Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7967
Gene name
LocationContig_91:57470..59901
Strand+
Gene length (bp)2431
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 8.4E-41 33 376

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10723|ARS_VOLCA Arylsulfatase OS=Volvox carteri PE=1 SV=1 33 566 6.0E-87
sp|P14217|ARS_CHLRE Arylsulfatase OS=Chlamydomonas reinhardtii GN=AS PE=1 SV=2 33 566 1.0E-71
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 33 510 9.0E-42
sp|P15586|GNS_HUMAN N-acetylglucosamine-6-sulfatase OS=Homo sapiens GN=GNS PE=1 SV=3 33 510 7.0E-40
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 33 512 8.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10723|ARS_VOLCA Arylsulfatase OS=Volvox carteri PE=1 SV=1 33 566 6.0E-87
sp|P14217|ARS_CHLRE Arylsulfatase OS=Chlamydomonas reinhardtii GN=AS PE=1 SV=2 33 566 1.0E-71
sp|Q8BFR4|GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus GN=Gns PE=1 SV=1 33 510 9.0E-42
sp|P15586|GNS_HUMAN N-acetylglucosamine-6-sulfatase OS=Homo sapiens GN=GNS PE=1 SV=3 33 510 7.0E-40
sp|Q1LZH9|GNS_BOVIN N-acetylglucosamine-6-sulfatase OS=Bos taurus GN=GNS PE=2 SV=1 33 512 8.0E-40
sp|P50426|GNS_CAPHI N-acetylglucosamine-6-sulfatase OS=Capra hircus GN=GNS PE=2 SV=1 33 510 4.0E-39
sp|Q21376|SULF1_CAEEL Putative extracellular sulfatase Sulf-1 homolog OS=Caenorhabditis elegans GN=sul-1 PE=3 SV=1 33 395 2.0E-37
sp|Q9VEX0|SULF1_DROME Extracellular sulfatase SULF-1 homolog OS=Drosophila melanogaster GN=Sulf1 PE=1 SV=1 33 409 1.0E-34
sp|Q90XB6|SULF1_COTCO Extracellular sulfatase Sulf-1 OS=Coturnix coturnix GN=SULF1 PE=1 SV=1 33 395 1.0E-32
sp|Q8IWU5|SULF2_HUMAN Extracellular sulfatase Sulf-2 OS=Homo sapiens GN=SULF2 PE=1 SV=1 28 395 3.0E-31
sp|Q8CFG0|SULF2_MOUSE Extracellular sulfatase Sulf-2 OS=Mus musculus GN=Sulf2 PE=2 SV=2 28 395 3.0E-31
sp|Q8VI60|SULF1_RAT Extracellular sulfatase Sulf-1 OS=Rattus norvegicus GN=Sulf1 PE=1 SV=1 30 395 7.0E-31
sp|Q8K007|SULF1_MOUSE Extracellular sulfatase Sulf-1 OS=Mus musculus GN=Sulf1 PE=2 SV=1 33 395 1.0E-30
sp|Q8IWU6|SULF1_HUMAN Extracellular sulfatase Sulf-1 OS=Homo sapiens GN=SULF1 PE=1 SV=1 1 426 2.0E-30
sp|P31447|YIDJ_ECOLI Uncharacterized sulfatase YidJ OS=Escherichia coli (strain K12) GN=yidJ PE=3 SV=1 33 480 2.0E-19
sp|Q148F3|ARSK_BOVIN Arylsulfatase K OS=Bos taurus GN=ARSK PE=2 SV=1 288 476 2.0E-07
sp|Q32KJ2|ARSK_RAT Arylsulfatase K OS=Rattus norvegicus GN=Arsk PE=2 SV=1 289 479 5.0E-07
sp|Q5ZK90|ARSK_CHICK Arylsulfatase K OS=Gallus gallus GN=ARSK PE=2 SV=1 277 488 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7967
MFFTRFILYLVFWATQCWCQSYTSPPIRWIPDNIILILTQDQDERLQSMDVMQNLRSKMIWSGIDFTNHFTPSSH
GGASRASIFRGQHAHNTNMTHPTSPGGGYAKWLASGLNEDYLPFWLKEAGYQTEFIGKFMDGYDAAIFDSPPSGW
DRVDALVDPWGSTYNKPVFSRDGRAPIYYRNRHQSDVISAKAVERLKVLFAQQKPFFLMIAPHAIQGTINRDWRP
QACERHRHNWSGMKAPRTPNYDTTDNLALQKSSWLSFLPRLRSRERWMTDSHHVRRLQTLESVDQLLGEVYRYVR
TVRALQYTWIIYTSDSGYHLGNHRVRAGKMLPYMEDVKVPLIVRGPVGPEFDITRRTVTDVPSTHLDLAPTFLEI
ARVPRIKWPKYLDGRSMLSVWKNPWVLPRRNDLRRIIHGEFWGRPLVEAGRKKYAYTIDPVAYKSIRVLDTDTSW
LYIRWCTGEIELYNTHTDPEELHNLVLEMRPKRPLDRIRWRLDALLLVTKTCSGSSCRNPWLELQRECRITTMCP
ASINIFRDWESALNSMFDPFFESLPKVSFGRCLEFQNKANEAPHMPAEPDLGIEYRLSPDNFTVPVREDTRKLAP
QTQSVGTWMNWREPLDVMAKEALPVTAKDLGRRLPGWQWPPVGQSTNESRSKDIKRRIASFSTLLKTNDAELQSG
QADFDD*
Coding >OphauB2|7967
ATGTTCTTCACCAGATTTATTCTATATCTAGTTTTTTGGGCTACACAATGCTGGTGTCAGTCTTATACGTCGCCC
CCAATCAGGTGGATCCCAGACAACATCATCCTGATCCTGACACAAGATCAGGATGAACGCCTACAGTCTATGGAT
GTAATGCAAAACTTGCGATCCAAGATGATATGGAGCGGGATCGACTTTACAAATCACTTCACCCCGTCGTCACAT
GGTGGTGCGAGTCGAGCGTCTATTTTTCGCGGCCAACACGCGCACAACACAAACATGACACATCCGACGTCTCCT
GGAGGTGGTTATGCCAAGTGGCTGGCTTCAGGCCTCAACGAAGACTATTTGCCCTTTTGGCTGAAGGAGGCCGGC
TATCAAACCGAATTCATTGGCAAGTTTATGGACGGGTACGATGCTGCTATATTTGACAGCCCTCCAAGCGGATGG
GACAGGGTTGATGCCTTGGTCGATCCATGGGGGAGCACGTACAATAAACCTGTATTCTCCCGGGATGGCAGAGCG
CCCATATACTACAGAAATCGCCATCAAAGTGATGTGATTTCGGCCAAAGCAGTCGAAAGACTCAAGGTTCTCTTT
GCTCAGCAAAAGCCCTTCTTCCTCATGATTGCTCCACATGCAATTCAAGGGACGATTAACAGAGACTGGAGGCCT
CAGGCTTGTGAGCGGCACCGACACAACTGGTCTGGCATGAAGGCGCCTCGAACGCCAAATTACGATACGACAGAC
AATCTAGCGCTACAAAAGTCGTCGTGGTTAAGCTTTCTACCCAGACTCCGGTCGCGGGAAAGGTGGATGACGGAT
TCCCACCATGTCAGGCGATTACAGACGCTCGAATCTGTGGACCAATTGTTGGGCGAAGTCTACAGATATGTGCGA
ACGGTGAGAGCCTTGCAGTATACATGGATCATCTATACATCCGATTCGGGATATCACTTGGGCAATCATCGAGTT
CGCGCCGGCAAGATGCTGCCATATATGGAAGATGTCAAAGTGCCATTAATAGTTAGAGGACCTGTCGGGCCCGAG
TTTGATATTACTCGGCGCACCGTGACTGATGTGCCGAGCACTCATCTTGATCTCGCACCCACATTTCTCGAAATC
GCACGCGTGCCACGTATTAAATGGCCCAAATATCTCGATGGGCGAAGCATGCTGAGCGTTTGGAAAAATCCATGG
GTGTTACCCAGACGCAATGACCTACGACGAATCATCCATGGAGAATTTTGGGGAAGACCACTTGTAGAGGCTGGG
AGGAAGAAATACGCATATACGATTGATCCAGTGGCTTACAAGTCGATACGTGTCCTCGATACGGACACCTCATGG
CTCTATATACGTTGGTGTACTGGAGAGATTGAGCTATACAATACACATACGGACCCCGAAGAGTTGCACAACTTG
GTTTTGGAAATGCGGCCTAAGCGGCCACTTGACCGGATAAGATGGCGTCTTGACGCGCTTCTCTTGGTGACCAAG
ACATGCAGCGGCAGCAGCTGTCGCAACCCGTGGCTGGAACTACAGCGTGAATGCCGCATAACAACAATGTGTCCG
GCGTCAATCAACATCTTTCGCGACTGGGAGTCTGCCTTGAATTCCATGTTTGACCCCTTTTTCGAGTCCTTGCCC
AAAGTTAGCTTTGGCAGATGCCTCGAGTTTCAAAACAAGGCCAACGAGGCACCTCATATGCCTGCTGAGCCTGAC
CTTGGCATAGAGTATCGACTGTCGCCCGATAACTTCACTGTCCCGGTGCGCGAGGACACGCGAAAACTTGCGCCG
CAGACACAATCAGTCGGCACCTGGATGAATTGGCGGGAACCACTGGACGTGATGGCAAAGGAAGCTCTACCGGTC
ACCGCCAAGGACTTGGGTAGGAGACTGCCAGGGTGGCAGTGGCCGCCTGTGGGGCAGTCGACTAATGAATCCAGA
TCTAAAGACATCAAGCGCCGTATTGCCAGCTTTTCAACCTTACTGAAGACGAATGACGCAGAGTTGCAAAGCGGG
CAGGCAGATTTTGATGATTGA
Transcript >OphauB2|7967
ATGTTCTTCACCAGATTTATTCTATATCTAGTTTTTTGGGCTACACAATGCTGGTGTCAGTCTTATACGTCGCCC
CCAATCAGGTGGATCCCAGACAACATCATCCTGATCCTGACACAAGATCAGGATGAACGCCTACAGTCTATGGAT
GTAATGCAAAACTTGCGATCCAAGATGATATGGAGCGGGATCGACTTTACAAATCACTTCACCCCGTCGTCACAT
GGTGGTGCGAGTCGAGCGTCTATTTTTCGCGGCCAACACGCGCACAACACAAACATGACACATCCGACGTCTCCT
GGAGGTGGTTATGCCAAGTGGCTGGCTTCAGGCCTCAACGAAGACTATTTGCCCTTTTGGCTGAAGGAGGCCGGC
TATCAAACCGAATTCATTGGCAAGTTTATGGACGGGTACGATGCTGCTATATTTGACAGCCCTCCAAGCGGATGG
GACAGGGTTGATGCCTTGGTCGATCCATGGGGGAGCACGTACAATAAACCTGTATTCTCCCGGGATGGCAGAGCG
CCCATATACTACAGAAATCGCCATCAAAGTGATGTGATTTCGGCCAAAGCAGTCGAAAGACTCAAGGTTCTCTTT
GCTCAGCAAAAGCCCTTCTTCCTCATGATTGCTCCACATGCAATTCAAGGGACGATTAACAGAGACTGGAGGCCT
CAGGCTTGTGAGCGGCACCGACACAACTGGTCTGGCATGAAGGCGCCTCGAACGCCAAATTACGATACGACAGAC
AATCTAGCGCTACAAAAGTCGTCGTGGTTAAGCTTTCTACCCAGACTCCGGTCGCGGGAAAGGTGGATGACGGAT
TCCCACCATGTCAGGCGATTACAGACGCTCGAATCTGTGGACCAATTGTTGGGCGAAGTCTACAGATATGTGCGA
ACGGTGAGAGCCTTGCAGTATACATGGATCATCTATACATCCGATTCGGGATATCACTTGGGCAATCATCGAGTT
CGCGCCGGCAAGATGCTGCCATATATGGAAGATGTCAAAGTGCCATTAATAGTTAGAGGACCTGTCGGGCCCGAG
TTTGATATTACTCGGCGCACCGTGACTGATGTGCCGAGCACTCATCTTGATCTCGCACCCACATTTCTCGAAATC
GCACGCGTGCCACGTATTAAATGGCCCAAATATCTCGATGGGCGAAGCATGCTGAGCGTTTGGAAAAATCCATGG
GTGTTACCCAGACGCAATGACCTACGACGAATCATCCATGGAGAATTTTGGGGAAGACCACTTGTAGAGGCTGGG
AGGAAGAAATACGCATATACGATTGATCCAGTGGCTTACAAGTCGATACGTGTCCTCGATACGGACACCTCATGG
CTCTATATACGTTGGTGTACTGGAGAGATTGAGCTATACAATACACATACGGACCCCGAAGAGTTGCACAACTTG
GTTTTGGAAATGCGGCCTAAGCGGCCACTTGACCGGATAAGATGGCGTCTTGACGCGCTTCTCTTGGTGACCAAG
ACATGCAGCGGCAGCAGCTGTCGCAACCCGTGGCTGGAACTACAGCGTGAATGCCGCATAACAACAATGTGTCCG
GCGTCAATCAACATCTTTCGCGACTGGGAGTCTGCCTTGAATTCCATGTTTGACCCCTTTTTCGAGTCCTTGCCC
AAAGTTAGCTTTGGCAGATGCCTCGAGTTTCAAAACAAGGCCAACGAGGCACCTCATATGCCTGCTGAGCCTGAC
CTTGGCATAGAGTATCGACTGTCGCCCGATAACTTCACTGTCCCGGTGCGCGAGGACACGCGAAAACTTGCGCCG
CAGACACAATCAGTCGGCACCTGGATGAATTGGCGGGAACCACTGGACGTGATGGCAAAGGAAGCTCTACCGGTC
ACCGCCAAGGACTTGGGTAGGAGACTGCCAGGGTGGCAGTGGCCGCCTGTGGGGCAGTCGACTAATGAATCCAGA
TCTAAAGACATCAAGCGCCGTATTGCCAGCTTTTCAACCTTACTGAAGACGAATGACGCAGAGTTGCAAAGCGGG
CAGGCAGATTTTGATGATTGA
Gene >OphauB2|7967
ATGTTCTTCACCAGATTTATTCTATATCTAGTTTTTTGGGCTACACAATGCTGGTGTCAGTCTTATACGTCGCCC
CCAATCAGGTGGATCCCAGACAACATCATCCTGATCCTGACACAAGATCAGGATGAACGCCTACAGTCTATGGAT
GTAATGCAAAACTTGCGATCCAAGATGATATGGAGCGGGATCGACTTTACAAATCACTTCACCCCGTCGTCACAT
GGTGGTGCGAGTCGAGCGTCTATTTTTCGCGGCCAACACGCGCACAACACAAACATGACACATCCGACGTCTCCT
GGGTAGGAAGACATTTTTTTTTGGGCAAATGTGACCCGCTAATGACCGGTGATGGGGATTCAATAGAGGTGGTTA
TGCCAAGTGGCTGGCTTCAGGCCTCAACGAAGACTATTTGCCCTTTTGGCTGAAGGAGGCCGGCTATCAAACCGA
ATGTGCGTTGCCCCAAAACCACGACTTTATTGGACTTGACCGCTAAAAGATTACTCTGCGCAGTCATTGGCAAGT
TTATGGACGGGTACGATGCTGCTATATTTGACAGCCCTCCAAGCGGATGGGACAGGGTTGATGCCTTGGTAGGCG
AGCTGAAAACAAAACTGCTTGGACAAGTGCTAAACGTTTATGCCGCAGGTCGATCCATGGGGGAGCACGTACAAT
AAACCTGTATTCTCCCGGGATGGCAGAGCGCCCATATACTACAGAAATCGCCATCAAAGTGATGTGATTTCGGCC
AAAGCGTGAGTAGCAGGACGCAAAAGAGCAATACAAGACGCAGCGAATTGACTCTTGTTGAAATGAAGAGTCGAA
AGACTCAAGGTTCTCTTTGCTCAGCAAAAGCCCTTCTTCCTCATGATTGCTCCACATGCAATTCAAGGGACGATT
AACAGAGACTGGAGGCCTCAGGCTTGTGAGCGGCACCGACACAACTGGTCTGGCATGAAGGCGCCTCGAACGCCA
AATTACGATACGACAGACAATCTAGCGCTACAAAAGTCGTCGTGGTTAAGCTTTCTACCCAGACTCCGGTCGCGG
GAAAGGTGGATGACGGATTCCCACCATGTCAGGCGATTACAGACGCTCGAATCTGTGGACCAATTGTTGGGCGAA
GTCTACAGATATGTGCGAACGGTGAGAGCCTTGCAGTATACATGGAGTAAATAGTCACCATCTTTCATCTGGAGG
ATCATTCTGACCAGTATTCCGCTAGTCATCTATACATCCGATTCGGGATATCACTTGGGCAATCATCGAGTTCGC
GCCGGCAAGATGCTGCCATATATGGAAGATGTCAAAGTGCCATTAATAGTTAGAGGACCTGTCGGGCCCGAGTTT
GATATTACTCGGCGCACCGTGACTGATGTGCCGAGCACTCATCTTGATCTCGCACCCACATTTCTCGAAATCGCA
CGCGTGCCACGTATTAAATGGCCCAAATATCTCGATGGGCGAAGCATGCTGAGCGTTTGGAAAAATCCATGGGTG
TTACCCAGACGCAATGACCTACGACGAATCATCCATGGAGAATTTTGGGGAAGACCACTTGTAGAGGCTGGGAGG
AAGAAATACGCATATACGATTGATCCAGTGGCTTACAAGTCGATACGTGTCCTCGATACGGACACCTCATGGCTC
TATATACGTTGGTGTACTGGAGAGATTGAGCTATACAATACACATGTGAGCAAATTCCCAACACCCCCTCCCCCT
TTTGTGCCTTGTCACATTGGGAACAAAAAGTAGAACGAATTTTGACATGGCTTATTAGACGGACCCCGAAGAGTT
GCACAACTTGGTTTTGGAAATGCGGCCTAAGCGGCCACTTGACCGGATAAGATGGCGTCTTGACGCGCTTCTCTT
GGTGACCAAGACATGCAGCGGCAGCAGCTGTCGCAACCCGTGGCTGGAACTACAGCGTGAATGCCGCATAACAAC
AATGTGTCCGGCGTCAATCAACATCTTTCGCGACTGGGAGTCTGCCTTGAATTCCATGTTTGACCCCTTTTTCGA
GTCCTTGCCCAAAGTTAGCTTTGGCAGATGCCTCGAGTTTCAAAACAAGGCCAACGAGGCACCTCATATGCCTGC
TGAGCCTGACCTTGGCATAGAGTATCGACTGTCGCCCGATAACTTCACTGTCCCGGTGCGCGAGGACACGCGAAA
ACTTGCGCCGCAGACACAATCAGTCGGCACCTGGATGAATTGGCGGGAACCACTGGACGTGATGGCAAAGGAAGC
TCTACCGGTCACCGCCAAGGACTTGGGTAGGAGACTGCCAGGGTGGCAGTGGCCGCCTGTGGGGCAGTCGACTAA
TGAATCCAGATCTAAAGACATCAAGCGCCGTATTGCCAGCTTTTCAACCTTACTGAAGACGAATGACGCAGAGTT
GCAAAGCGGGCAGGCAGATTTTGATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail