Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7969
Gene name
LocationContig_91:63424..64366
Strand+
Gene length (bp)942
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04261 Dyp_perox Dyp-type peroxidase family 1.1E-81 7 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P76536|YFEX_ECOLI Probable deferrochelatase/peroxidase YfeX OS=Escherichia coli (strain K12) GN=yfeX PE=1 SV=2 15 310 9.0E-40
sp|Q1CHD5|EFEB_YERPN Deferrochelatase/peroxidase EfeB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeB PE=3 SV=1 56 206 4.0E-08
sp|Q7CI09|EFEB_YERPE Deferrochelatase/peroxidase EfeB OS=Yersinia pestis GN=efeB PE=3 SV=1 56 206 4.0E-08
sp|Q66BP4|EFEB_YERPS Deferrochelatase/peroxidase EfeB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeB PE=3 SV=1 56 206 4.0E-08
sp|Q0TJ48|EFEB_ECOL5 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeB PE=3 SV=1 56 304 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P76536|YFEX_ECOLI Probable deferrochelatase/peroxidase YfeX OS=Escherichia coli (strain K12) GN=yfeX PE=1 SV=2 15 310 9.0E-40
sp|Q1CHD5|EFEB_YERPN Deferrochelatase/peroxidase EfeB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=efeB PE=3 SV=1 56 206 4.0E-08
sp|Q7CI09|EFEB_YERPE Deferrochelatase/peroxidase EfeB OS=Yersinia pestis GN=efeB PE=3 SV=1 56 206 4.0E-08
sp|Q66BP4|EFEB_YERPS Deferrochelatase/peroxidase EfeB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=efeB PE=3 SV=1 56 206 4.0E-08
sp|Q0TJ48|EFEB_ECOL5 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=efeB PE=3 SV=1 56 304 3.0E-07
sp|P31545|EFEB_ECOLI Deferrochelatase/peroxidase EfeB OS=Escherichia coli (strain K12) GN=efeB PE=1 SV=2 56 304 3.0E-07
sp|Q3Z396|EFEB_SHISS Deferrochelatase/peroxidase EfeB OS=Shigella sonnei (strain Ss046) GN=efeB PE=3 SV=1 56 304 3.0E-07
sp|Q1RDJ8|EFEB_ECOUT Deferrochelatase/peroxidase EfeB OS=Escherichia coli (strain UTI89 / UPEC) GN=efeB PE=3 SV=1 56 304 3.0E-07
sp|Q8CW71|EFEB_ECOL6 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=efeB PE=2 SV=1 56 304 3.0E-07
sp|Q8XAS4|EFEB_ECO57 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O157:H7 GN=efeB PE=1 SV=1 56 304 3.0E-07
sp|Q31Z86|EFEB_SHIBS Deferrochelatase/peroxidase EfeB OS=Shigella boydii serotype 4 (strain Sb227) GN=efeB PE=3 SV=1 56 304 8.0E-07
sp|A1A9S3|EFEB_ECOK1 Deferrochelatase/peroxidase EfeB OS=Escherichia coli O1:K1 / APEC GN=efeB PE=3 SV=1 56 301 9.0E-07
sp|Q83LK4|EFEB_SHIFL Deferrochelatase/peroxidase EfeB OS=Shigella flexneri GN=efeB PE=3 SV=1 56 304 2.0E-06
sp|Q0T616|EFEB_SHIF8 Deferrochelatase/peroxidase EfeB OS=Shigella flexneri serotype 5b (strain 8401) GN=efeB PE=3 SV=1 56 304 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0003824 catalytic activity No
GO:0046906 tetrapyrrole binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5267
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1750
Ophiocordyceps australis map64 (Brazil) OphauB2|7969 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04813
Ophiocordyceps camponoti-rufipedis Ophun1|6193
Ophiocordyceps kimflemingae Ophio5|2276
Ophiocordyceps subramaniannii Hirsu2|456

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7969
MKASRAQAVDAPLTQSATFIVLTVADKPDAIKTVRSAIAGISGLAKSVGVRDSTSSFACTVGIGSRVWDQLMGMP
RPAELHPFEEIKGNTHTAVSTPGDLLLHIRSDRRDICFEFERQLMKQLGSAVQVEDTTVGFRYFDLRDLLGFVDG
TANPIGPAVPESVLVAEEDGECAGGSYIVVQKYLHNLSTWEKLPSEKQEAIIGRTKLDNIELDDAPPPDQKSHKT
LATIQDDQGNEHDILRDNMPFGSPGTDEFGTYFIGYSRRLWVTERMLQRMFVGDPPGMHDRILDYSEAKTGCVFF
APPADVLASLDSD*
Coding >OphauB2|7969
ATGAAGGCGTCTCGGGCCCAAGCGGTTGATGCTCCGCTCACACAGTCGGCAACCTTTATCGTCCTGACTGTCGCA
GACAAGCCCGACGCCATAAAGACTGTGCGTTCAGCCATTGCCGGCATCAGTGGTCTGGCCAAGAGCGTGGGCGTG
CGCGACTCGACGTCTTCTTTTGCATGCACGGTTGGGATCGGCAGTCGTGTCTGGGACCAACTCATGGGGATGCCA
CGGCCAGCCGAGCTTCACCCCTTTGAAGAAATCAAGGGCAATACCCATACTGCTGTTTCTACGCCGGGCGACTTG
CTCTTGCACATTCGCTCAGACCGTCGCGACATTTGCTTCGAGTTTGAACGCCAACTCATGAAACAGCTGGGAAGC
GCTGTCCAAGTTGAAGACACCACTGTGGGTTTCCGCTACTTTGATCTTCGCGATCTCCTTGGCTTCGTCGACGGC
ACGGCCAATCCAATTGGGCCTGCCGTGCCAGAATCTGTCCTTGTGGCCGAGGAGGACGGCGAATGTGCTGGAGGC
AGCTACATCGTTGTGCAAAAGTATCTTCACAATCTTTCAACATGGGAGAAGCTGCCATCAGAGAAGCAAGAGGCC
ATAATTGGCAGGACAAAGCTGGATAACATTGAGCTCGACGATGCACCGCCCCCGGACCAAAAGTCTCACAAGACA
CTGGCCACTATACAAGACGATCAAGGCAATGAACATGACATTCTCCGGGACAACATGCCCTTTGGGTCTCCCGGG
ACCGATGAGTTTGGCACCTACTTTATTGGCTACTCGCGTCGTCTCTGGGTTACTGAACGCATGCTGCAGCGCATG
TTTGTCGGCGACCCCCCTGGGATGCACGACCGCATCTTGGATTACTCAGAGGCAAAAACTGGTTGCGTTTTTTTC
GCACCCCCGGCCGATGTATTGGCTAGTCTCGATTCTGATTGA
Transcript >OphauB2|7969
ATGAAGGCGTCTCGGGCCCAAGCGGTTGATGCTCCGCTCACACAGTCGGCAACCTTTATCGTCCTGACTGTCGCA
GACAAGCCCGACGCCATAAAGACTGTGCGTTCAGCCATTGCCGGCATCAGTGGTCTGGCCAAGAGCGTGGGCGTG
CGCGACTCGACGTCTTCTTTTGCATGCACGGTTGGGATCGGCAGTCGTGTCTGGGACCAACTCATGGGGATGCCA
CGGCCAGCCGAGCTTCACCCCTTTGAAGAAATCAAGGGCAATACCCATACTGCTGTTTCTACGCCGGGCGACTTG
CTCTTGCACATTCGCTCAGACCGTCGCGACATTTGCTTCGAGTTTGAACGCCAACTCATGAAACAGCTGGGAAGC
GCTGTCCAAGTTGAAGACACCACTGTGGGTTTCCGCTACTTTGATCTTCGCGATCTCCTTGGCTTCGTCGACGGC
ACGGCCAATCCAATTGGGCCTGCCGTGCCAGAATCTGTCCTTGTGGCCGAGGAGGACGGCGAATGTGCTGGAGGC
AGCTACATCGTTGTGCAAAAGTATCTTCACAATCTTTCAACATGGGAGAAGCTGCCATCAGAGAAGCAAGAGGCC
ATAATTGGCAGGACAAAGCTGGATAACATTGAGCTCGACGATGCACCGCCCCCGGACCAAAAGTCTCACAAGACA
CTGGCCACTATACAAGACGATCAAGGCAATGAACATGACATTCTCCGGGACAACATGCCCTTTGGGTCTCCCGGG
ACCGATGAGTTTGGCACCTACTTTATTGGCTACTCGCGTCGTCTCTGGGTTACTGAACGCATGCTGCAGCGCATG
TTTGTCGGCGACCCCCCTGGGATGCACGACCGCATCTTGGATTACTCAGAGGCAAAAACTGGTTGCGTTTTTTTC
GCACCCCCGGCCGATGTATTGGCTAGTCTCGATTCTGATTGA
Gene >OphauB2|7969
ATGAAGGCGTCTCGGGCCCAAGCGGTTGATGCTCCGCTCACACAGTCGGCAACCTTTATCGTCCTGACTGTCGCA
GACAAGCCCGACGCCATAAAGACTGTGCGTTCAGCCATTGCCGGCATCAGTGGTCTGGCCAAGAGCGTGGGCGTG
CGCGACTCGACGTCTTCTTTTGCATGCACGGTTGGGATCGGCAGTCGTGTCTGGGACCAACTCATGGGGATGCCA
CGGCCAGCCGAGCTTCACCCCTTTGAAGAAATCAAGGGCAATACCCATACTGCTGTTTCTACGCCGGGCGACTTG
CTCTTGCACATTCGCTCAGACCGTCGCGACATTTGCTTCGAGTTTGAACGCCAACTCATGAAACAGCTGGGAAGC
GCTGTCCAAGTTGAAGACACCACTGTGGGTTTCCGCTACTTTGATCTTCGCGATCTCCTTGGCTTCGTCGACGGC
ACGGCCAATCCAATTGGGCCTGCCGTGCCAGAATCTGTCCTTGTGGCCGAGGAGGACGGCGAATGTGCTGGAGGC
AGCTACATCGTTGTGCAAAAGTATCTTCACAATCTTTCAACATGGGAGAAGCTGCCATCAGAGAAGCAAGAGGCC
ATAATTGGCAGGACAAAGCTGGATAACATTGAGCTCGACGATGCACCGCCCCCGGACCAAAAGTCTCACAAGACA
CTGGCCACTATACAAGACGATCAAGGCAATGAACATGACATTCTCCGGGACAACATGCCCTTTGGGTCTCCCGGG
ACCGATGAGTTTGGCACCTACTTTATTGGCTACTCGCGTCGTCTCTGGGTTACTGAACGCATGCTGCAGCGCATG
TTTGTCGGCGACCCCCCTGGGATGCACGACCGCATCTTGGATTACTCAGAGGCAAAAACTGGTTGCGTTTTTTTC
GCACCCCCGGCCGATGTATTGGCTAGTCTCGATTCTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail