Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7958
Gene name
LocationContig_91:40986..42996
Strand+
Gene length (bp)2010
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 1.8E-01 355 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74999|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1 7 568 1.0E-45
sp|P06779|RAD7_YEAST DNA repair protein RAD7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD7 PE=1 SV=3 1 585 2.0E-16
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 346 563 5.0E-10
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 325 574 4.0E-09
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 321 575 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74999|RAD7_SCHPO DNA repair protein rhp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp7 PE=3 SV=1 7 568 1.0E-45
sp|P06779|RAD7_YEAST DNA repair protein RAD7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD7 PE=1 SV=3 1 585 2.0E-16
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 346 563 5.0E-10
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 325 574 4.0E-09
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 321 575 5.0E-07
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 321 575 5.0E-07
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 321 575 6.0E-07
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 341 574 7.0E-07
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 325 577 1.0E-06
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 325 575 2.0E-06
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 403 592 2.0E-06
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 255 547 3.0E-06
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 255 547 3.0E-06
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 227 544 3.0E-06
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 255 547 5.0E-06
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 403 577 8.0E-06
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 402 574 8.0E-06
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 289 577 9.0E-06
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 289 577 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7958
MYLSRNITGPQSALTDFLASHNISARQIREDAELRRRRAEAETGDSQLQTDETEAPQPAARRASRRVAANTDDGG
FGFPFDQRTLDAAKTKKAIRAYLKRKKAHPDDDEDEEIELAISESKGNSMPGQMENCAHCGKRFTVTPYSVAAPE
GGLLCVPCGKELARERHGQPKKKARKQTGGIGSRRALQSRILDGDVGTKSLATLCVHTLAKNVDMADSLGDLPDH
LVDKIARLFSKRRLLKSETLPLFVHPATHILHIYDGAKLGEEDFMSIFQTASKLRHFKARCAIQFKDEVMDYLLS
RNIVLESFYLHGANLLSEEKWHEFFAAKGNSLQRLQVYCTDKHFGDESITTIAKHCPSLLRLKVEQNQKLTDKGV
EAMAELSSLQHLGMQLHNSIGSAALCKVVSSIGPKLKTLSLKRVPHADDTVLQAIHEHCRDLKKLRITESEIMTD
KGFQELFTDWANTRLRIVDLEKCRHVDAAAPRINPLSRGLCSEGFKALMAHSGSKLENINVHACRHISGEAFEEV
FGPGTCYPELRKLEISFCEQVTDFILGCIFRACPKIREVNVFGCMKVKDVRVPRGVILVGVPNAQGMITEGE*
Coding >OphauB2|7958
ATGTACCTGTCTCGAAATATTACAGGGCCACAGTCAGCACTAACAGACTTTCTTGCGTCACACAACATCTCGGCC
AGGCAAATTCGAGAGGATGCAGAGCTGCGGCGACGACGAGCAGAGGCTGAAACTGGTGACAGCCAGCTGCAGACT
GATGAGACGGAAGCACCACAGCCTGCAGCAAGGAGGGCCAGCCGCCGCGTCGCAGCTAATACTGATGATGGAGGG
TTTGGTTTTCCATTTGATCAACGAACACTTGATGCTGCCAAGACCAAGAAAGCTATAAGAGCCTATTTGAAGCGG
AAAAAAGCCCATCCAGACGACGATGAAGATGAAGAAATAGAGCTCGCAATTTCAGAGTCTAAAGGAAATTCGATG
CCCGGACAGATGGAAAATTGTGCACATTGCGGGAAGCGCTTCACTGTAACACCCTATTCTGTCGCCGCGCCAGAA
GGCGGCCTTTTATGCGTTCCCTGCGGCAAAGAACTTGCCAGGGAACGCCATGGCCAACCCAAGAAGAAAGCACGG
AAACAGACGGGCGGCATAGGTAGCCGCCGTGCCCTCCAAAGTCGCATTCTTGACGGCGACGTTGGCACCAAGAGC
CTGGCTACGCTGTGTGTCCATACTTTGGCCAAGAATGTCGACATGGCGGATAGCTTGGGAGACTTGCCCGACCAC
CTCGTTGACAAGATTGCCCGGCTCTTTTCCAAGCGTCGGCTTCTCAAGTCAGAAACATTGCCTCTATTTGTGCAC
CCAGCGACGCATATCCTGCACATCTACGACGGCGCCAAACTTGGAGAGGAAGACTTCATGAGCATCTTCCAAACG
GCCTCCAAGTTGCGCCATTTCAAGGCCCGATGTGCCATTCAGTTCAAGGATGAAGTCATGGACTATTTGCTATCG
CGCAACATTGTCCTGGAAAGCTTTTACCTCCATGGGGCCAATCTCTTGAGCGAGGAGAAGTGGCACGAGTTTTTC
GCCGCAAAAGGAAACAGTCTACAGAGACTCCAAGTCTACTGTACCGACAAACACTTTGGCGATGAGAGCATCACC
ACTATTGCTAAACATTGCCCCAGTTTGCTTCGCCTCAAGGTGGAGCAGAACCAAAAACTCACAGACAAAGGGGTA
GAAGCCATGGCTGAGTTGTCGTCCCTGCAGCATCTCGGAATGCAGCTGCATAACAGTATAGGGTCTGCAGCTTTA
TGCAAGGTCGTTTCCAGCATTGGACCAAAGCTTAAGACCCTTTCTCTCAAGCGGGTGCCGCATGCAGATGACACT
GTCTTGCAGGCTATTCATGAGCACTGCCGAGACTTGAAGAAGCTGCGCATCACCGAGAGCGAAATTATGACGGAC
AAGGGTTTTCAAGAGCTCTTTACAGACTGGGCAAACACGCGACTGAGAATCGTCGACTTGGAAAAATGTCGACAT
GTCGATGCGGCGGCGCCTCGCATCAACCCCCTGTCAAGGGGCCTTTGCAGTGAGGGCTTCAAGGCACTCATGGCT
CATTCAGGTTCCAAGCTTGAAAACATCAATGTGCATGCCTGTCGCCACATCTCTGGAGAGGCATTTGAGGAGGTG
TTTGGCCCAGGCACGTGCTATCCGGAGCTGCGTAAGCTGGAGATAAGCTTTTGCGAACAGGTGACTGACTTTATC
CTTGGATGCATCTTTCGAGCATGCCCCAAGATTCGTGAAGTCAATGTTTTTGGGTGCATGAAGGTCAAGGATGTC
AGAGTGCCGCGGGGTGTTATCCTCGTTGGCGTGCCTAATGCACAGGGTATGATTACTGAGGGAGAATAG
Transcript >OphauB2|7958
ATGTACCTGTCTCGAAATATTACAGGGCCACAGTCAGCACTAACAGACTTTCTTGCGTCACACAACATCTCGGCC
AGGCAAATTCGAGAGGATGCAGAGCTGCGGCGACGACGAGCAGAGGCTGAAACTGGTGACAGCCAGCTGCAGACT
GATGAGACGGAAGCACCACAGCCTGCAGCAAGGAGGGCCAGCCGCCGCGTCGCAGCTAATACTGATGATGGAGGG
TTTGGTTTTCCATTTGATCAACGAACACTTGATGCTGCCAAGACCAAGAAAGCTATAAGAGCCTATTTGAAGCGG
AAAAAAGCCCATCCAGACGACGATGAAGATGAAGAAATAGAGCTCGCAATTTCAGAGTCTAAAGGAAATTCGATG
CCCGGACAGATGGAAAATTGTGCACATTGCGGGAAGCGCTTCACTGTAACACCCTATTCTGTCGCCGCGCCAGAA
GGCGGCCTTTTATGCGTTCCCTGCGGCAAAGAACTTGCCAGGGAACGCCATGGCCAACCCAAGAAGAAAGCACGG
AAACAGACGGGCGGCATAGGTAGCCGCCGTGCCCTCCAAAGTCGCATTCTTGACGGCGACGTTGGCACCAAGAGC
CTGGCTACGCTGTGTGTCCATACTTTGGCCAAGAATGTCGACATGGCGGATAGCTTGGGAGACTTGCCCGACCAC
CTCGTTGACAAGATTGCCCGGCTCTTTTCCAAGCGTCGGCTTCTCAAGTCAGAAACATTGCCTCTATTTGTGCAC
CCAGCGACGCATATCCTGCACATCTACGACGGCGCCAAACTTGGAGAGGAAGACTTCATGAGCATCTTCCAAACG
GCCTCCAAGTTGCGCCATTTCAAGGCCCGATGTGCCATTCAGTTCAAGGATGAAGTCATGGACTATTTGCTATCG
CGCAACATTGTCCTGGAAAGCTTTTACCTCCATGGGGCCAATCTCTTGAGCGAGGAGAAGTGGCACGAGTTTTTC
GCCGCAAAAGGAAACAGTCTACAGAGACTCCAAGTCTACTGTACCGACAAACACTTTGGCGATGAGAGCATCACC
ACTATTGCTAAACATTGCCCCAGTTTGCTTCGCCTCAAGGTGGAGCAGAACCAAAAACTCACAGACAAAGGGGTA
GAAGCCATGGCTGAGTTGTCGTCCCTGCAGCATCTCGGAATGCAGCTGCATAACAGTATAGGGTCTGCAGCTTTA
TGCAAGGTCGTTTCCAGCATTGGACCAAAGCTTAAGACCCTTTCTCTCAAGCGGGTGCCGCATGCAGATGACACT
GTCTTGCAGGCTATTCATGAGCACTGCCGAGACTTGAAGAAGCTGCGCATCACCGAGAGCGAAATTATGACGGAC
AAGGGTTTTCAAGAGCTCTTTACAGACTGGGCAAACACGCGACTGAGAATCGTCGACTTGGAAAAATGTCGACAT
GTCGATGCGGCGGCGCCTCGCATCAACCCCCTGTCAAGGGGCCTTTGCAGTGAGGGCTTCAAGGCACTCATGGCT
CATTCAGGTTCCAAGCTTGAAAACATCAATGTGCATGCCTGTCGCCACATCTCTGGAGAGGCATTTGAGGAGGTG
TTTGGCCCAGGCACGTGCTATCCGGAGCTGCGTAAGCTGGAGATAAGCTTTTGCGAACAGGTGACTGACTTTATC
CTTGGATGCATCTTTCGAGCATGCCCCAAGATTCGTGAAGTCAATGTTTTTGGGTGCATGAAGGTCAAGGATGTC
AGAGTGCCGCGGGGTGTTATCCTCGTTGGCGTGCCTAATGCACAGGGTATGATTACTGAGGGAGAATAG
Gene >OphauB2|7958
ATGTACGTATGATGCATCATCCTCACCCTGGTGGCTGAGTCTTTCGTTGCTAATGCTTTACACTTAGGGTTCGTA
CGAGAAACGATTACTCGGGACCAAATTCTGAGCAGCTGTCTCGAAATATTACAGGGCCGTTAGCATCACATGCCT
CTCTCGAGCTCTCTGCTGTTTACGGCTGACATTTGATTGCTTAGACAGTCAGCACTAACAGACTTTCTTGCGGTA
TGTAGACTGCTCTCATACTACTTGCTTCTCAAACTTACCGTCATGTAGTCACACAACATCTCGGCCAGGCAAATT
CGAGAGGATGCAGAGCTGCGGCGACGACGAGCAGAGGCTGAAACTGGTGACAGCCAGCTGCAGACTGATGAGACG
GAAGCACCACAGCCTGCAGCAAGGAGGGCCAGCCGCCGCGTCGCAGCTAATACTGATGATGGAGGGTTTGGTTTT
CCATTTGATCAACGAACACTTGATGCTGCCAAGACCAAGAAAGCTATAAGAGCCTATTTGAAGCGGAAAAAAGCC
CATCCAGACGACGATGAAGATGAAGAAATAGAGCTCGCAATTTCAGAGTCTAAAGGAAATTCGATGCCCGGACAG
ATGGAAAATTGTGCACATTGCGGGAAGCGCTTCACTGTAACACCCTATTCTGTCGCCGCGCCAGAAGGCGGCCTT
TTATGCGTTCCCTGCGGCAAAGAACTTGCCAGGGAACGCCATGGCCAACCCAAGAAGAAAGCACGGAAACAGACG
GGCGGCATAGGTAGCCGCCGTGCCCTCCAAAGTCGCATTCTTGACGGCGACGTTGGCACCAAGAGCCTGGCTACG
CTGTGTGTCCATACTTTGGCCAAGAATGTCGACATGGCGGATAGCTTGGGAGACTTGCCCGACCACCTCGTTGAC
AAGATTGCCCGGCTCTTTTCCAAGCGTCGGCTTCTCAAGTCAGAAACATTGCCTCTATTTGTGCACCCAGCGACG
CATATCCTGCACATCTACGACGGCGCCAAACTTGGAGAGGAAGACTTCATGAGCATCTTCCAAACGGCCTCCAAG
TTGCGCCATTTCAAGGCCCGATGTGCCATTCAGTTCAAGGATGAAGTCATGGACTATTTGCTATCGCGCAACATT
GTCCTGGAAAGCTTTTACCTCCATGGGGCCAATCTCTTGAGCGAGGAGAAGTGGCACGAGTTTTTCGCCGCAAAA
GGAAACAGTCTACAGAGACTCCAAGTCTACTGTACCGACAAACACTTTGGCGATGAGAGCATCACCACTATTGCT
AAACATTGCCCCAGTTTGCTTCGCCTCAAGGTGGAGCAGAACCAAAAACTCACAGACAAAGGGGTAGAAGCCATG
GCTGAGTTGTCGTCCCTGCAGCATCTCGGAATGCAGCTGCATAACAGTATAGGGTCTGCAGCTTTATGCAAGGTC
GTTTCCAGCATTGGACCAAAGCTTAAGACCCTTTCTCTCAAGCGGGTGCCGCATGCAGATGACACTGTCTTGCAG
GCTATTCATGAGCACTGCCGAGACTTGAAGAAGCTGCGCATCACCGAGAGCGAAATTATGACGGACAAGGGTTTT
CAAGAGCTCTTTACAGACTGGGCAAACACGCGACTGAGAATCGTCGACTTGGAAAAATGTCGACATGTCGATGCG
GCGGCGCCTCGCATCAACCCCCTGTCAAGGGGCCTTTGCAGTGAGGGCTTCAAGGCACTCATGGCTCATTCAGGT
TCCAAGCTTGAAAACATCAATGTGCATGCCTGTCGCCACATCTCTGGAGAGGCATTTGAGGAGGTGTTTGGCCCA
GGCACGTGCTATCCGGAGCTGCGTAAGCTGGAGATAAGCTTTTGCGAACAGGTGACTGACTTTATCCTTGGATGC
ATCTTTCGAGCATGCCCCAAGATTCGTGAAGTCAATGTTTTTGGGTGCATGAAGGTCAAGGATGTCAGAGTGCCG
CGGGGTGTTATCCTCGTTGGCGTGCCTAATGCACAGGGTATGATTACTGAGGGAGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail