTCATCTCGGCGGTTTGAGCATCTAGGAGCTCACACCATTATTGGTCAATGT
ACCGACTGGGCTCGCTGGGCAGGCTTTAGCACTGTCGTTTGCCATGGTGCTCAGGGGCCCCTTGACGGCTCAACA
ACACTCAATCTGGGCAACACGACTTTTACCTACCGACTGGCAGAACCCATGGCCTGCGCCAGTCCCGACATGCTC
GTTTGCTCCATGCCAGTCCATCCAGGGCGTGTGGCTCTCAGCTTGGCATATCCGGCAGGACTCGTACCTGTCGAT
TTTGGTGTCTCCACGATGCGTCTTCTTGTGGGAGCCGTCAAGACGCTGGCGTGTTATGAGACGGTCAGCGAGCCC
ATCCTGCCACCATCAAGCGAATACAAGGCTCTGGTGCCAAGGGTGCCCCTACAAGAATCGCGTCGACGCGACGAC
GCTGACGAGATGCATCATCTCTCTCACGAGCAGCATCGCGCACTAGGTGATCTCATCGCGGCGACATGGCGTCAA
GTTCTCTTGCCTCAAGGGTGCGGCAATTTGCTGCATCCTCAAGAGCAAGAGGCTTGCTTCTACGACGTGGCTGGC
TGTCTGCTACCGGCGTACATGCTGTCACACCATTTGAACCATGGGCTGAGCAGACTGGGAATGACGAGCTTTGGC
GCCATTACATTGACACCCGAGGACATTATTCGCCATCCTACAATGGCGGCTCAGCGGAATCTGGTGGCGCGCAAA
ATGCACAGCTTGGGACTCGCGGCACCAGCGGCCCGGCGAAGGACTTTTAGCATCATGGGCCATGGCGTATCCGAG
GCTATAGCATCGCCCACACAGCACAAGACCACTTCATCTTGGGGCGCTGAAGCTGCACGTGGCTCATGGCGGGCT
CCAAAGACGCGTCACGGCAGCATGAGAGAGCTGGGTTCCCGCGCAGGCGACTGGATGCGTCACCACGTGAGCATG
AGTCGCGACAAGGAGTCGAAATACAACTGGCACAGCGGGCACGAGCAATGGCGGCTGCAGCGGCACCAGAGCCAG
CAGCCGGCTGCGCTCGTGCTCGATGACGTGAGCCCTCTGAGTAGCTCATCGCCGGGAGGGGCGTGGAACAGTCAA
AGAGCAGCTGTATCTCCATTGTGCAACCCTTGCCTCAACCATGCCTACATGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail