Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7956
Gene name
LocationContig_91:34975..35947
Strand+
Gene length (bp)972
Transcript length (bp)687
Coding sequence length (bp)687
Protein length (aa) 229

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain 2.0E-31 145 228
PF10587 EF-1_beta_acid Eukaryotic elongation factor 1 beta central acidic region 2.4E-12 107 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30151|EF1B_XENLA Elongation factor 1-beta OS=Xenopus laevis GN=eef1b PE=1 SV=3 1 228 7.0E-77
sp|O74173|EF1B_SCHPO Elongation factor 1-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef5 PE=2 SV=1 1 228 4.0E-73
sp|Q6DET9|EF1B_XENTR Elongation factor 1-beta OS=Xenopus tropicalis GN=eef1b PE=2 SV=3 1 228 1.0E-70
sp|P24534|EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens GN=EEF1B2 PE=1 SV=3 1 228 8.0E-70
sp|Q5E983|EF1B_BOVIN Elongation factor 1-beta OS=Bos taurus GN=EEF1B PE=2 SV=3 1 228 5.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30151|EF1B_XENLA Elongation factor 1-beta OS=Xenopus laevis GN=eef1b PE=1 SV=3 1 228 7.0E-77
sp|O74173|EF1B_SCHPO Elongation factor 1-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef5 PE=2 SV=1 1 228 4.0E-73
sp|Q6DET9|EF1B_XENTR Elongation factor 1-beta OS=Xenopus tropicalis GN=eef1b PE=2 SV=3 1 228 1.0E-70
sp|P24534|EF1B_HUMAN Elongation factor 1-beta OS=Homo sapiens GN=EEF1B2 PE=1 SV=3 1 228 8.0E-70
sp|Q5E983|EF1B_BOVIN Elongation factor 1-beta OS=Bos taurus GN=EEF1B PE=2 SV=3 1 228 5.0E-69
sp|P34826|EF1B_RABIT Elongation factor 1-beta OS=Oryctolagus cuniculus GN=EEF1B PE=1 SV=2 1 228 1.0E-68
sp|O70251|EF1B_MOUSE Elongation factor 1-beta OS=Mus musculus GN=Eef1b PE=1 SV=5 1 228 5.0E-68
sp|Q9YGQ1|EF1B_CHICK Elongation factor 1-beta OS=Gallus gallus GN=EEF1B PE=2 SV=3 1 228 6.0E-68
sp|P12262|EF1B_ARTSA Elongation factor 1-beta OS=Artemia salina PE=1 SV=3 1 228 2.0E-65
sp|Q9GRF8|EF1B_DICDI Elongation factor 1-beta OS=Dictyostelium discoideum GN=efa1B PE=1 SV=1 2 228 3.0E-56
sp|P29522|EF1B2_BOMMO Elongation factor 1-beta' OS=Bombyx mori PE=1 SV=2 1 228 3.0E-53
sp|P78590|EF1B_CANAW Elongation factor 1-beta OS=Candida albicans (strain WO-1) GN=EFB1 PE=3 SV=1 1 228 4.0E-53
sp|O96827|EF1B_DROME Probable elongation factor 1-beta OS=Drosophila melanogaster GN=Ef1beta PE=1 SV=3 1 228 1.0E-51
sp|A5D989|EF1D_BOVIN Elongation factor 1-delta OS=Bos taurus GN=EEF1D PE=2 SV=2 105 228 4.0E-50
sp|P34460|EF1B1_CAEEL Probable elongation factor 1-beta/1-delta 1 OS=Caenorhabditis elegans GN=eef-1B.1 PE=1 SV=1 5 228 2.0E-49
sp|P29693|EF1D_XENLA Elongation factor 1-delta OS=Xenopus laevis GN=eef1d PE=1 SV=1 107 228 3.0E-49
sp|Q4R3D4|EF1D_MACFA Elongation factor 1-delta OS=Macaca fascicularis GN=EEF1D PE=2 SV=2 92 228 6.0E-49
sp|P53787|EF1D_RABIT Elongation factor 1-delta OS=Oryctolagus cuniculus GN=EEF1D PE=2 SV=1 107 228 6.0E-49
sp|P29692|EF1D_HUMAN Elongation factor 1-delta OS=Homo sapiens GN=EEF1D PE=1 SV=5 92 228 9.0E-49
sp|P32192|EF1D_ARTSA Elongation factor 1-delta OS=Artemia salina PE=1 SV=2 93 228 9.0E-49
sp|P29412|EF1B_PIG Elongation factor 1-beta OS=Sus scrofa GN=EEF1B PE=1 SV=1 2 228 9.0E-47
sp|P93447|EF1D_PIMBR Elongation factor 1-delta OS=Pimpinella brachycarpa PE=2 SV=3 3 228 7.0E-46
sp|Q68FR9|EF1D_RAT Elongation factor 1-delta OS=Rattus norvegicus GN=Eef1d PE=1 SV=2 92 228 8.0E-46
sp|P57776|EF1D_MOUSE Elongation factor 1-delta OS=Mus musculus GN=Eef1d PE=1 SV=3 92 228 6.0E-45
sp|P32471|EF1B_YEAST Elongation factor 1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFB1 PE=1 SV=4 1 228 2.0E-41
sp|Q717R8|EF1D_SHEEP Elongation factor 1-delta OS=Ovis aries GN=EEF1D PE=2 SV=1 105 228 5.0E-41
sp|Q9SI20|EF1D2_ARATH Elongation factor 1-delta 2 OS=Arabidopsis thaliana GN=At2g18110 PE=1 SV=1 3 228 5.0E-41
sp|P48006|EF1D1_ARATH Elongation factor 1-delta 1 OS=Arabidopsis thaliana GN=At1g30230 PE=1 SV=2 3 228 7.0E-40
sp|Q9VL18|EF1D_DROME Probable elongation factor 1-delta OS=Drosophila melanogaster GN=eEF1delta PE=1 SV=1 93 228 1.0E-38
sp|Q40680|EF1D1_ORYSJ Elongation factor 1-delta 1 OS=Oryza sativa subsp. japonica GN=Os07g0614500 PE=2 SV=3 1 228 4.0E-38
sp|Q40682|EF1D2_ORYSJ Elongation factor 1-delta 2 OS=Oryza sativa subsp. japonica GN=Os03g0406200 PE=2 SV=3 8 228 4.0E-38
sp|P29545|EF1B_ORYSJ Elongation factor 1-beta OS=Oryza sativa subsp. japonica GN=Os07g0662500 PE=1 SV=3 3 228 2.0E-35
sp|Q84WM9|EF1B1_ARATH Elongation factor 1-beta 1 OS=Arabidopsis thaliana GN=At5g12110 PE=2 SV=2 3 228 3.0E-33
sp|O81918|EF1D_BETVU Elongation factor 1-delta OS=Beta vulgaris PE=2 SV=3 3 228 4.0E-32
sp|Q9SCX3|EF1B2_ARATH Elongation factor 1-beta 2 OS=Arabidopsis thaliana GN=At5g19510 PE=1 SV=1 3 228 2.0E-30
sp|P29546|EF1B_WHEAT Elongation factor 1-beta OS=Triticum aestivum PE=1 SV=2 3 228 7.0E-30
sp|Q9U2H9|EF1B2_CAEEL Probable elongation factor 1-beta/1-delta 2 OS=Caenorhabditis elegans GN=eef-1B.2 PE=1 SV=4 102 228 1.0E-29
sp|P34827|EF1B_TRYCR 25 kDa elongation factor 1-beta OS=Trypanosoma cruzi PE=2 SV=1 13 228 9.0E-26
sp|Q9ER72|SYCC_MOUSE Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2 15 60 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003746 translation elongation factor activity Yes
GO:0006414 translational elongation Yes
GO:0044249 cellular biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0009059 macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008135 translation factor activity, RNA binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0045182 translation regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7956
MGFVDFLSDAGLGMLNNWLATRSYITGYSASQADVACFKALSSQPNPEKFPHAARWYTHVATFEPEFGNLAGDAS
KPYTVYGPDKAEVTLNPAKAPATAADDDDVDLFGSDEEEDAEAARVREERLAEYRKKKEAKPKTTAKSVVTMDVK
PWDDETDMAALEAAVRSIDKDGLVWGASKLVTVGFGIKKLQINLVVEDEKISLDELQEEIAEFDDYVQSSDVAAM
QKL*
Coding >OphauB2|7956
ATGGGTTTTGTCGACTTTCTCTCCGATGCTGGCCTTGGCATGTTGAATAACTGGCTGGCCACTCGGTCCTACATT
ACCGGCTACTCCGCCTCGCAGGCCGACGTGGCTTGCTTCAAGGCTCTCAGCTCCCAGCCTAATCCCGAGAAATTC
CCCCATGCGGCTCGATGGTACACACATGTGGCCACGTTTGAGCCCGAGTTTGGCAACCTGGCGGGCGACGCCAGC
AAGCCCTACACCGTCTATGGCCCCGATAAGGCAGAGGTGACGCTCAACCCCGCAAAGGCACCCGCCACTGCCGCC
GACGATGATGACGTCGACTTGTTTGGTAGCGATGAAGAGGAGGACGCAGAGGCGGCGCGCGTTCGCGAGGAGCGC
TTGGCAGAGTACCGCAAGAAGAAGGAGGCCAAGCCCAAGACGACGGCAAAGTCTGTCGTCACCATGGATGTTAAG
CCCTGGGATGACGAAACAGACATGGCCGCCCTCGAGGCCGCCGTCCGCAGCATTGATAAAGACGGCCTTGTTTGG
GGTGCCTCCAAGCTCGTCACTGTCGGCTTCGGCATCAAGAAGCTGCAAATCAACCTCGTTGTCGAGGATGAGAAA
ATCAGTCTCGACGAACTCCAGGAGGAAATCGCCGAGTTCGACGACTACGTTCAGTCCTCCGACGTCGCCGCCATG
CAGAAGCTCTAG
Transcript >OphauB2|7956
ATGGGTTTTGTCGACTTTCTCTCCGATGCTGGCCTTGGCATGTTGAATAACTGGCTGGCCACTCGGTCCTACATT
ACCGGCTACTCCGCCTCGCAGGCCGACGTGGCTTGCTTCAAGGCTCTCAGCTCCCAGCCTAATCCCGAGAAATTC
CCCCATGCGGCTCGATGGTACACACATGTGGCCACGTTTGAGCCCGAGTTTGGCAACCTGGCGGGCGACGCCAGC
AAGCCCTACACCGTCTATGGCCCCGATAAGGCAGAGGTGACGCTCAACCCCGCAAAGGCACCCGCCACTGCCGCC
GACGATGATGACGTCGACTTGTTTGGTAGCGATGAAGAGGAGGACGCAGAGGCGGCGCGCGTTCGCGAGGAGCGC
TTGGCAGAGTACCGCAAGAAGAAGGAGGCCAAGCCCAAGACGACGGCAAAGTCTGTCGTCACCATGGATGTTAAG
CCCTGGGATGACGAAACAGACATGGCCGCCCTCGAGGCCGCCGTCCGCAGCATTGATAAAGACGGCCTTGTTTGG
GGTGCCTCCAAGCTCGTCACTGTCGGCTTCGGCATCAAGAAGCTGCAAATCAACCTCGTTGTCGAGGATGAGAAA
ATCAGTCTCGACGAACTCCAGGAGGAAATCGCCGAGTTCGACGACTACGTTCAGTCCTCCGACGTCGCCGCCATG
CAGAAGCTCTAG
Gene >OphauB2|7956
ATGGGTTTTGTCGACTTTCTCTCCGATGCTGGCCTTGGCAGTAAGTTGAGCCGCAGGGAAGCTGGGCCGTGGGCA
AAAGGGCGAGCAAAGCTAATCAAGATTCAAGTGTTGAATAACTGGCTGGCCACTCGGTCCTACATTACCGGGTAT
GCAAATCTCGTCATGCTCTATAAATGCTTTTTTCCCCTTGGAATGCAATCAAGTCTTGCTGTATACCCTTGGCCA
AAGCTTTGGCATCTTGACCAAGCTGCTAACGCCTCGGTGCACAGCTACTCCGCCTCGCAGGCCGACGTGGCTTGC
TTCAAGGCTCTCAGCTCCCAGCCTAATCCCGAGAAATTCCCCCATGCGGCTCGATGGTACACACATGTGGCCACG
TTTGAGCCCGAGTTTGGCAACCTGGCGGGCGACGCCAGCAAGCCCTACACCGTCTATGGCCCCGATAAGGCAGAG
GTGACGCTCAACCCCGCAAAGGCACCCGCCACTGCCGCCGACGATGATGACGTCGACTTGTTTGGTAGCGATGAA
GAGGAGGACGCAGAGGCGGCGCGCGTTCGCGAGGAGCGCTTGGCAGAGTACCGCAAGAAGAAGGAGGCCAAGCCC
AAGACGACGGCAAAGTCTGTCGTCACCATGGATGTTAAGCCCTGGGGTAAATCACTCTCCTCCTTTGACTTTTCC
CTACCAGAATCTCTTGTTGGGTTGCTTTTGATGTTTGACTCGATCCACATACTAATCGCGTATACAGATGACGAA
ACAGACATGGCCGCCCTCGAGGCCGCCGTCCGCAGCATTGATAAAGACGGCCTTGTTTGGGGTGCCTCCAAGCTC
GTCACTGTCGGCTTCGGCATCAAGAAGCTGCAAATCAACCTCGTTGTCGAGGATGAGAAAATCAGTCTCGACGAA
CTCCAGGAGGAAATCGCCGAGTTCGACGACTACGTTCAGTCCTCCGACGTCGCCGCCATGCAGAAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail