Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7957
Gene name
LocationContig_91:36750..39988
Strand-
Gene length (bp)3238
Transcript length (bp)3081
Coding sequence length (bp)3081
Protein length (aa) 1027

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 2.6E-52 431 763
PF00271 Helicase_C Helicase conserved C-terminal domain 1.2E-15 855 969
PF04851 ResIII Type III restriction enzyme, res subunit 4.3E-07 432 596
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.9E-06 777 816

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 387 1023 0.0E+00
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 387 1023 0.0E+00
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 414 1024 1.0E-84
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 422 1023 2.0E-81
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 423 1023 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 387 1023 0.0E+00
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 387 1023 0.0E+00
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 414 1024 1.0E-84
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 422 1023 2.0E-81
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 423 1023 2.0E-78
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 416 1023 2.0E-78
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 414 1023 6.0E-78
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 473 1023 4.0E-73
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 443 1023 7.0E-73
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 435 1024 5.0E-72
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 473 999 6.0E-71
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 473 999 8.0E-71
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 473 999 1.0E-68
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 381 1023 2.0E-68
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 443 1013 2.0E-68
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 443 1013 3.0E-68
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 411 1023 9.0E-68
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 431 1023 2.0E-67
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 473 1023 1.0E-65
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 444 1023 1.0E-65
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 444 1023 1.0E-64
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 431 999 1.0E-64
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 435 1023 6.0E-64
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 442 999 3.0E-63
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 413 1001 5.0E-63
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 413 1023 3.0E-54
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 410 1026 3.0E-50
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 422 1024 1.0E-43
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 423 1014 6.0E-43
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 413 1026 3.0E-42
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 413 1023 4.0E-42
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 397 1023 4.0E-42
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 414 1026 2.0E-41
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 402 1023 3.0E-41
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 414 1026 7.0E-41
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 423 1010 9.0E-41
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 414 1026 1.0E-40
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 414 1026 3.0E-40
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 419 1023 9.0E-40
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 419 1023 2.0E-39
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 379 990 2.0E-39
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 398 999 2.0E-39
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 393 990 3.0E-39
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 420 990 3.0E-39
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 404 999 5.0E-39
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 403 1015 5.0E-39
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 420 990 1.0E-38
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 420 990 3.0E-38
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 422 990 4.0E-38
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 422 999 5.0E-38
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 420 990 7.0E-37
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 416 999 9.0E-36
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 444 766 2.0E-35
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 408 1004 4.0E-35
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 423 1003 1.0E-33
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 777 1023 1.0E-33
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 444 766 2.0E-33
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 397 990 4.0E-33
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 771 1008 6.0E-33
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 777 1002 1.0E-31
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 458 769 2.0E-30
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 777 1002 8.0E-30
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 431 763 1.0E-29
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 853 1023 1.0E-29
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 416 763 5.0E-27
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 416 763 2.0E-26
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 426 1004 5.0E-26
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 400 763 6.0E-26
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 416 763 8.0E-26
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 400 763 1.0E-25
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 410 763 2.0E-25
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 416 763 7.0E-25
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 410 763 1.0E-24
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 412 766 3.0E-24
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 269 766 3.0E-24
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 853 1024 1.0E-23
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 416 763 2.0E-23
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 415 763 3.0E-23
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 407 767 4.0E-23
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 874 1023 4.0E-23
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 423 1009 8.0E-23
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 855 1025 9.0E-23
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 853 1023 2.0E-22
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 851 990 2.0E-22
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 853 1023 3.0E-22
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 845 999 7.0E-22
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 854 1004 9.0E-22
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 410 619 1.0E-21
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 845 1022 1.0E-21
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 406 762 1.0E-21
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 414 611 1.0E-21
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 851 1019 1.0E-21
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 853 1023 2.0E-21
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 851 990 2.0E-21
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 855 990 2.0E-21
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 871 1023 2.0E-21
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 855 1015 3.0E-21
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 414 768 3.0E-21
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 853 1023 3.0E-21
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 853 1023 3.0E-21
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 414 611 3.0E-21
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 853 1023 3.0E-21
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 403 767 3.0E-21
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 412 763 3.0E-21
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 412 763 3.0E-21
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 873 990 3.0E-21
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 874 1023 4.0E-21
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 414 763 5.0E-21
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 422 763 5.0E-21
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 855 990 6.0E-21
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 871 1023 7.0E-21
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 853 1023 7.0E-21
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 416 763 8.0E-21
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 414 768 8.0E-21
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 851 1019 8.0E-21
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 855 1015 1.0E-20
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 855 1023 1.0E-20
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 854 1004 1.0E-20
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 416 763 1.0E-20
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 415 618 1.0E-20
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 851 1008 1.0E-20
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 408 611 1.0E-20
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 415 769 1.0E-20
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 383 763 1.0E-20
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 855 1015 2.0E-20
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 416 763 2.0E-20
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 383 763 2.0E-20
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 853 1023 2.0E-20
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 383 763 2.0E-20
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 415 618 2.0E-20
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 415 769 2.0E-20
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 851 1023 2.0E-20
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 415 768 2.0E-20
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 415 781 2.0E-20
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 852 990 2.0E-20
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 853 1023 3.0E-20
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 415 769 3.0E-20
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 423 763 3.0E-20
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 422 763 4.0E-20
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 840 1014 4.0E-20
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 415 769 4.0E-20
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 852 1023 4.0E-20
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 852 1004 4.0E-20
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 852 1023 4.0E-20
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 415 769 4.0E-20
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 852 1004 5.0E-20
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 415 763 5.0E-20
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 415 770 5.0E-20
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 873 1023 5.0E-20
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 852 1004 6.0E-20
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 853 1023 6.0E-20
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 872 990 6.0E-20
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 852 1023 6.0E-20
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 852 1023 6.0E-20
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 852 1023 6.0E-20
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 871 1004 7.0E-20
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 852 1006 7.0E-20
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 423 763 8.0E-20
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 423 763 8.0E-20
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 840 989 8.0E-20
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 415 767 8.0E-20
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 415 767 8.0E-20
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 415 769 8.0E-20
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 414 763 8.0E-20
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 853 999 8.0E-20
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 871 1004 9.0E-20
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 419 1017 9.0E-20
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 871 1015 1.0E-19
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 389 763 1.0E-19
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 413 763 1.0E-19
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 415 618 1.0E-19
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 873 1005 1.0E-19
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 847 1022 1.0E-19
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 847 1022 1.0E-19
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 847 1022 1.0E-19
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 847 1022 1.0E-19
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 872 1023 1.0E-19
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 853 1024 1.0E-19
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 863 990 2.0E-19
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 847 989 2.0E-19
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 847 989 2.0E-19
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 422 611 3.0E-19
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 422 611 3.0E-19
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 852 986 3.0E-19
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 855 1004 4.0E-19
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 416 766 4.0E-19
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 385 611 4.0E-19
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 847 990 4.0E-19
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 840 989 4.0E-19
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 356 767 4.0E-19
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 423 763 4.0E-19
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 873 1004 5.0E-19
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 852 1024 5.0E-19
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 411 618 6.0E-19
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 833 1022 7.0E-19
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 833 1022 7.0E-19
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 407 767 8.0E-19
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 423 779 8.0E-19
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 847 989 9.0E-19
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 867 1004 1.0E-18
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 854 996 1.0E-18
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 854 996 1.0E-18
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 351 611 1.0E-18
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 422 611 1.0E-18
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 414 619 1.0E-18
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 850 1024 1.0E-18
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 414 611 1.0E-18
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 414 779 1.0E-18
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 848 1006 2.0E-18
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 422 763 2.0E-18
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 414 763 2.0E-18
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 414 611 2.0E-18
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 852 1024 2.0E-18
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 423 611 3.0E-18
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 851 989 3.0E-18
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 407 764 3.0E-18
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 853 1023 3.0E-18
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 853 1023 3.0E-18
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 414 619 3.0E-18
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 871 1004 3.0E-18
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 871 1004 3.0E-18
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 848 1022 3.0E-18
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 414 611 4.0E-18
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 851 989 4.0E-18
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 415 768 4.0E-18
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 416 763 4.0E-18
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 851 989 4.0E-18
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 414 611 4.0E-18
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 414 619 4.0E-18
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 419 763 5.0E-18
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 419 763 5.0E-18
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 416 786 5.0E-18
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 852 1014 6.0E-18
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 413 611 6.0E-18
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 423 611 7.0E-18
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 414 763 8.0E-18
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 847 1012 9.0E-18
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 852 990 9.0E-18
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 423 611 9.0E-18
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 415 768 1.0E-17
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 416 611 1.0E-17
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 851 989 1.0E-17
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 851 989 1.0E-17
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 414 767 1.0E-17
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 850 1023 1.0E-17
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 851 989 2.0E-17
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 851 989 2.0E-17
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 851 989 2.0E-17
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 851 989 2.0E-17
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 851 989 2.0E-17
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 423 763 2.0E-17
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 853 1024 2.0E-17
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 853 1023 2.0E-17
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 422 763 2.0E-17
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 836 990 2.0E-17
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 423 763 2.0E-17
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 873 1024 2.0E-17
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 853 1024 2.0E-17
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 414 611 2.0E-17
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 851 989 3.0E-17
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 874 1008 3.0E-17
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 423 763 3.0E-17
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 423 763 3.0E-17
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 423 763 3.0E-17
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 415 767 3.0E-17
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 414 611 3.0E-17
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 423 634 3.0E-17
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 415 603 3.0E-17
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 876 999 4.0E-17
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 416 610 4.0E-17
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 423 763 4.0E-17
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 423 763 4.0E-17
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 852 1006 4.0E-17
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 850 1024 4.0E-17
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 423 763 4.0E-17
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 851 989 4.0E-17
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 419 612 5.0E-17
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 407 767 5.0E-17
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 851 989 6.0E-17
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 851 989 7.0E-17
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 416 763 7.0E-17
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 852 1005 7.0E-17
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 414 771 7.0E-17
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 414 767 8.0E-17
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 874 1004 9.0E-17
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 852 1016 9.0E-17
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 399 775 1.0E-16
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 413 611 1.0E-16
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 419 775 1.0E-16
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 876 999 1.0E-16
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 423 730 1.0E-16
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 852 990 1.0E-16
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 399 612 2.0E-16
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 419 643 2.0E-16
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 419 775 2.0E-16
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 412 611 2.0E-16
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 852 1016 2.0E-16
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 419 612 2.0E-16
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 419 612 2.0E-16
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 853 996 3.0E-16
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 853 1008 3.0E-16
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 842 1005 4.0E-16
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 419 775 4.0E-16
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 872 1004 4.0E-16
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 423 612 4.0E-16
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 416 611 5.0E-16
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 853 993 5.0E-16
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 419 612 6.0E-16
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 852 999 6.0E-16
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 852 996 6.0E-16
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 852 1024 6.0E-16
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 853 999 6.0E-16
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 852 989 7.0E-16
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 419 612 8.0E-16
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 813 1006 9.0E-16
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 423 763 9.0E-16
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 419 612 1.0E-15
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 398 612 1.0E-15
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 855 1006 1.0E-15
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 423 803 1.0E-15
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 414 767 1.0E-15
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 414 767 1.0E-15
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 872 990 1.0E-15
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 423 767 2.0E-15
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 414 619 2.0E-15
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 872 1023 2.0E-15
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 852 1026 2.0E-15
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 872 989 2.0E-15
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 852 989 3.0E-15
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 852 989 3.0E-15
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 852 989 3.0E-15
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 852 1024 3.0E-15
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 852 999 3.0E-15
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 414 616 3.0E-15
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 852 999 4.0E-15
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 411 611 4.0E-15
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 852 990 5.0E-15
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 414 767 5.0E-15
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 852 990 5.0E-15
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 876 1004 7.0E-15
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 876 1004 7.0E-15
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 876 1004 7.0E-15
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 416 611 7.0E-15
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 759 990 9.0E-15
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 851 1024 1.0E-14
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 851 1024 1.0E-14
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 852 990 1.0E-14
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 768 1023 1.0E-14
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 876 1009 3.0E-14
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 853 1023 3.0E-14
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 874 1023 3.0E-14
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 853 1023 3.0E-14
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 423 611 4.0E-14
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 851 1024 4.0E-14
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 423 612 4.0E-14
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 853 1023 4.0E-14
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 423 611 7.0E-14
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 852 990 1.0E-13
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 423 619 1.0E-13
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 419 612 1.0E-13
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 445 617 1.0E-13
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 895 989 1.0E-13
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 419 612 2.0E-13
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 853 1019 2.0E-13
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 417 612 2.0E-13
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 854 1023 3.0E-13
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 852 1012 4.0E-13
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 853 1023 6.0E-13
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 858 999 6.0E-13
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 858 999 6.0E-13
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 858 999 6.0E-13
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 853 1023 9.0E-13
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 416 608 1.0E-12
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 419 612 1.0E-12
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 852 1016 1.0E-12
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 853 1023 2.0E-12
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 416 608 2.0E-12
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 394 790 2.0E-12
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 852 1016 2.0E-12
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 858 999 2.0E-12
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 416 625 3.0E-12
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 419 611 3.0E-12
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 768 989 3.0E-12
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 872 986 4.0E-12
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 422 618 4.0E-12
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 832 1005 6.0E-12
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 766 990 9.0E-12
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 422 618 1.0E-11
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 422 618 1.0E-11
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 422 618 1.0E-11
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 830 995 1.0E-11
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 853 1023 2.0E-11
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 860 1023 6.0E-11
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 416 611 7.0E-11
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 860 1006 1.0E-10
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 419 612 2.0E-10
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 770 994 2.0E-10
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 412 611 2.0E-10
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 853 1023 4.0E-10
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 799 1005 5.0E-10
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 824 991 6.0E-10
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 853 1023 1.0E-09
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 860 1006 1.0E-09
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 853 1005 1.0E-09
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 412 763 2.0E-09
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 425 611 2.0E-09
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 896 998 2.0E-09
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 830 995 2.0E-09
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 853 1005 2.0E-09
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 842 1013 2.0E-09
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 869 979 3.0E-09
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 851 995 8.0E-09
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 840 972 9.0E-09
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 419 631 1.0E-08
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 416 624 2.0E-08
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 419 763 3.0E-08
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 874 1013 3.0E-08
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 874 1020 5.0E-08
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 413 611 5.0E-08
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 828 995 6.0E-08
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 443 601 7.0E-08
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 869 1007 8.0E-08
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 444 619 1.0E-07
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 444 619 2.0E-07
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 444 619 2.0E-07
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 444 619 2.0E-07
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 828 995 2.0E-07
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 830 995 2.0E-07
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 444 619 3.0E-07
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 874 986 3.0E-07
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 473 617 1.0E-06
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 473 617 1.0E-06
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 416 612 1.0E-06
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 416 612 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding Yes
GO:0003824 catalytic activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043169 cation binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3195
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6724
Ophiocordyceps australis map64 (Brazil) OphauB2|7957 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03520
Ophiocordyceps camponoti-rufipedis Ophun1|4616
Ophiocordyceps kimflemingae Ophio5|8479
Ophiocordyceps subramaniannii Hirsu2|574

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7957
MAPGRRLVPKTPEVPENEPGRLTRQSLTIKAGQGVSSRVSLVSDSSINSSQPAKRPRGRPPRASLAAAMESSPAL
VEAASLATRRLRPRNSSSSVAGSRSASTAPTTLDATSEGESSTRASTQASTPISTASSATPKSRLSNTSIQVHIP
SSSALQPDSERLLRTSVYSINHAPKHTKRQFQESDDEDELIDMSRDSQVARRLQREENAIHGTRLSKRIAPQTIK
DRIRATRASMRQNSSAKRVKVVEDSESQDDDLSDAKPELGLVSVVSEHDVSPRDEEFESDGDESYEDSPSEDELA
NRAPRPNTTTGTNPSFVHPIDEFLSNPITPATLGFSDPEDASSAINVVPIDDGSSDSDDDNSRRLVLTRPRGYRA
GNSRRMKKERSRLEHHHPEIVTMWTELEKMPLLKPGKAEQPSTISRRLKPFQLEGLAWMKEMEKTKWKGGLLGDE
MGLGKTIQAVSLIMSDYPAKQPSLVLVPPVALMQWQSEIKSYTDGTLKTFVFHTTNQQTKGITAKELRKYDVIMM
SYNSLESMYRKQEKGFKRKAGLYKEKSVIHSIHFHRVILDEAHCIKTRTTMTAKACFALKTDYRWCLTGTPLQNR
IGEFFSLVRFLNMTPFASYLCKQCSCSSLEWQMNDVTRCRQCDHAGMQHVSVFNQELLNPIQKFGNYGPGRQAFS
KLRLMTGHIMLRRLKKDHTNSMELPVKEVYVDRQFFGEEENDFANSIMTNGQRKFDTYVAQGVLLNNYANIFGLI
MQMRQVADHPDLILKKDSEGGQNVLVCCICDEPAEDTVRSRCKHDFCRACVTSYVHSTEQPDCPRCHIALSIDLE
QPEIEQEEALMKKNSIINRIKMDKWTSSSKIELLVHELHRLRSDNASHKSIIFSQFTTMLQLIEWRLRRAGITTV
MLDGSMTPAQRQASIEHFMNNVDVECFLVSLKAGGVALNLTEASRVFIVDPWWNPAAEWQSADRCHRIGQTRPCS
VTRLCIEDSVESRMVLIQEKKTSMINSTVNADDKAMDSLSPEDMQFLFRGS*
Coding >OphauB2|7957
ATGGCTCCCGGACGCCGCCTCGTCCCAAAGACGCCGGAAGTGCCAGAAAATGAACCTGGGCGGCTGACACGTCAA
AGTTTGACCATTAAGGCTGGTCAGGGAGTCAGTTCCAGAGTCTCCCTGGTCTCCGATTCGTCGATAAATTCTTCG
CAACCAGCTAAACGTCCACGAGGACGTCCTCCTCGTGCCTCACTTGCAGCTGCTATGGAATCTTCACCTGCCCTG
GTCGAGGCTGCATCGCTAGCCACAAGGCGCTTACGCCCTAGGAACAGCAGTTCGTCTGTTGCTGGCAGTCGCTCT
GCTTCAACCGCCCCCACGACTTTAGATGCCACATCTGAGGGAGAATCCTCCACAAGAGCGTCTACCCAGGCTTCG
ACGCCTATATCTACCGCTTCTTCTGCGACCCCAAAATCTAGATTGTCCAATACTTCTATTCAAGTACATATTCCG
AGCAGTTCAGCCTTGCAGCCAGACAGCGAACGCTTGTTACGAACCAGTGTCTATTCAATAAACCATGCGCCCAAA
CACACCAAGCGCCAATTTCAAGAGAGCGACGATGAGGACGAGTTAATAGATATGTCTCGCGACTCTCAAGTTGCT
CGCCGACTTCAACGAGAAGAAAATGCCATACACGGTACGAGATTGAGCAAAAGAATTGCACCACAAACCATAAAG
GATCGCATTCGTGCCACACGCGCCTCGATGCGACAGAATTCATCAGCTAAGAGGGTCAAAGTTGTGGAAGACTCG
GAGTCGCAAGATGATGACTTATCTGATGCAAAACCGGAACTAGGGTTGGTTAGCGTCGTCTCGGAGCACGATGTT
AGCCCACGAGACGAAGAATTCGAATCGGATGGTGATGAGTCTTACGAAGATTCTCCGTCGGAAGATGAACTGGCA
AATCGTGCGCCTAGGCCAAATACTACTACGGGAACGAACCCGTCCTTTGTACATCCTATTGACGAGTTTTTGTCA
AACCCTATCACGCCTGCTACTCTGGGTTTTAGTGACCCGGAAGATGCTTCATCTGCCATTAATGTTGTCCCCATA
GATGATGGGTCTAGCGACAGCGATGACGACAACTCCAGGAGATTGGTCTTGACTCGCCCACGTGGCTACAGAGCG
GGCAACTCACGGCGCATGAAGAAGGAGCGTAGCCGACTGGAGCACCACCATCCAGAAATTGTTACCATGTGGACG
GAATTGGAGAAGATGCCGCTTCTCAAACCTGGCAAAGCTGAGCAGCCATCGACAATTTCTCGACGTCTCAAACCT
TTTCAGCTTGAGGGCCTGGCTTGGATGAAGGAGATGGAAAAGACCAAATGGAAAGGCGGCCTTCTCGGAGATGAG
ATGGGCTTGGGAAAAACTATCCAAGCCGTGTCTCTCATAATGTCGGATTATCCCGCCAAGCAACCATCCTTGGTG
CTTGTCCCTCCTGTGGCCCTCATGCAATGGCAATCTGAGATCAAGTCGTATACCGACGGCACGCTCAAGACGTTT
GTCTTTCACACCACGAACCAGCAGACCAAGGGAATCACAGCAAAGGAGCTGCGCAAGTACGATGTCATTATGATG
TCTTACAATAGTCTTGAGTCTATGTACCGAAAGCAGGAAAAGGGCTTCAAGCGCAAAGCTGGCCTTTACAAGGAG
AAGAGTGTTATCCACTCCATTCATTTCCATCGCGTTATTCTCGATGAGGCTCATTGCATCAAGACGCGGACAACC
ATGACTGCAAAGGCATGTTTTGCACTCAAGACGGACTATCGCTGGTGTCTTACAGGCACTCCACTACAAAACCGT
ATTGGAGAGTTCTTTTCACTCGTCAGGTTTCTCAACATGACGCCGTTTGCCTCGTACCTTTGCAAGCAGTGCTCA
TGCTCATCTCTCGAGTGGCAGATGAATGACGTTACGCGATGCAGACAATGCGACCACGCTGGAATGCAGCACGTC
TCCGTCTTCAACCAAGAGTTGCTCAACCCAATCCAAAAGTTTGGCAACTATGGTCCTGGCAGACAGGCTTTCAGC
AAGCTAAGACTTATGACTGGGCATATCATGCTCCGTCGGCTCAAGAAAGATCACACCAACTCAATGGAGCTCCCC
GTCAAGGAGGTTTACGTGGACCGTCAGTTTTTTGGTGAGGAAGAAAATGACTTTGCCAATAGCATCATGACGAAT
GGACAACGCAAGTTCGACACATACGTTGCGCAGGGCGTGCTGCTCAACAACTATGCTAATATATTTGGCCTAATC
ATGCAGATGCGTCAGGTTGCTGACCATCCCGACCTTATACTAAAGAAGGATTCTGAAGGCGGGCAAAATGTTCTC
GTGTGCTGCATCTGCGACGAGCCGGCCGAGGACACGGTGCGCAGTAGATGCAAGCACGACTTTTGCCGCGCCTGT
GTGACGAGCTACGTGCACTCTACAGAACAGCCAGACTGCCCCCGCTGTCACATTGCCCTGTCAATCGACCTTGAG
CAACCCGAAATCGAGCAGGAAGAGGCGCTCATGAAGAAGAACTCCATTATCAACCGCATCAAGATGGACAAGTGG
ACATCGTCATCCAAGATTGAACTGCTGGTCCACGAGTTGCATCGCCTGCGCTCAGACAATGCTTCGCACAAGTCC
ATCATCTTTTCGCAGTTTACCACTATGCTGCAACTAATCGAGTGGCGTTTGCGTCGCGCGGGCATCACGACTGTT
ATGTTGGATGGAAGCATGACGCCGGCACAACGCCAGGCGTCGATTGAGCATTTTATGAACAATGTCGATGTGGAG
TGCTTTCTTGTGTCTCTCAAGGCGGGTGGCGTGGCACTCAATTTGACCGAGGCATCTCGCGTCTTCATTGTCGAT
CCGTGGTGGAACCCTGCGGCGGAATGGCAATCTGCCGACCGCTGCCATCGCATCGGCCAGACGCGCCCGTGCAGT
GTTACGCGACTTTGCATCGAAGACTCTGTTGAGAGTCGCATGGTACTTATTCAGGAAAAGAAGACGAGCATGATC
AACTCGACGGTCAATGCTGACGACAAGGCCATGGATTCGCTCAGCCCCGAGGACATGCAGTTCCTGTTTCGTGGC
TCTTAG
Transcript >OphauB2|7957
ATGGCTCCCGGACGCCGCCTCGTCCCAAAGACGCCGGAAGTGCCAGAAAATGAACCTGGGCGGCTGACACGTCAA
AGTTTGACCATTAAGGCTGGTCAGGGAGTCAGTTCCAGAGTCTCCCTGGTCTCCGATTCGTCGATAAATTCTTCG
CAACCAGCTAAACGTCCACGAGGACGTCCTCCTCGTGCCTCACTTGCAGCTGCTATGGAATCTTCACCTGCCCTG
GTCGAGGCTGCATCGCTAGCCACAAGGCGCTTACGCCCTAGGAACAGCAGTTCGTCTGTTGCTGGCAGTCGCTCT
GCTTCAACCGCCCCCACGACTTTAGATGCCACATCTGAGGGAGAATCCTCCACAAGAGCGTCTACCCAGGCTTCG
ACGCCTATATCTACCGCTTCTTCTGCGACCCCAAAATCTAGATTGTCCAATACTTCTATTCAAGTACATATTCCG
AGCAGTTCAGCCTTGCAGCCAGACAGCGAACGCTTGTTACGAACCAGTGTCTATTCAATAAACCATGCGCCCAAA
CACACCAAGCGCCAATTTCAAGAGAGCGACGATGAGGACGAGTTAATAGATATGTCTCGCGACTCTCAAGTTGCT
CGCCGACTTCAACGAGAAGAAAATGCCATACACGGTACGAGATTGAGCAAAAGAATTGCACCACAAACCATAAAG
GATCGCATTCGTGCCACACGCGCCTCGATGCGACAGAATTCATCAGCTAAGAGGGTCAAAGTTGTGGAAGACTCG
GAGTCGCAAGATGATGACTTATCTGATGCAAAACCGGAACTAGGGTTGGTTAGCGTCGTCTCGGAGCACGATGTT
AGCCCACGAGACGAAGAATTCGAATCGGATGGTGATGAGTCTTACGAAGATTCTCCGTCGGAAGATGAACTGGCA
AATCGTGCGCCTAGGCCAAATACTACTACGGGAACGAACCCGTCCTTTGTACATCCTATTGACGAGTTTTTGTCA
AACCCTATCACGCCTGCTACTCTGGGTTTTAGTGACCCGGAAGATGCTTCATCTGCCATTAATGTTGTCCCCATA
GATGATGGGTCTAGCGACAGCGATGACGACAACTCCAGGAGATTGGTCTTGACTCGCCCACGTGGCTACAGAGCG
GGCAACTCACGGCGCATGAAGAAGGAGCGTAGCCGACTGGAGCACCACCATCCAGAAATTGTTACCATGTGGACG
GAATTGGAGAAGATGCCGCTTCTCAAACCTGGCAAAGCTGAGCAGCCATCGACAATTTCTCGACGTCTCAAACCT
TTTCAGCTTGAGGGCCTGGCTTGGATGAAGGAGATGGAAAAGACCAAATGGAAAGGCGGCCTTCTCGGAGATGAG
ATGGGCTTGGGAAAAACTATCCAAGCCGTGTCTCTCATAATGTCGGATTATCCCGCCAAGCAACCATCCTTGGTG
CTTGTCCCTCCTGTGGCCCTCATGCAATGGCAATCTGAGATCAAGTCGTATACCGACGGCACGCTCAAGACGTTT
GTCTTTCACACCACGAACCAGCAGACCAAGGGAATCACAGCAAAGGAGCTGCGCAAGTACGATGTCATTATGATG
TCTTACAATAGTCTTGAGTCTATGTACCGAAAGCAGGAAAAGGGCTTCAAGCGCAAAGCTGGCCTTTACAAGGAG
AAGAGTGTTATCCACTCCATTCATTTCCATCGCGTTATTCTCGATGAGGCTCATTGCATCAAGACGCGGACAACC
ATGACTGCAAAGGCATGTTTTGCACTCAAGACGGACTATCGCTGGTGTCTTACAGGCACTCCACTACAAAACCGT
ATTGGAGAGTTCTTTTCACTCGTCAGGTTTCTCAACATGACGCCGTTTGCCTCGTACCTTTGCAAGCAGTGCTCA
TGCTCATCTCTCGAGTGGCAGATGAATGACGTTACGCGATGCAGACAATGCGACCACGCTGGAATGCAGCACGTC
TCCGTCTTCAACCAAGAGTTGCTCAACCCAATCCAAAAGTTTGGCAACTATGGTCCTGGCAGACAGGCTTTCAGC
AAGCTAAGACTTATGACTGGGCATATCATGCTCCGTCGGCTCAAGAAAGATCACACCAACTCAATGGAGCTCCCC
GTCAAGGAGGTTTACGTGGACCGTCAGTTTTTTGGTGAGGAAGAAAATGACTTTGCCAATAGCATCATGACGAAT
GGACAACGCAAGTTCGACACATACGTTGCGCAGGGCGTGCTGCTCAACAACTATGCTAATATATTTGGCCTAATC
ATGCAGATGCGTCAGGTTGCTGACCATCCCGACCTTATACTAAAGAAGGATTCTGAAGGCGGGCAAAATGTTCTC
GTGTGCTGCATCTGCGACGAGCCGGCCGAGGACACGGTGCGCAGTAGATGCAAGCACGACTTTTGCCGCGCCTGT
GTGACGAGCTACGTGCACTCTACAGAACAGCCAGACTGCCCCCGCTGTCACATTGCCCTGTCAATCGACCTTGAG
CAACCCGAAATCGAGCAGGAAGAGGCGCTCATGAAGAAGAACTCCATTATCAACCGCATCAAGATGGACAAGTGG
ACATCGTCATCCAAGATTGAACTGCTGGTCCACGAGTTGCATCGCCTGCGCTCAGACAATGCTTCGCACAAGTCC
ATCATCTTTTCGCAGTTTACCACTATGCTGCAACTAATCGAGTGGCGTTTGCGTCGCGCGGGCATCACGACTGTT
ATGTTGGATGGAAGCATGACGCCGGCACAACGCCAGGCGTCGATTGAGCATTTTATGAACAATGTCGATGTGGAG
TGCTTTCTTGTGTCTCTCAAGGCGGGTGGCGTGGCACTCAATTTGACCGAGGCATCTCGCGTCTTCATTGTCGAT
CCGTGGTGGAACCCTGCGGCGGAATGGCAATCTGCCGACCGCTGCCATCGCATCGGCCAGACGCGCCCGTGCAGT
GTTACGCGACTTTGCATCGAAGACTCTGTTGAGAGTCGCATGGTACTTATTCAGGAAAAGAAGACGAGCATGATC
AACTCGACGGTCAATGCTGACGACAAGGCCATGGATTCGCTCAGCCCCGAGGACATGCAGTTCCTGTTTCGTGGC
TCTTAG
Gene >OphauB2|7957
ATGGCTCCCGGACGCCGCCTCGTCCCAAAGACGCCGGAAGTGCCAGGTACACTATTTCCTTTTCTACTGAGACTT
TTGGCTGGACTACTAACGCGACATGCCTTAGAAAATGAACCTGGGCGGCTGACACGTCAAAGTTTGACCATTAAG
GCTGGTCAGGGAGTCAGTTCCAGAGTCTCCCTGGTCTCCGATTCGTCGATAAATTCTTCGCAACCAGCTAAACGT
CCACGAGGACGTCCTCCTCGTGCCTCACTTGCAGCTGCTATGGAATCTTCACCTGCCCTGGTCGAGGCTGCATCG
CTAGCCACAAGGCGCTTACGCCCTAGGAACAGCAGTTCGTCTGTTGCTGGCAGTCGCTCTGCTTCAACCGCCCCC
ACGACTTTAGATGCCACATCTGAGGGAGAATCCTCCACAAGAGCGTCTACCCAGGCTTCGACGCCTATATCTACC
GCTTCTTCTGCGACCCCAAAATCTAGATTGTCCAATACTTCTATTCAAGTACATATTCCGAGCAGTTCAGCCTTG
CAGCCAGACAGCGAACGCTTGTTACGAACCAGTGTCTATTCAATAAACCATGCGCCCAAACACACCAAGCGCCAA
TTTCAAGAGAGCGACGATGAGGACGAGTTAATAGATATGTCTCGCGACTCTCAAGTTGCTCGCCGACTTCAACGA
GAAGAAAATGCCATACACGGTACGAGATTGAGCAAAAGAATTGCACCACAAACCATAAAGGATCGCATTCGTGCC
ACACGCGCCTCGATGCGACAGAATTCATCAGCTAAGAGGGTCAAAGTTGTGGAAGACTCGGAGTCGCAAGATGAT
GACTTATCTGATGCAAAACCGGAACTAGGGTTGGTTAGCGTCGTCTCGGAGCACGATGTTAGCCCACGAGACGAA
GAATTCGAATCGGATGGTGATGAGTCTTACGAAGATTCTCCGTCGGAAGATGAACTGGCAAATCGTGCGCCTAGG
CCAAATACTACTACGGGAACGAACCCGTCCTTTGTACATCCTATTGACGAGTTTTTGTCAAACCCTATCACGCCT
GCTACTCTGGGTTTTAGTGACCCGGAAGATGCTTCATCTGCCATTAATGTTGTCCCCATAGATGATGGGTCTAGC
GACAGCGATGACGACAACTCCAGGAGATTGGTCTTGACTCGCCCACGTGGCTACAGAGCGGGCAACTCACGGCGC
ATGAAGAAGGAGCGTAGCCGACTGGAGCACCACCATCCAGAAATTGTTACCATGTGGACGGAATTGGAGAAGATG
CCGCTTCTCAAACCTGGCAAAGCTGAGCAGCCATCGACAATTTCTCGACGTCTCAAACCTTTTCAGCTTGAGGGC
CTGGCTTGGATGAAGGAGATGGAAAAGACCAAATGGAAAGGCGGCCTTCTCGGAGATGAGATGGGCTTGGGAAAA
ACTATCCAAGCCGTGTCTCTCATAATGTCGGATTATCCCGCCAAGCAACCATCCTTGGTGCTTGTCCCTCCTGTG
GCCCTCATGCAATGGCAATCTGAGATCAAGTCGTATACCGACGGCACGCTCAAGACGTTTGTCTTTCACACCACG
AACCAGCAGACCAAGGGAATCACAGCAAAGGAGCTGCGCAAGTACGATGTCATTATGATGTCTTACAATAGTCTT
GAGTCTATGTACCGAAAGCAGGAAAAGGGCTTCAAGCGCAAAGCTGGCCTTTACAAGGAGAAGAGTGTTATCCAC
TCCATTCATTTCCATCGCGTTATTCTCGATGAGGCTCATTGCATCAAGACGCGGACAACCATGACTGCAAAGGCA
TGTTTTGCACTCAAGACGGACTATCGCTGGTGTCTTACAGGCACTCCACTACAAAACCGTATTGGAGAGTTCTTT
TCACTCGTCAGGTTTCTCAACATGACGCCGTTTGCCTCGTACCTTTGCAAGCAGTGCTCATGCTCATCTCTCGAG
TGGCAGATGAATGACGTTACGCGATGCAGACAATGCGACCACGCTGGAATGCAGCACGTCTCCGTCTTCAACCAA
GAGTTGCTCAACCCAATCCAAAAGTTTGGCAACTATGGTCCTGGCAGACAGGCTTTCAGCAAGCTAAGACTTATG
ACTGGGCATATCATGCTCCGTCGGCTCAAGAAAGATCACACCAACTCAATGGAGCTCCCCGTCAAGGAGGTTTAC
GTGGACCGTCAGTTTTTTGGTGAGGAAGAAAATGACTTTGCCAATAGCATCATGACGAATGGACAACGCAAGTTC
GACACATACGTTGCGCAGGGCGTGCTGCTCAACAACTATGCTAATATATTTGGCCTAATCATGCAGATGCGTCAG
GTTGCTGACCATCCCGACCTTATACTAAAGAAGGATTCTGAAGGCGGGCAAAATGTTCTCGTGTGCTGCATCTGC
GACGAGCCGGCCGAGGACACGGTGCGCAGTAGATGCAAGCACGACTTTTGCCGCGCCTGTGTGACGAGCTACGTG
CACTCTACAGAACAGCCAGACTGCCCCCGCTGTCACATTGCCCTGTCAATCGACCTTGAGCAACCCGAAATCGAG
CAGGAAGAGGCGCTCATGAAGAAGAACTCCATTATCAACCGCATCAAGATGGACAAGTGGACATCGTCATCCAAG
ATTGAACTGCTGGTCCACGAGTTGCATCGCCTGCGCTCAGACAATGCTTCGCACAAGTCCATCATCTTTTCGCAG
TTTACCACTATGCTGCAACTAATCGAGTGGCGTTTGCGTCGCGCGGGCATCACGACTGTTATGTTGGATGGAAGC
ATGACGCCGGCACAACGCCAGGCGTCGATTGAGCATTTTATGAACAATGTCGATGTGGAGTGCTTTCTTGTGTCT
CTCAAGGCGGGTGGCGTGGCACTCAATTTGACCGAGGCATCTCGCGTCTTCATTGTCGATCCGTAAGTTACTTTT
TTTTTTTTTTTTCACTCCACCATTTTTTACCGCATTTACACCAGTCATTGCTTTGAAAGAGTTTTGCTCACAATG
TGAATATAGGTGGTGGAACCCTGCGGCGGAATGGCAATCTGCCGACCGCTGCCATCGCATCGGCCAGACGCGCCC
GTGCAGTGTTACGCGACTTTGCATCGAAGACTCTGTTGAGAGTCGCATGGTACTTATTCAGGAAAAGAAGACGAG
CATGATCAACTCGACGGTCAATGCTGACGACAAGGCCATGGATTCGCTCAGCCCCGAGGACATGCAGTTCCTGTT
TCGTGGCTCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail