Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7960
Gene name
LocationContig_91:46374..46665
Strand+
Gene length (bp)291
Transcript length (bp)225
Coding sequence length (bp)225
Protein length (aa) 75

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 28 74 5.0E-15
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 24 74 9.0E-15
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 26 74 2.0E-14
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 26 74 2.0E-14
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 28 74 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 28 74 5.0E-15
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 24 74 9.0E-15
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 26 74 2.0E-14
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 26 74 2.0E-14
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 28 74 3.0E-14
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 28 74 4.0E-14
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 28 74 4.0E-14
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 30 74 1.0E-08
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 12 74 2.0E-08
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 28 74 6.0E-08
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 28 74 6.0E-08
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 28 74 7.0E-08
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 1 70 1.0E-07
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 24 70 4.0E-07
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 24 74 4.0E-07
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 10 73 2.0E-06
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 1 70 2.0E-06
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 30 74 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7960
MAFASLVLAACVAVALAPWAGLGASFASVAYYPAPHGGWVTEWTESYDKARSMVAKMTLAEKANLTGGTGVFMG*
Coding >OphauB2|7960
ATGGCGTTTGCATCTCTCGTCTTGGCCGCATGTGTGGCTGTCGCGCTGGCTCCATGGGCTGGCCTCGGTGCCTCT
TTTGCGTCTGTGGCTTACTATCCTGCGCCTCATGGCGGCTGGGTCACCGAATGGACGGAAAGCTATGACAAAGCA
CGCAGCATGGTGGCCAAAATGACGCTGGCTGAAAAGGCCAATCTCACTGGCGGCACTGGTGTATTTATGGGGTGA
Transcript >OphauB2|7960
ATGGCGTTTGCATCTCTCGTCTTGGCCGCATGTGTGGCTGTCGCGCTGGCTCCATGGGCTGGCCTCGGTGCCTCT
TTTGCGTCTGTGGCTTACTATCCTGCGCCTCATGGCGGCTGGGTCACCGAATGGACGGAAAGCTATGACAAAGCA
CGCAGCATGGTGGCCAAAATGACGCTGGCTGAAAAGGCCAATCTCACTGGCGGCACTGGTGTATTTATGGGGTGA
Gene >OphauB2|7960
ATGGCGTTTGCATCTCTCGTCTTGGCCGCATGTGTGGCTGTCGCGCTGGCTCCATGGGCTGGCCTCGGTGCCTCT
TTTGCGTCTGTGGCTTACTATCCTGCGCCTCATGGCGGCTGGGTCACCGAATGGACGGAAAGCTATGACAAAGCA
CGCAGCATGGTGGCCAAAATGACGCTGGCTGAAAAGGCCAATCTCACTGGCGGCACTGGTGTATTTATGGGTGCG
TTTAGTTGCTTCCTACTCACTTTGCTTGGTATATAAAGTTTTACTGATGATGACAGAATAGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail