Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7955
Gene name
LocationContig_91:32370..34254
Strand+
Gene length (bp)1884
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.6E-13 192 283
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.7E-17 256 343
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.6E-14 357 447
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.7E-13 458 551
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.1E-13 524 607
PF13637 Ank_4 Ankyrin repeats (many copies) 3.5E-10 252 306
PF13637 Ank_4 Ankyrin repeats (many copies) 4.1E-09 353 406
PF13637 Ank_4 Ankyrin repeats (many copies) 5.7E-05 396 440
PF13637 Ank_4 Ankyrin repeats (many copies) 1.7E-09 454 506
PF13637 Ank_4 Ankyrin repeats (many copies) 5.4E-06 522 574
PF13637 Ank_4 Ankyrin repeats (many copies) 5.1E-06 555 607
PF13606 Ank_3 Ankyrin repeat 1.6E-04 252 280
PF13857 Ank_5 Ankyrin repeats (many copies) 3.6E-09 377 428
PF00023 Ank Ankyrin repeat 2.4E-02 217 249
PF00023 Ank Ankyrin repeat 6.4E-03 253 283
PF00023 Ank Ankyrin repeat 7.6E-03 287 309
PF00023 Ank Ankyrin repeat 1.7E-04 386 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 127 613 1.0E-38
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 180 583 4.0E-38
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 180 583 6.0E-38
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 180 583 5.0E-37
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 215 617 8.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 127 613 1.0E-38
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 180 583 4.0E-38
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 180 583 6.0E-38
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 180 583 5.0E-37
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 215 617 8.0E-37
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 191 617 3.0E-36
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 216 611 5.0E-36
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 190 607 7.0E-36
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 190 607 1.0E-35
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 191 617 1.0E-35
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 215 607 1.0E-35
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 190 607 2.0E-35
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 191 607 2.0E-35
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 203 583 4.0E-35
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 169 617 2.0E-34
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 191 613 2.0E-34
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 191 613 3.0E-34
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 203 617 4.0E-33
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 216 611 6.0E-33
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 190 609 1.0E-32
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 253 607 2.0E-32
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 179 607 5.0E-32
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 203 607 5.0E-31
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 191 617 6.0E-31
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 169 617 7.0E-31
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 113 607 7.0E-31
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 203 610 1.0E-30
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 212 613 1.0E-30
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 246 607 8.0E-30
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 216 607 8.0E-30
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 189 607 1.0E-29
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 215 609 2.0E-29
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 173 607 2.0E-29
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 203 595 3.0E-29
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 244 607 3.0E-29
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 203 595 5.0E-29
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 187 607 6.0E-29
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 143 607 6.0E-29
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 190 607 7.0E-29
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 169 617 7.0E-29
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 113 611 8.0E-29
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 175 609 1.0E-28
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 186 607 2.0E-28
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 190 607 3.0E-28
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 212 583 4.0E-28
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 212 583 4.0E-28
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 187 607 4.0E-28
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 186 607 4.0E-28
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 212 599 4.0E-28
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 212 607 5.0E-28
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 204 610 5.0E-28
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 113 611 6.0E-28
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 189 607 7.0E-28
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 113 611 7.0E-28
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 212 599 8.0E-28
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 192 605 8.0E-28
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 178 607 1.0E-27
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 189 607 1.0E-27
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 202 607 6.0E-27
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 216 608 7.0E-27
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 215 609 2.0E-26
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 217 601 2.0E-26
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 216 609 2.0E-26
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 243 607 2.0E-26
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 179 607 2.0E-26
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 254 607 2.0E-26
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 192 605 4.0E-26
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 216 608 6.0E-26
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 179 607 6.0E-26
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 179 607 8.0E-26
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 285 612 8.0E-26
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 244 607 9.0E-26
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 186 607 2.0E-25
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 218 608 2.0E-25
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 243 607 2.0E-25
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 218 609 2.0E-25
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 244 607 3.0E-25
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 192 605 5.0E-25
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 212 607 7.0E-25
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 212 607 7.0E-25
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 220 617 1.0E-24
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 214 550 1.0E-24
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 211 609 1.0E-24
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 203 565 2.0E-24
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 220 617 2.0E-24
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 214 550 2.0E-24
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 219 605 2.0E-24
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 243 607 2.0E-24
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 289 607 3.0E-24
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 285 607 3.0E-24
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 204 607 5.0E-24
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 218 607 5.0E-24
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 212 607 6.0E-24
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 212 607 7.0E-24
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 216 611 8.0E-24
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 255 599 9.0E-24
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 301 607 1.0E-23
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 214 548 2.0E-23
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 171 617 2.0E-23
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 252 599 3.0E-23
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 112 615 3.0E-23
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 203 592 3.0E-23
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 211 617 3.0E-23
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 218 563 3.0E-23
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 218 607 4.0E-23
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 260 607 4.0E-23
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 204 607 5.0E-23
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 216 611 5.0E-23
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 180 477 5.0E-23
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 203 487 6.0E-23
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 252 599 2.0E-22
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 180 442 2.0E-22
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 214 575 2.0E-22
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 349 611 3.0E-22
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 188 607 3.0E-22
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 205 509 3.0E-22
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 211 617 3.0E-22
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 337 607 4.0E-22
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 220 617 5.0E-22
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 203 592 5.0E-22
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 216 611 7.0E-22
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 260 607 9.0E-22
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 179 540 9.0E-22
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 322 612 1.0E-21
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 202 577 2.0E-21
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 247 585 2.0E-21
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 211 577 3.0E-21
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 203 595 4.0E-21
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 246 607 5.0E-21
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 188 615 5.0E-21
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 173 607 5.0E-21
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 224 585 8.0E-21
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 142 609 9.0E-21
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 286 607 9.0E-21
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 203 595 9.0E-21
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 213 607 9.0E-21
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 199 604 1.0E-20
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 350 607 1.0E-20
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 218 553 1.0E-20
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 187 523 1.0E-20
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 199 607 1.0E-20
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 187 523 1.0E-20
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 224 578 2.0E-20
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 142 592 2.0E-20
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 248 607 3.0E-20
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 169 540 3.0E-20
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 283 617 3.0E-20
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 203 607 3.0E-20
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 249 541 3.0E-20
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 237 445 3.0E-20
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 246 607 5.0E-20
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 246 607 8.0E-20
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 246 607 1.0E-19
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 292 627 1.0E-19
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 237 578 1.0E-19
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 212 544 1.0E-19
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 214 551 2.0E-19
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 215 550 2.0E-19
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 345 617 3.0E-19
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 378 608 3.0E-19
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 248 512 4.0E-19
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 252 592 4.0E-19
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 329 607 5.0E-19
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 386 607 6.0E-19
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 353 608 6.0E-19
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 181 443 1.0E-18
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 246 607 1.0E-18
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 163 508 1.0E-18
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 349 607 3.0E-18
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 218 562 3.0E-18
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 286 599 4.0E-18
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 378 613 4.0E-18
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 256 607 4.0E-18
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 353 607 6.0E-18
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 355 607 8.0E-18
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 225 609 9.0E-18
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 212 539 9.0E-18
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 218 607 9.0E-18
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 200 577 1.0E-17
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 346 608 1.0E-17
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 224 562 1.0E-17
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 259 524 1.0E-17
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 378 613 2.0E-17
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 191 607 2.0E-17
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 191 607 2.0E-17
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 375 607 2.0E-17
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 187 605 2.0E-17
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 378 608 2.0E-17
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 378 608 2.0E-17
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 191 480 2.0E-17
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 213 607 2.0E-17
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 201 609 3.0E-17
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 258 528 3.0E-17
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 346 613 3.0E-17
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 356 607 3.0E-17
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 210 607 4.0E-17
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 191 607 4.0E-17
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 377 598 4.0E-17
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 289 607 4.0E-17
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 225 573 4.0E-17
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 191 541 5.0E-17
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 378 613 5.0E-17
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 191 558 5.0E-17
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 356 609 6.0E-17
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 251 613 7.0E-17
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 225 573 7.0E-17
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 212 607 8.0E-17
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 171 541 8.0E-17
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 356 607 8.0E-17
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 221 607 8.0E-17
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 191 541 9.0E-17
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 356 609 1.0E-16
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 318 613 1.0E-16
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 248 517 1.0E-16
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 356 607 1.0E-16
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 231 582 1.0E-16
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 191 558 2.0E-16
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 199 595 2.0E-16
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 345 608 2.0E-16
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 378 612 2.0E-16
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 355 596 2.0E-16
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 191 480 2.0E-16
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 225 559 2.0E-16
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 322 612 2.0E-16
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 378 606 2.0E-16
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 219 433 3.0E-16
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 378 606 3.0E-16
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 353 607 3.0E-16
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 353 607 3.0E-16
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 353 607 3.0E-16
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 235 614 4.0E-16
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 235 582 4.0E-16
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 229 607 5.0E-16
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 203 405 6.0E-16
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 191 480 6.0E-16
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 274 582 7.0E-16
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 235 614 8.0E-16
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 240 542 8.0E-16
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 216 434 9.0E-16
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 342 607 1.0E-15
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 290 597 1.0E-15
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 290 597 1.0E-15
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 249 607 1.0E-15
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 348 607 1.0E-15
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 355 596 1.0E-15
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 353 607 1.0E-15
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 353 607 1.0E-15
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 191 445 2.0E-15
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 159 441 2.0E-15
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 378 608 2.0E-15
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 470 618 2.0E-15
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 455 612 2.0E-15
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 251 612 2.0E-15
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 302 618 2.0E-15
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 204 475 2.0E-15
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 191 558 3.0E-15
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 191 445 3.0E-15
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 274 595 3.0E-15
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 217 577 3.0E-15
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 354 618 3.0E-15
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 355 609 3.0E-15
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 254 579 4.0E-15
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 267 586 4.0E-15
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 235 614 4.0E-15
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 251 612 4.0E-15
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 251 463 4.0E-15
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 320 613 6.0E-15
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 159 539 6.0E-15
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 375 607 7.0E-15
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 314 543 7.0E-15
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 218 612 7.0E-15
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 246 607 8.0E-15
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 217 577 9.0E-15
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 365 626 1.0E-14
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 346 595 1.0E-14
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 218 554 1.0E-14
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 346 613 1.0E-14
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 202 443 1.0E-14
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 418 618 1.0E-14
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 450 607 1.0E-14
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 255 607 1.0E-14
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 171 512 1.0E-14
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 204 473 1.0E-14
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 348 614 2.0E-14
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 254 607 2.0E-14
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 359 609 2.0E-14
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 359 609 2.0E-14
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 346 607 2.0E-14
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 464 613 2.0E-14
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 229 441 2.0E-14
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 251 463 2.0E-14
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 251 463 2.0E-14
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 251 463 2.0E-14
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 347 592 2.0E-14
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 246 445 2.0E-14
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 365 595 3.0E-14
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 263 442 3.0E-14
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 212 539 3.0E-14
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 352 575 3.0E-14
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 225 599 3.0E-14
sp|Q5UQZ7|YR901_MIMIV Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 164 473 3.0E-14
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 204 434 3.0E-14
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 403 607 3.0E-14
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 367 607 3.0E-14
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 222 518 3.0E-14
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 367 592 3.0E-14
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 375 607 4.0E-14
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 173 541 4.0E-14
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 246 441 4.0E-14
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 322 612 4.0E-14
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 455 625 4.0E-14
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 290 524 4.0E-14
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 290 524 4.0E-14
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 428 610 5.0E-14
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 171 441 5.0E-14
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 347 592 5.0E-14
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 181 599 6.0E-14
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 187 539 6.0E-14
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 253 546 6.0E-14
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 353 599 6.0E-14
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 290 524 6.0E-14
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 210 512 7.0E-14
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 337 577 7.0E-14
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 367 607 7.0E-14
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 214 573 8.0E-14
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 182 443 8.0E-14
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 237 429 8.0E-14
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 250 577 8.0E-14
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 327 594 9.0E-14
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 259 547 9.0E-14
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 255 625 9.0E-14
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 304 607 9.0E-14
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 203 580 9.0E-14
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 351 607 1.0E-13
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 210 546 1.0E-13
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 212 607 1.0E-13
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 237 429 1.0E-13
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 237 429 1.0E-13
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 237 429 1.0E-13
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 204 475 1.0E-13
sp|P17442|PHO81_YEAST Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 246 524 1.0E-13
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 321 607 1.0E-13
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 321 607 1.0E-13
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 222 518 1.0E-13
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 457 589 1.0E-13
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 455 625 1.0E-13
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 180 341 2.0E-13
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 320 574 2.0E-13
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 259 589 2.0E-13
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 212 417 2.0E-13
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 208 541 2.0E-13
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 304 607 2.0E-13
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 219 545 2.0E-13
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 388 599 2.0E-13
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 222 518 2.0E-13
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 237 440 2.0E-13
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 383 618 2.0E-13
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 251 541 2.0E-13
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 359 625 2.0E-13
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 188 518 2.0E-13
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 288 570 2.0E-13
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 376 618 3.0E-13
sp|Q6NSI1|AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 454 624 3.0E-13
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 237 441 3.0E-13
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 455 607 3.0E-13
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 457 589 3.0E-13
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 415 618 3.0E-13
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 244 409 3.0E-13
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 337 577 4.0E-13
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 337 577 4.0E-13
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 367 592 4.0E-13
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 244 409 4.0E-13
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 367 592 4.0E-13
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 171 540 5.0E-13
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 280 581 5.0E-13
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 333 607 5.0E-13
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 353 577 5.0E-13
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 455 607 5.0E-13
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 171 577 5.0E-13
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 254 611 5.0E-13
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 220 623 6.0E-13
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 354 607 6.0E-13
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 203 544 6.0E-13
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 333 607 6.0E-13
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 455 626 6.0E-13
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 455 607 6.0E-13
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 207 540 7.0E-13
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 455 607 7.0E-13
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 455 607 7.0E-13
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 204 438 8.0E-13
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 455 625 8.0E-13
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 237 441 8.0E-13
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 455 607 8.0E-13
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 354 595 8.0E-13
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 237 440 8.0E-13
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 195 441 9.0E-13
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 399 619 9.0E-13
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 288 483 9.0E-13
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 288 483 9.0E-13
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 246 441 9.0E-13
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 327 577 9.0E-13
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 259 527 9.0E-13
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 211 424 1.0E-12
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 206 410 1.0E-12
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 476 607 1.0E-12
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 199 419 1.0E-12
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 251 463 1.0E-12
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 211 440 1.0E-12
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 220 607 1.0E-12
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 388 599 1.0E-12
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 288 483 1.0E-12
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 480 607 1.0E-12
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 195 607 1.0E-12
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 237 440 1.0E-12
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 237 440 1.0E-12
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 277 607 1.0E-12
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 455 607 1.0E-12
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 356 595 1.0E-12
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 231 446 1.0E-12
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 454 622 1.0E-12
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 231 409 1.0E-12
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 356 595 1.0E-12
sp|Q811D2|ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 450 607 1.0E-12
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 219 409 1.0E-12
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 356 595 1.0E-12
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 288 607 2.0E-12
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 207 587 2.0E-12
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 113 516 2.0E-12
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 277 597 2.0E-12
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 199 419 2.0E-12
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 199 419 2.0E-12
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 301 520 2.0E-12
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 292 625 2.0E-12
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 359 573 2.0E-12
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 359 573 2.0E-12
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 222 557 2.0E-12
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 451 607 2.0E-12
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 455 607 2.0E-12
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 455 607 2.0E-12
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 346 607 2.0E-12
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 469 614 2.0E-12
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 417 618 2.0E-12
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 390 624 2.0E-12
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 455 607 2.0E-12
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 383 579 2.0E-12
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 203 342 2.0E-12
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 455 626 2.0E-12
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 237 429 3.0E-12
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 237 440 3.0E-12
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 359 573 3.0E-12
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 359 573 3.0E-12
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 455 607 3.0E-12
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 455 607 3.0E-12
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 455 607 3.0E-12
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 383 579 3.0E-12
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 383 579 3.0E-12
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 455 607 3.0E-12
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 455 607 3.0E-12
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 455 607 3.0E-12
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 231 409 3.0E-12
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 246 610 3.0E-12
sp|Q1RJR4|Y319_RICBR Putative ankyrin repeat protein RBE_0319 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0319 PE=4 SV=1 344 614 3.0E-12
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 290 597 4.0E-12
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 313 550 4.0E-12
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 246 483 4.0E-12
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 190 491 4.0E-12
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 190 491 4.0E-12
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 201 443 4.0E-12
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 359 573 4.0E-12
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 353 547 4.0E-12
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 455 607 4.0E-12
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 353 603 4.0E-12
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 455 607 4.0E-12
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 211 424 5.0E-12
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 375 607 5.0E-12
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 354 607 5.0E-12
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 191 390 5.0E-12
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 359 573 5.0E-12
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 457 589 6.0E-12
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 424 608 6.0E-12
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 218 554 7.0E-12
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 225 428 7.0E-12
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 254 498 7.0E-12
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 379 607 7.0E-12
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 455 607 7.0E-12
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 313 550 8.0E-12
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 177 561 8.0E-12
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 191 589 9.0E-12
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 303 524 9.0E-12
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 356 615 9.0E-12
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 231 409 9.0E-12
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 390 623 9.0E-12
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 222 557 9.0E-12
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 351 607 1.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 350 607 1.0E-11
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 457 607 1.0E-11
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 180 407 1.0E-11
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 218 448 1.0E-11
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 215 443 1.0E-11
sp|Q5UQZ7|YR901_MIMIV Putative ankyrin repeat protein R901 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R901 PE=3 SV=1 194 529 1.0E-11
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 246 483 1.0E-11
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 220 540 1.0E-11
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 350 599 1.0E-11
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 368 608 1.0E-11
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 457 607 1.0E-11
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 366 574 1.0E-11
sp|Q5CZ79|AN20B_HUMAN Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 454 607 1.0E-11
sp|Q03017|CACT_DROME NF-kappa-B inhibitor cactus OS=Drosophila melanogaster GN=cact PE=1 SV=2 420 607 1.0E-11
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 228 618 1.0E-11
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 350 607 2.0E-11
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 170 407 2.0E-11
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 457 607 2.0E-11
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 225 613 2.0E-11
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 348 607 2.0E-11
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 191 405 2.0E-11
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 246 483 2.0E-11
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 259 483 2.0E-11
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 254 538 2.0E-11
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 366 574 2.0E-11
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 191 508 2.0E-11
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 219 409 2.0E-11
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 468 607 2.0E-11
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 269 441 2.0E-11
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 245 497 2.0E-11
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 383 614 2.0E-11
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 288 474 2.0E-11
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 349 610 2.0E-11
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 358 542 2.0E-11
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 215 541 2.0E-11
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 351 614 3.0E-11
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 203 472 3.0E-11
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 188 412 3.0E-11
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 225 428 3.0E-11
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 354 590 3.0E-11
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 354 590 3.0E-11
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 354 590 3.0E-11
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 366 574 3.0E-11
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 254 538 3.0E-11
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 187 420 3.0E-11
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 366 574 3.0E-11
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 354 590 3.0E-11
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 366 574 3.0E-11
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 353 611 3.0E-11
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 241 409 3.0E-11
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 241 409 3.0E-11
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 241 409 3.0E-11
sp|Q875S9|AKR1_LACK1 Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 428 607 3.0E-11
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 307 581 3.0E-11
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 251 442 4.0E-11
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 398 607 4.0E-11
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 398 607 4.0E-11
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 238 577 4.0E-11
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 287 607 4.0E-11
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 366 574 4.0E-11
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 354 590 4.0E-11
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 354 506 4.0E-11
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 468 607 4.0E-11
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 353 547 4.0E-11
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 455 607 4.0E-11
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 455 607 4.0E-11
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 455 607 4.0E-11
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 290 524 4.0E-11
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 455 607 4.0E-11
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 455 607 4.0E-11
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 356 579 4.0E-11
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 254 577 4.0E-11
sp|G3V8T1|MPP8_RAT M-phase phosphoprotein 8 OS=Rattus norvegicus GN=Mphosph8 PE=2 SV=1 449 609 4.0E-11
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 289 594 4.0E-11
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 359 541 5.0E-11
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 356 541 5.0E-11
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 356 541 5.0E-11
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 191 340 5.0E-11
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 399 607 5.0E-11
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 187 420 5.0E-11
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 354 590 5.0E-11
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 212 430 5.0E-11
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 354 506 5.0E-11
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 187 420 5.0E-11
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 287 577 5.0E-11
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 448 613 5.0E-11
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 448 613 5.0E-11
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 215 541 5.0E-11
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 383 583 5.0E-11
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 384 607 5.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 416 623 6.0E-11
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 290 506 6.0E-11
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 311 597 6.0E-11
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 204 428 6.0E-11
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 188 340 6.0E-11
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 256 545 6.0E-11
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 378 577 6.0E-11
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 354 506 6.0E-11
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 127 577 6.0E-11
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 366 574 6.0E-11
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 356 625 6.0E-11
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 356 541 6.0E-11
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 461 608 6.0E-11
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 454 607 6.0E-11
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 454 607 6.0E-11
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 220 411 6.0E-11
sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 383 583 6.0E-11
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 290 524 6.0E-11
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 236 593 7.0E-11
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 160 409 7.0E-11
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 454 620 7.0E-11
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 187 420 7.0E-11
sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 383 573 7.0E-11
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 188 574 8.0E-11
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 352 580 8.0E-11
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 254 558 8.0E-11
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 251 442 9.0E-11
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 356 541 9.0E-11
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 254 441 9.0E-11
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 352 580 9.0E-11
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 352 580 9.0E-11
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 188 340 9.0E-11
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 256 614 9.0E-11
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 455 607 9.0E-11
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 461 608 9.0E-11
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 180 407 1.0E-10
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 359 607 1.0E-10
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 249 428 1.0E-10
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 188 340 1.0E-10
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 190 491 1.0E-10
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 188 340 1.0E-10
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 322 561 1.0E-10
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 354 590 1.0E-10
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 187 420 1.0E-10
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 457 605 1.0E-10
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 356 611 1.0E-10
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 356 611 1.0E-10
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 288 474 1.0E-10
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 356 611 1.0E-10
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 325 595 1.0E-10
sp|Q3TYA6|MPP8_MOUSE M-phase phosphoprotein 8 OS=Mus musculus GN=Mphosph8 PE=1 SV=1 414 609 1.0E-10
sp|P83757|CACT_DROYA NF-kappa-B inhibitor cactus OS=Drosophila yakuba GN=cact PE=3 SV=1 420 607 1.0E-10
sp|Q99549|MPP8_HUMAN M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 414 577 1.0E-10
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 375 607 2.0E-10
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 243 614 2.0E-10
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 224 607 2.0E-10
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 204 443 2.0E-10
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 251 442 2.0E-10
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 359 541 2.0E-10
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 266 441 2.0E-10
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 266 441 2.0E-10
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 266 441 2.0E-10
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 354 583 2.0E-10
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 188 340 2.0E-10
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 354 506 2.0E-10
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 354 625 2.0E-10
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 254 538 2.0E-10
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 354 590 2.0E-10
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 353 539 2.0E-10
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 354 590 2.0E-10
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 187 420 2.0E-10
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 454 607 2.0E-10
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 354 540 2.0E-10
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 354 506 2.0E-10
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 246 342 2.0E-10
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 354 557 2.0E-10
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 320 540 2.0E-10
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 256 441 2.0E-10
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 288 474 2.0E-10
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 457 607 2.0E-10
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 454 607 2.0E-10
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 486 607 2.0E-10
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 225 441 2.0E-10
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 454 607 2.0E-10
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 288 474 2.0E-10
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 375 607 3.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 356 607 3.0E-10
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 484 607 3.0E-10
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 453 618 3.0E-10
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 179 409 3.0E-10
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 225 428 3.0E-10
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 359 610 3.0E-10
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 228 417 3.0E-10
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 418 613 3.0E-10
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 181 562 3.0E-10
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 266 441 3.0E-10
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 187 420 3.0E-10
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 254 441 3.0E-10
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 254 451 3.0E-10
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 354 590 3.0E-10
sp|Q1RJR4|Y319_RICBR Putative ankyrin repeat protein RBE_0319 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0319 PE=4 SV=1 186 447 3.0E-10
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 354 590 3.0E-10
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 457 616 3.0E-10
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 211 545 3.0E-10
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 171 341 3.0E-10
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 320 540 3.0E-10
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 428 591 3.0E-10
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 212 409 3.0E-10
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 461 608 3.0E-10
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 290 579 3.0E-10
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 351 607 4.0E-10
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 206 494 4.0E-10
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 445 607 4.0E-10
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 224 607 4.0E-10
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 191 398 4.0E-10
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 204 342 4.0E-10
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 204 342 4.0E-10
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 354 506 4.0E-10
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 254 441 4.0E-10
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 354 506 4.0E-10
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 354 506 4.0E-10
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 254 441 4.0E-10
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 352 575 4.0E-10
sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 158 409 4.0E-10
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 254 545 4.0E-10
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 246 342 4.0E-10
sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 380 575 4.0E-10
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 356 561 4.0E-10
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 244 441 4.0E-10
sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 395 573 4.0E-10
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 191 573 5.0E-10
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 202 342 5.0E-10
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 354 621 5.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 219 450 5.0E-10
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 187 420 5.0E-10
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 356 573 5.0E-10
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 462 607 5.0E-10
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 226 429 5.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 356 611 5.0E-10
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 246 379 5.0E-10
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 423 605 5.0E-10
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 259 527 5.0E-10
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 252 441 5.0E-10
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 191 440 6.0E-10
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 188 311 6.0E-10
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 188 311 6.0E-10
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 454 607 6.0E-10
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 366 574 6.0E-10
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 366 574 6.0E-10
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 214 607 6.0E-10
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 221 459 6.0E-10
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 356 579 6.0E-10
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 439 607 6.0E-10
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 288 474 6.0E-10
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 147 481 7.0E-10
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 356 563 7.0E-10
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 204 342 7.0E-10
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 266 441 7.0E-10
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 188 340 7.0E-10
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 366 574 7.0E-10
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 203 341 7.0E-10
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 155 512 7.0E-10
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 480 607 7.0E-10
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 254 595 8.0E-10
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 191 455 8.0E-10
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 354 506 8.0E-10
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 368 617 8.0E-10
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 454 607 8.0E-10
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 356 614 8.0E-10
sp|G3I6Z6|NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 380 575 8.0E-10
sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 380 575 8.0E-10
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 380 575 8.0E-10
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 246 574 8.0E-10
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 191 340 9.0E-10
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 187 420 9.0E-10
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 254 441 9.0E-10
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 354 590 9.0E-10
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 388 599 9.0E-10
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 256 441 9.0E-10
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 184 339 9.0E-10
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 454 607 9.0E-10
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 256 614 1.0E-09
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 191 573 1.0E-09
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 249 541 1.0E-09
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 224 491 1.0E-09
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 212 510 1.0E-09
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 280 561 1.0E-09
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 249 428 1.0E-09
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 177 561 1.0E-09
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 385 610 1.0E-09
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 368 558 1.0E-09
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 454 620 1.0E-09
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 190 491 1.0E-09
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 188 340 1.0E-09
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 218 473 1.0E-09
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 259 541 1.0E-09
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 454 607 1.0E-09
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 254 441 1.0E-09
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 254 441 1.0E-09
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 320 539 1.0E-09
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 256 506 1.0E-09
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 459 625 1.0E-09
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 203 341 1.0E-09
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 191 420 1.0E-09
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 353 613 1.0E-09
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 359 556 1.0E-09
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 287 539 1.0E-09
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 354 575 1.0E-09
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 356 579 1.0E-09
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 287 539 1.0E-09
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 385 620 1.0E-09
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 356 579 1.0E-09
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 287 539 1.0E-09
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 243 441 1.0E-09
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 253 592 1.0E-09
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 353 529 1.0E-09
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 356 611 1.0E-09
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 243 441 1.0E-09
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 215 541 1.0E-09
sp|Q6BP80|AKR1_DEBHA Palmitoyltransferase AKR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AKR1 PE=3 SV=2 457 610 1.0E-09
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 215 541 1.0E-09
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 212 410 2.0E-09
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 450 610 2.0E-09
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 216 437 2.0E-09
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 188 340 2.0E-09
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 254 441 2.0E-09
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 246 434 2.0E-09
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 187 420 2.0E-09
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 254 506 2.0E-09
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 354 590 2.0E-09
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 220 405 2.0E-09
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 356 595 2.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 205 409 2.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 267 449 2.0E-09
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 205 409 2.0E-09
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 267 449 2.0E-09
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 225 440 2.0E-09
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 225 440 2.0E-09
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 187 340 2.0E-09
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 350 598 2.0E-09
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 173 474 2.0E-09
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 347 575 2.0E-09
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 203 577 2.0E-09
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 254 483 2.0E-09
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 485 607 2.0E-09
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 286 607 2.0E-09
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 464 607 2.0E-09
sp|Q04861|NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 356 587 2.0E-09
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 244 441 2.0E-09
sp|A2ARS0|ANR63_MOUSE Ankyrin repeat domain-containing protein 63 OS=Mus musculus GN=Ankrd63 PE=1 SV=1 188 340 2.0E-09
sp|Q63ZY3|KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=KANK2 PE=1 SV=1 395 573 2.0E-09
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 464 607 2.0E-09
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 250 577 2.0E-09
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 448 607 2.0E-09
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 320 591 2.0E-09
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 457 607 3.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 478 612 3.0E-09
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 450 610 3.0E-09
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 290 550 3.0E-09
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 292 607 3.0E-09
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 171 340 3.0E-09
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 225 508 3.0E-09
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 254 441 3.0E-09
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 356 573 3.0E-09
sp|Q5CZ79|AN20B_HUMAN Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 225 441 3.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 367 591 3.0E-09
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 367 591 3.0E-09
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 225 440 3.0E-09
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 249 441 3.0E-09
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 420 617 3.0E-09
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 254 472 3.0E-09
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 254 472 3.0E-09
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 238 441 3.0E-09
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 454 607 3.0E-09
sp|C9JTQ0|ANR63_HUMAN Ankyrin repeat domain-containing protein 63 OS=Homo sapiens GN=ANKRD63 PE=3 SV=1 188 339 3.0E-09
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 359 556 3.0E-09
sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=2 SV=1 175 447 3.0E-09
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 464 607 3.0E-09
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 243 441 3.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 478 612 4.0E-09
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 212 443 4.0E-09
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 445 607 4.0E-09
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 187 418 4.0E-09
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 187 340 4.0E-09
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 423 607 4.0E-09
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 254 441 4.0E-09
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 368 617 4.0E-09
sp|Q1RJR4|Y319_RICBR Putative ankyrin repeat protein RBE_0319 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0319 PE=4 SV=1 472 622 4.0E-09
sp|Q5CZ79|AN20B_HUMAN Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 350 627 4.0E-09
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 184 339 4.0E-09
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 354 627 4.0E-09
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 354 627 4.0E-09
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 354 627 4.0E-09
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 350 598 4.0E-09
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 254 472 4.0E-09
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 211 558 4.0E-09
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 260 441 4.0E-09
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 322 539 4.0E-09
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 254 441 4.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 113 314 5.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 191 424 5.0E-09
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 109 342 5.0E-09
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 254 441 5.0E-09
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 254 441 5.0E-09
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 479 612 5.0E-09
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 350 598 5.0E-09
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 220 405 5.0E-09
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 377 607 5.0E-09
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 218 545 5.0E-09
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 244 426 5.0E-09
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 359 529 5.0E-09
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 363 612 5.0E-09
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 321 591 5.0E-09
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 359 614 6.0E-09
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 187 340 6.0E-09
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 187 340 6.0E-09
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 254 441 6.0E-09
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 246 440 6.0E-09
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 155 341 6.0E-09
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 314 595 6.0E-09
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 353 529 6.0E-09
sp|Q9HLN1|Y196_THEAC Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 465 607 6.0E-09
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 356 528 6.0E-09
sp|Q5T7N3|KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens GN=KANK4 PE=2 SV=1 376 561 6.0E-09
sp|Q14678|KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 420 573 6.0E-09
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 390 607 7.0E-09
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 266 441 7.0E-09
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 187 418 7.0E-09
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 187 340 7.0E-09
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 393 611 7.0E-09
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 287 539 7.0E-09
sp|Q6NY19|KANK3_HUMAN KN motif and ankyrin repeat domain-containing protein 3 OS=Homo sapiens GN=KANK3 PE=1 SV=1 379 580 7.0E-09
sp|Q9J5H9|V022_FOWPN Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 365 604 7.0E-09
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 254 548 8.0E-09
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 220 405 8.0E-09
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 254 506 8.0E-09
sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 354 607 8.0E-09
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 215 452 8.0E-09
sp|P21783|NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis GN=notch1 PE=1 SV=3 362 575 8.0E-09
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 402 625 8.0E-09
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 314 607 9.0E-09
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 216 437 9.0E-09
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 452 607 9.0E-09
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 293 506 9.0E-09
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 74 410 9.0E-09
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 254 506 9.0E-09
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 352 575 9.0E-09
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 353 607 9.0E-09
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 374 591 9.0E-09
sp|Q9BXX3|AN30A_HUMAN Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 243 441 9.0E-09
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 200 577 1.0E-08
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 489 618 1.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 191 445 1.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 278 618 1.0E-08
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 212 442 1.0E-08
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 212 390 1.0E-08
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 448 613 1.0E-08
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 217 416 1.0E-08
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 217 416 1.0E-08
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 217 416 1.0E-08
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 477 607 1.0E-08
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 452 607 1.0E-08
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 266 441 1.0E-08
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 254 441 1.0E-08
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 187 420 1.0E-08
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 187 340 1.0E-08
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 187 340 1.0E-08
sp|Q811D2|ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 349 540 1.0E-08
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 200 506 1.0E-08
sp|Q875S9|AKR1_LACK1 Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 259 443 1.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 187 340 1.0E-08
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 254 506 1.0E-08
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 205 342 1.0E-08
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 356 539 1.0E-08
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 244 441 1.0E-08
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 289 607 1.0E-08
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 425 610 1.0E-08
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 372 609 1.0E-08
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 244 441 1.0E-08
sp|A2RUV0|NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 362 575 1.0E-08
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 388 594 1.0E-08
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 457 592 1.0E-08
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 212 433 1.0E-08
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 293 441 1.0E-08
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 220 410 2.0E-08
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 203 405 2.0E-08
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 330 607 2.0E-08
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 116 272 2.0E-08
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 364 616 2.0E-08
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 460 613 2.0E-08
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 456 607 2.0E-08
sp|Q52T38|ZDH22_ARATH Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 327 514 2.0E-08
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 63 350 2.0E-08
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 256 441 2.0E-08
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 212 433 2.0E-08
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 187 340 2.0E-08
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 266 441 2.0E-08
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 256 538 2.0E-08
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 261 540 2.0E-08
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 385 573 2.0E-08
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 187 340 2.0E-08
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 359 541 2.0E-08
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 350 598 2.0E-08
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 254 441 2.0E-08
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 415 611 2.0E-08
sp|Q54LF0|SIR2B_DICDI NAD-dependent deacetylase sir2B OS=Dictyostelium discoideum GN=sir2B PE=2 SV=1 225 545 2.0E-08
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 214 344 2.0E-08
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 287 590 2.0E-08
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 460 607 2.0E-08
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 457 620 2.0E-08
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 396 612 2.0E-08
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 293 441 2.0E-08
sp|Q9UPS8|ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens GN=ANKRD26 PE=1 SV=3 454 607 2.0E-08
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 380 575 2.0E-08
sp|Q5EA33|ANR49_BOVIN Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 456 616 2.0E-08
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 457 592 2.0E-08
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 457 607 3.0E-08
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 408 612 3.0E-08
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 194 310 3.0E-08
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 249 428 3.0E-08
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 191 440 3.0E-08
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 480 607 3.0E-08
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 217 341 3.0E-08
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 320 574 3.0E-08
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 354 612 3.0E-08
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 278 578 3.0E-08
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 245 450 3.0E-08
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 187 420 3.0E-08
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 290 561 3.0E-08
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 254 557 3.0E-08
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 386 575 3.0E-08
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 452 607 3.0E-08
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 240 512 3.0E-08
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 457 592 3.0E-08
sp|A0PJZ0|A20A5_HUMAN Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 454 582 3.0E-08
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 293 441 3.0E-08
sp|Q6XJU9|OSTF1_MONAL Osteoclast-stimulating factor 1 OS=Monopterus albus GN=ostf1 PE=2 SV=1 339 469 3.0E-08
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 243 341 3.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 330 607 4.0E-08
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 356 607 4.0E-08
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 456 607 4.0E-08
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 448 613 4.0E-08
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 280 441 4.0E-08
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 187 420 4.0E-08
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 290 618 4.0E-08
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 359 529 4.0E-08
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 459 607 4.0E-08
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 350 554 4.0E-08
sp|Q8BX02|KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Kank2 PE=1 SV=1 395 573 4.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 457 592 4.0E-08
sp|Q9J512|V223_FOWPN Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 377 506 4.0E-08
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 213 309 4.0E-08
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 293 441 4.0E-08
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 401 575 4.0E-08
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 356 535 4.0E-08
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 376 575 4.0E-08
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 254 441 4.0E-08
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 203 405 5.0E-08
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 364 616 5.0E-08
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 215 340 5.0E-08
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 469 607 5.0E-08
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 215 577 5.0E-08
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 203 407 5.0E-08
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 187 420 5.0E-08
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 187 420 5.0E-08
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 353 575 5.0E-08
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 161 340 5.0E-08
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 254 441 5.0E-08
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 339 469 5.0E-08
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 359 441 5.0E-08
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 167 328 6.0E-08
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 460 622 6.0E-08
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 209 399 6.0E-08
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 356 529 6.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 359 529 6.0E-08
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 244 393 6.0E-08
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 314 595 6.0E-08
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 256 441 6.0E-08
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 238 350 6.0E-08
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 356 607 7.0E-08
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 356 490 7.0E-08
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 259 442 7.0E-08
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 415 611 7.0E-08
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 290 409 7.0E-08
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 238 350 7.0E-08
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 467 610 7.0E-08
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 231 428 7.0E-08
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 401 619 8.0E-08
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 489 607 8.0E-08
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 254 448 8.0E-08
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 423 592 8.0E-08
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 356 528 8.0E-08
sp|B0G124|Y9043_DICDI Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 454 592 8.0E-08
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 243 436 8.0E-08
sp|Q8NI38|IKBD_HUMAN NF-kappa-B inhibitor delta OS=Homo sapiens GN=NFKBID PE=1 SV=1 421 615 8.0E-08
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 387 577 8.0E-08
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 213 309 8.0E-08
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 469 591 8.0E-08
sp|Q8WVL7|ANR49_HUMAN Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 456 616 8.0E-08
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 275 441 9.0E-08
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 191 446 9.0E-08
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 217 408 9.0E-08
sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 254 441 9.0E-08
sp|P25963|IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 282 440 9.0E-08
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 191 410 1.0E-07
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 220 410 1.0E-07
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 385 607 1.0E-07
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 460 622 1.0E-07
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 217 419 1.0E-07
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 204 409 1.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 163 336 1.0E-07
sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 217 372 1.0E-07
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 273 607 1.0E-07
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 218 474 1.0E-07
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 218 341 1.0E-07
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 385 586 1.0E-07
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 190 332 1.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 457 592 1.0E-07
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 454 577 1.0E-07
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 457 592 1.0E-07
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 476 607 1.0E-07
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 290 409 1.0E-07
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 290 409 1.0E-07
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 524 607 1.0E-07
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 243 449 1.0E-07
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 524 607 1.0E-07
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 243 449 1.0E-07
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 251 593 1.0E-07
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 259 440 1.0E-07
sp|Q1RI31|Y902_RICBR Putative ankyrin repeat protein RBE_0902 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0902 PE=4 SV=1 217 540 1.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 213 309 1.0E-07
sp|Q9Z1E3|IKBA_MOUSE NF-kappa-B inhibitor alpha OS=Mus musculus GN=Nfkbia PE=1 SV=2 282 440 1.0E-07
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 243 327 1.0E-07
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 220 340 1.0E-07
sp|Q1RK83|Y150_RICBR Putative ankyrin repeat protein RBE_0150 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0150 PE=4 SV=1 213 305 1.0E-07
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 324 613 1.0E-07
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 238 350 1.0E-07
sp|P46683|YAR1_YEAST Ankyrin repeat-containing protein YAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAR1 PE=1 SV=1 434 540 1.0E-07
sp|Q5XJ13|ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 319 577 1.0E-07
sp|Q6P9J5|KANK4_MOUSE KN motif and ankyrin repeat domain-containing protein 4 OS=Mus musculus GN=Kank4 PE=1 SV=1 376 579 1.0E-07
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 244 327 1.0E-07
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 188 327 2.0E-07
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 466 616 2.0E-07
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 208 305 2.0E-07
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 201 356 2.0E-07
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 63 342 2.0E-07
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 454 607 2.0E-07
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 457 607 2.0E-07
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 457 607 2.0E-07
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 457 607 2.0E-07
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 289 506 2.0E-07
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 320 614 2.0E-07
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 187 340 2.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 457 607 2.0E-07
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 163 336 2.0E-07
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 187 340 2.0E-07
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 215 405 2.0E-07
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 256 443 2.0E-07
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 190 332 2.0E-07
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 356 579 2.0E-07
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 288 540 2.0E-07
sp|Q5ZLC6|ANR10_CHICK Ankyrin repeat domain-containing protein 10 OS=Gallus gallus GN=ANKRD10 PE=2 SV=1 399 542 2.0E-07
sp|Q12013|AKR2_YEAST Probable palmitoyltransferase AKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR2 PE=1 SV=1 453 607 2.0E-07
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 424 608 2.0E-07
sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 363 592 2.0E-07
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 460 612 2.0E-07
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 244 327 2.0E-07
sp|Q63746|IKBA_RAT NF-kappa-B inhibitor alpha OS=Rattus norvegicus GN=Nfkbia PE=2 SV=1 282 440 2.0E-07
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 370 607 2.0E-07
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 240 428 2.0E-07
sp|Q9HFE7|YNW5_SCHPO Ankyrin repeat-containing protein P16F5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP16F5.05c PE=3 SV=1 208 307 2.0E-07
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 320 565 2.0E-07
sp|Q1RHQ8|Y1025_RICBR Putative ankyrin repeat protein RBE_1025 OS=Rickettsia bellii (strain RML369-C) GN=RBE_1025 PE=3 SV=1 355 510 2.0E-07
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 244 407 2.0E-07
sp|Q6UB98|ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 480 595 2.0E-07
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 115 411 3.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 151 474 3.0E-07
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 457 607 3.0E-07
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 212 340 3.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 457 607 3.0E-07
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 356 491 3.0E-07
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 246 451 3.0E-07
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 293 506 3.0E-07
sp|Q4V890|FEM1A_RAT Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 217 391 3.0E-07
sp|Q554E7|ZDHC5_DICDI Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 376 595 3.0E-07
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 260 441 3.0E-07
sp|Q9J5H9|V022_FOWPN Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 203 562 3.0E-07
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 378 575 3.0E-07
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 470 607 3.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 290 409 3.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 290 409 3.0E-07
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 457 588 3.0E-07
sp|Q5UNU1|YL675_MIMIV Putative ankyrin repeat protein L675 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L675 PE=3 SV=1 205 309 3.0E-07
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 460 613 3.0E-07
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 184 410 4.0E-07
sp|Q6ZVH7|ESPNL_HUMAN Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 216 410 4.0E-07
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 195 306 4.0E-07
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 254 483 4.0E-07
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 479 608 4.0E-07
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 217 372 4.0E-07
sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=2 SV=1 383 627 4.0E-07
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 290 409 4.0E-07
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 249 527 4.0E-07
sp|Q8VE42|ANR49_MOUSE Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 456 615 4.0E-07
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 204 323 5.0E-07
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 460 622 5.0E-07
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 457 607 5.0E-07
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 457 610 5.0E-07
sp|G3I6Z6|NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 212 407 5.0E-07
sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 212 407 5.0E-07
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 212 407 5.0E-07
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 214 410 5.0E-07
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 277 472 5.0E-07
sp|A0PJZ0|A20A5_HUMAN Putative ankyrin repeat domain-containing protein 20A5 OS=Homo sapiens GN=ANKRD20A5P PE=5 SV=1 244 327 5.0E-07
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 213 309 5.0E-07
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 213 309 5.0E-07
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 460 603 5.0E-07
sp|Q5UPD5|YL059_MIMIV Putative ankyrin repeat protein L59 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L59 PE=3 SV=1 384 607 5.0E-07
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 167 328 6.0E-07
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 356 611 6.0E-07
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 212 336 6.0E-07
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 217 372 6.0E-07
sp|Q9BXX3|AN30A_HUMAN Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 450 607 6.0E-07
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 213 309 6.0E-07
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 358 524 6.0E-07
sp|Q5UPV1|YL271_MIMIV Putative ankyrin repeat protein L271 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L271 PE=3 SV=1 378 575 6.0E-07
sp|Q99LW0|ANR10_MOUSE Ankyrin repeat domain-containing protein 10 OS=Mus musculus GN=Ankrd10 PE=2 SV=2 401 542 6.0E-07
sp|P14585|LIN12_CAEEL Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 479 611 6.0E-07
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 327 527 7.0E-07
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 212 340 7.0E-07
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 383 609 7.0E-07
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 460 613 7.0E-07
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 212 391 7.0E-07
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 350 600 8.0E-07
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 412 540 8.0E-07
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 469 558 8.0E-07
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 458 592 8.0E-07
sp|Q5UPR3|YR777_MIMIV Putative ankyrin repeat protein R777 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R777 PE=3 SV=1 248 409 8.0E-07
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 524 610 8.0E-07
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 349 540 9.0E-07
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 256 445 9.0E-07
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 327 527 9.0E-07
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 188 340 9.0E-07
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 256 432 9.0E-07
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 278 607 9.0E-07
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 292 607 9.0E-07
sp|Q9Z1P7|KANK3_MOUSE KN motif and ankyrin repeat domain-containing protein 3 OS=Mus musculus GN=Kank3 PE=1 SV=1 379 539 9.0E-07
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 356 469 9.0E-07
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 356 443 9.0E-07
sp|Q6UB99|ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 474 609 9.0E-07
sp|Q1LVW0|BTBBA_DANRE Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A OS=Danio rerio GN=btbd11a PE=3 SV=2 205 352 9.0E-07
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 225 381 9.0E-07
sp|Q10311|YD58_SCHPO Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 456 600 1.0E-06
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 356 490 1.0E-06
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 479 610 1.0E-06
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 479 607 1.0E-06
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 327 527 1.0E-06
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 256 432 1.0E-06
sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 212 407 1.0E-06
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 247 441 1.0E-06
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 461 607 1.0E-06
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 481 608 1.0E-06
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 208 428 1.0E-06
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 259 409 1.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 358 539 1.0E-06
sp|Q9J512|V223_FOWPN Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 466 607 1.0E-06
sp|Q12013|AKR2_YEAST Probable palmitoyltransferase AKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR2 PE=1 SV=1 428 610 1.0E-06
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 454 577 1.0E-06
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 459 614 1.0E-06
sp|P14585|LIN12_CAEEL Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 455 621 1.0E-06
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 256 436 1.0E-06
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 412 612 1.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 516 607 1.0E-06
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 293 605 1.0E-06
sp|O08764|ABTB2_RAT Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Rattus norvegicus GN=Abtb2 PE=2 SV=1 246 406 1.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 356 469 1.0E-06
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 356 469 1.0E-06
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 191 327 1.0E-06
sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 242 327 1.0E-06
sp|Q54XY6|Y0019_DICDI Probable serine/threonine-protein kinase DDB_G0278521 OS=Dictyostelium discoideum GN=DDB_G0278521 PE=3 SV=1 195 341 1.0E-06
sp|Q9WTK5|NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 363 602 1.0E-06
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 502 611 1.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 472 607 2.0E-06
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 212 336 2.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 278 556 2.0E-06
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 212 328 2.0E-06
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 249 424 2.0E-06
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 259 424 2.0E-06
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 248 527 2.0E-06
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 460 613 2.0E-06
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 358 561 2.0E-06
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 259 409 2.0E-06
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 460 613 2.0E-06
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 460 613 2.0E-06
sp|Q5XJ13|ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 386 607 2.0E-06
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 203 341 2.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 378 517 2.0E-06
sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 515 613 2.0E-06
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 212 387 2.0E-06
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 220 340 2.0E-06
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 460 613 2.0E-06
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 502 591 2.0E-06
sp|Q5UP14|YR845_MIMIV Putative ankyrin repeat protein R845 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R845 PE=3 SV=1 259 441 2.0E-06
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 464 617 2.0E-06
sp|Q7TQI7|ABTB2_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus GN=Abtb2 PE=1 SV=1 246 368 2.0E-06
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 460 613 2.0E-06
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 460 613 2.0E-06
sp|Q60773|CDN2D_MOUSE Cyclin-dependent kinase 4 inhibitor D OS=Mus musculus GN=Cdkn2d PE=1 SV=2 256 440 2.0E-06
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 245 436 2.0E-06
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 322 520 2.0E-06
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 339 469 2.0E-06
sp|Q495M9|USH1G_HUMAN Usher syndrome type-1G protein OS=Homo sapiens GN=USH1G PE=1 SV=1 246 339 2.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 288 616 3.0E-06
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 455 622 3.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 455 613 3.0E-06
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 191 411 3.0E-06
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 212 409 3.0E-06
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 364 577 3.0E-06
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 217 372 3.0E-06
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 242 410 3.0E-06
sp|Q5T7N3|KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens GN=KANK4 PE=2 SV=1 450 614 3.0E-06
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 288 441 3.0E-06
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 320 614 3.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 545 607 3.0E-06
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 240 341 3.0E-06
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 278 409 3.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 215 309 3.0E-06
sp|Q5UPA2|YL023_MIMIV Putative ankyrin repeat protein L23 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L23 PE=3 SV=1 256 409 3.0E-06
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 213 482 3.0E-06
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 387 591 3.0E-06
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 212 387 3.0E-06
sp|Q80T11|USH1G_MOUSE Usher syndrome type-1G protein homolog OS=Mus musculus GN=Ush1g PE=1 SV=1 246 339 3.0E-06
sp|Q9NXR5|ANR10_HUMAN Ankyrin repeat domain-containing protein 10 OS=Homo sapiens GN=ANKRD10 PE=1 SV=2 401 542 3.0E-06
sp|Q3U0L2|AN33B_MOUSE Ankyrin repeat domain-containing protein 33B OS=Mus musculus GN=Ankrd33b PE=1 SV=1 457 573 3.0E-06
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 460 613 3.0E-06
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 460 613 3.0E-06
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 469 558 3.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 444 607 4.0E-06
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 243 341 4.0E-06
sp|Q63ZY3|KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=KANK2 PE=1 SV=1 301 440 4.0E-06
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 350 540 4.0E-06
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 363 572 4.0E-06
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 187 340 4.0E-06
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 240 341 4.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 259 409 4.0E-06
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 246 340 4.0E-06
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 240 428 4.0E-06
sp|Q5UPB4|YL036_MIMIV Putative ankyrin repeat protein L36 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L36 PE=3 SV=1 214 409 4.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 479 610 5.0E-06
sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 441 607 5.0E-06
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 479 607 5.0E-06
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 479 607 5.0E-06
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 250 541 5.0E-06
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 212 336 5.0E-06
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 218 373 5.0E-06
sp|Q8TF21|ANR24_HUMAN Ankyrin repeat domain-containing protein 24 OS=Homo sapiens GN=ANKRD24 PE=2 SV=2 276 442 5.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 460 613 5.0E-06
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 240 341 5.0E-06
sp|Q3U0L2|AN33B_MOUSE Ankyrin repeat domain-containing protein 33B OS=Mus musculus GN=Ankrd33b PE=1 SV=1 214 337 5.0E-06
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 460 613 5.0E-06
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 235 342 5.0E-06
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 425 607 6.0E-06
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 453 603 6.0E-06
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 188 388 6.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 188 388 6.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 188 388 6.0E-06
sp|A2ARS0|ANR63_MOUSE Ankyrin repeat domain-containing protein 63 OS=Mus musculus GN=Ankrd63 PE=1 SV=1 514 607 6.0E-06
sp|C9JTQ0|ANR63_HUMAN Ankyrin repeat domain-containing protein 63 OS=Homo sapiens GN=ANKRD63 PE=3 SV=1 514 607 6.0E-06
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 288 544 6.0E-06
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 376 611 7.0E-06
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 364 577 7.0E-06
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 249 574 7.0E-06
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 246 595 7.0E-06
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 393 539 7.0E-06
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 460 612 8.0E-06
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 502 609 8.0E-06
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 212 607 8.0E-06
sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 425 607 8.0E-06
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 255 588 8.0E-06
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 460 613 8.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 224 607 9.0E-06
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 448 607 9.0E-06
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 218 420 9.0E-06
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 213 353 9.0E-06
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 356 523 9.0E-06
sp|Q6XJU9|OSTF1_MONAL Osteoclast-stimulating factor 1 OS=Monopterus albus GN=ostf1 PE=2 SV=1 243 307 9.0E-06
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 377 531 9.0E-06
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 377 531 9.0E-06
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 243 309 9.0E-06
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 212 592 1.0E-05
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 218 372 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7955
MEGNQPYLAEVFFQTEMEPEITDYKEGFYHLGSKEYRYDASRLVDKYWTEEKEWHTHNTFKNLDKKVEKFKKKHK
PLTVIGYDEGKKCYKLDTLEWYCPWEIGTKKFYTQDRGFYAVSVAPSPSDKDIVNFLEGMAAGLSLEPDAPNEDG
PLIVEILTEFDKFEKKHAQRDAGSEITGTQDMEEFALFLSSAANGYKAFAKFLLILKPQVCNTTDKDGRTPLSLA
AGNGHEAIALSLIGLADVDPNAMDKQNRTPLSWAAENGHVRLVKLLLDNPKVDPDSKDHLEQTPLLLAAKNGHAA
IVKLLLDTGKISWNTNDKLGGTPLRYAAEFGHNETVKQLVESCKCKDAHDTLLSLLWSAAANGKVSTIRTLIGSN
KVDINALDNSGRTALALATTNGHPRVVELLLETGKVDWNAKDKMNGWTPLEYAAYDGQTEVVQQLIRSCKCNDAH
NVVLSLLWSAAANGYMSTIKTLLNSTEIDLNTRDKEGRTALHWAAAGGRLALVKLLTSTDFDQDAKDVYGATALL
LAVNSGKYAVVKLLLDMHKFDPDSKDTSGRTSLSYAAGAGNADIVRLLLETGKTDPAAEDKEGRTPVYWARTHGH
EAIVKLLEGATKIGPEQRHQVGEEESS*
Coding >OphauB2|7955
ATGGAAGGAAATCAGCCCTACTTGGCCGAGGTATTCTTCCAGACAGAAATGGAGCCTGAAATTACAGACTACAAG
GAAGGCTTCTATCACCTGGGTTCTAAAGAGTATCGCTATGATGCATCAAGACTCGTGGATAAGTATTGGACTGAA
GAGAAAGAGTGGCATACCCACAATACTTTCAAGAACCTCGACAAAAAAGTTGAAAAATTCAAGAAAAAGCATAAG
CCACTTACAGTTATCGGATACGATGAAGGAAAAAAGTGCTATAAGCTTGATACATTGGAGTGGTATTGCCCGTGG
GAAATAGGGACGAAGAAATTCTACACTCAAGACAGAGGTTTTTACGCTGTGTCTGTCGCTCCAAGTCCCTCTGAT
AAGGATATCGTCAATTTCCTTGAGGGTATGGCTGCAGGCCTCTCGCTTGAGCCTGACGCCCCTAACGAGGACGGT
CCCCTCATCGTCGAAATCCTTACCGAGTTCGACAAATTCGAGAAGAAGCATGCCCAGCGAGACGCGGGCAGTGAA
ATTACGGGTACTCAAGACATGGAAGAATTTGCACTGTTTCTGTCATCAGCAGCAAACGGGTATAAGGCGTTTGCC
AAATTCCTCCTCATATTGAAACCGCAAGTCTGCAATACCACTGACAAGGATGGACGGACACCGCTGTCGTTGGCG
GCCGGAAACGGGCATGAAGCAATTGCTTTGTCGCTAATAGGACTGGCCGACGTTGATCCAAACGCTATGGATAAG
CAAAACCGAACGCCTTTATCATGGGCTGCAGAAAACGGACATGTAAGGCTTGTCAAGTTGCTTCTAGACAACCCC
AAAGTCGACCCAGACAGCAAGGATCACCTTGAGCAGACGCCCCTACTATTGGCAGCAAAAAATGGACACGCTGCC
ATTGTTAAGTTACTTCTAGATACCGGCAAGATCAGCTGGAATACTAATGACAAGCTTGGAGGGACACCGCTAAGA
TATGCGGCAGAGTTTGGTCATAACGAGACAGTCAAGCAGCTTGTGGAAAGTTGCAAGTGCAAGGATGCTCATGAC
ACTCTATTATCTCTACTCTGGTCGGCGGCGGCGAATGGAAAAGTGTCAACGATTAGAACACTAATAGGCTCTAAC
AAAGTCGATATTAACGCTTTGGATAATTCAGGACGGACAGCGTTGGCTTTGGCCACAACAAACGGTCATCCCAGG
GTCGTTGAGCTGCTTCTAGAAACCGGCAAGGTTGATTGGAATGCCAAGGATAAGATGAATGGATGGACACCCCTA
GAATATGCGGCATATGACGGCCAAACAGAGGTGGTCCAGCAGCTTATTCGTAGCTGTAAATGCAATGACGCTCAC
AACGTTGTATTATCGCTACTATGGTCGGCGGCAGCAAACGGATACATGTCGACTATCAAGACACTTCTAAACTCG
ACAGAGATCGATCTCAATACTAGGGACAAAGAAGGACGAACGGCTCTACATTGGGCAGCGGCGGGCGGGCGTTTA
GCGCTTGTTAAACTATTAACTTCGACTGACTTTGACCAGGATGCCAAGGATGTATACGGGGCCACGGCGTTGTTA
TTAGCTGTAAACAGTGGAAAATACGCGGTAGTCAAGCTGCTTCTAGATATGCACAAGTTTGACCCGGATAGCAAG
GATACTTCGGGTCGCACGTCGCTATCATATGCTGCAGGGGCTGGCAACGCTGATATTGTTCGACTGCTCTTGGAA
ACAGGCAAAACCGATCCGGCAGCCGAGGATAAAGAAGGACGAACACCGGTTTACTGGGCCAGGACGCATGGGCAT
GAGGCAATTGTCAAGCTATTGGAGGGCGCGACGAAAATTGGCCCTGAGCAAAGGCATCAAGTTGGAGAGGAAGAG
TCATCATGA
Transcript >OphauB2|7955
ATGGAAGGAAATCAGCCCTACTTGGCCGAGGTATTCTTCCAGACAGAAATGGAGCCTGAAATTACAGACTACAAG
GAAGGCTTCTATCACCTGGGTTCTAAAGAGTATCGCTATGATGCATCAAGACTCGTGGATAAGTATTGGACTGAA
GAGAAAGAGTGGCATACCCACAATACTTTCAAGAACCTCGACAAAAAAGTTGAAAAATTCAAGAAAAAGCATAAG
CCACTTACAGTTATCGGATACGATGAAGGAAAAAAGTGCTATAAGCTTGATACATTGGAGTGGTATTGCCCGTGG
GAAATAGGGACGAAGAAATTCTACACTCAAGACAGAGGTTTTTACGCTGTGTCTGTCGCTCCAAGTCCCTCTGAT
AAGGATATCGTCAATTTCCTTGAGGGTATGGCTGCAGGCCTCTCGCTTGAGCCTGACGCCCCTAACGAGGACGGT
CCCCTCATCGTCGAAATCCTTACCGAGTTCGACAAATTCGAGAAGAAGCATGCCCAGCGAGACGCGGGCAGTGAA
ATTACGGGTACTCAAGACATGGAAGAATTTGCACTGTTTCTGTCATCAGCAGCAAACGGGTATAAGGCGTTTGCC
AAATTCCTCCTCATATTGAAACCGCAAGTCTGCAATACCACTGACAAGGATGGACGGACACCGCTGTCGTTGGCG
GCCGGAAACGGGCATGAAGCAATTGCTTTGTCGCTAATAGGACTGGCCGACGTTGATCCAAACGCTATGGATAAG
CAAAACCGAACGCCTTTATCATGGGCTGCAGAAAACGGACATGTAAGGCTTGTCAAGTTGCTTCTAGACAACCCC
AAAGTCGACCCAGACAGCAAGGATCACCTTGAGCAGACGCCCCTACTATTGGCAGCAAAAAATGGACACGCTGCC
ATTGTTAAGTTACTTCTAGATACCGGCAAGATCAGCTGGAATACTAATGACAAGCTTGGAGGGACACCGCTAAGA
TATGCGGCAGAGTTTGGTCATAACGAGACAGTCAAGCAGCTTGTGGAAAGTTGCAAGTGCAAGGATGCTCATGAC
ACTCTATTATCTCTACTCTGGTCGGCGGCGGCGAATGGAAAAGTGTCAACGATTAGAACACTAATAGGCTCTAAC
AAAGTCGATATTAACGCTTTGGATAATTCAGGACGGACAGCGTTGGCTTTGGCCACAACAAACGGTCATCCCAGG
GTCGTTGAGCTGCTTCTAGAAACCGGCAAGGTTGATTGGAATGCCAAGGATAAGATGAATGGATGGACACCCCTA
GAATATGCGGCATATGACGGCCAAACAGAGGTGGTCCAGCAGCTTATTCGTAGCTGTAAATGCAATGACGCTCAC
AACGTTGTATTATCGCTACTATGGTCGGCGGCAGCAAACGGATACATGTCGACTATCAAGACACTTCTAAACTCG
ACAGAGATCGATCTCAATACTAGGGACAAAGAAGGACGAACGGCTCTACATTGGGCAGCGGCGGGCGGGCGTTTA
GCGCTTGTTAAACTATTAACTTCGACTGACTTTGACCAGGATGCCAAGGATGTATACGGGGCCACGGCGTTGTTA
TTAGCTGTAAACAGTGGAAAATACGCGGTAGTCAAGCTGCTTCTAGATATGCACAAGTTTGACCCGGATAGCAAG
GATACTTCGGGTCGCACGTCGCTATCATATGCTGCAGGGGCTGGCAACGCTGATATTGTTCGACTGCTCTTGGAA
ACAGGCAAAACCGATCCGGCAGCCGAGGATAAAGAAGGACGAACACCGGTTTACTGGGCCAGGACGCATGGGCAT
GAGGCAATTGTCAAGCTATTGGAGGGCGCGACGAAAATTGGCCCTGAGCAAAGGCATCAAGTTGGAGAGGAAGAG
TCATCATGA
Gene >OphauB2|7955
ATGGAAGGAAATCAGCCCTACTTGGCCGAGGTATTCTTCCAGACAGAAATGGAGCCTGAAATTACAGACTACAAG
GAAGGCTTCTATCACCTGGGTTCTAAAGAGTATCGCTATGATGCATCAAGACTCGTGGATAAGTATTGGACTGAA
GAGAAAGAGTGGCATACCCACAATACTTTCAAGAACCTCGACAAAAAAGTTGAAAAATTCAAGAAAAAGCATAAG
CCACTTACAGTTATCGGATACGATGAAGGAAAAAAGTGCTATAAGCTTGATACATTGGAGTGGTATTGCCCGTGG
GAAATAGGGACGAAGAAATTCTACACTCAAGACAGAGGTTTTTACGCTGTGTCTGTCGCTCCAAGTCCCTCTGAT
AAGGATATCGTCAATTTCCTTGAGGGTATGGCTGCAGGCCTCTCGCTTGAGCCTGACGCCCCTAACGAGGACGGT
CCCCTCATCGTCGAAATCCTTACCGAGTTCGACAAATTCGAGAAGAAGCATGCCCAGCGAGACGCGGGCAGTGAA
ATTACGGGTACTCAAGACATGGAAGAATTTGCACTGTTTCTGTCATCAGCAGCAAACGGGTATAAGGCGTTTGCC
AAATTCCTCCTCATATTGAAACCGCAAGTCTGCAATACCACTGACAAGGATGGACGGACACCGCTGTCGTTGGCG
GCCGGAAACGGGCATGAAGCAATTGCTTTGTCGCTAATAGGACTGGCCGACGTTGATCCAAACGCTATGGATAAG
CAAAACCGAACGCCTTTATCATGGGCTGCAGAAAACGGACATGTAAGGCTTGTCAAGTTGCTTCTAGACAACCCC
AAAGTCGACCCAGACAGCAAGGATCACCTTGAGCAGACGCCCCTACTATTGGCAGCAAAAAATGGACACGCTGCC
ATTGTTAAGTTACTTCTAGATACCGGCAAGATCAGCTGGAATACTAATGACAAGCTTGGAGGGACACCGCTAAGA
TATGCGGCAGAGTTTGGTCATAACGAGACAGTCAAGCAGCTTGTGGAAAGTTGCAAGTGCAAGGATGCTCATGAC
ACTCTATTATCTCTACTCTGGTCGGCGGCGGCGAATGGAAAAGTGTCAACGATTAGAACACTAATAGGCTCTAAC
AAAGTCGATATTAACGCTTTGGATAATTCAGGACGGACAGCGTTGGCTTTGGCCACAACAAACGGTCATCCCAGG
GTCGTTGAGCTGCTTCTAGAAACCGGCAAGGTTGATTGGAATGCCAAGGATAAGATGAATGGATGGACACCCCTA
GAATATGCGGCATATGACGGCCAAACAGAGGTGGTCCAGCAGCTTATTCGTAGCTGTAAATGCAATGACGCTCAC
AACGTTGTATTATCGCTACTATGGTCGGCGGCAGCAAACGGATACATGTCGACTATCAAGACACTTCTAAACTCG
ACAGAGATCGATCTCAATACTAGGGACAAAGAAGGACGAACGGCTCTACATTGGGCAGCGGCGGGCGGGCGTTTA
GCGCTTGTTAAACTATTAACTTCGACTGACTTTGACCAGGATGCCAAGGATGTATACGGGGCCACGGCGTTGTTA
TTAGCTGTAAACAGTGGAAAATACGCGGTAGTCAAGCTGCTTCTAGATATGCACAAGTTTGACCCGGATAGCAAG
GATACTTCGGGTCGCACGTCGCTATCATATGCTGCAGGGGCTGGCAACGCTGATATTGTTCGACTGCTCTTGGAA
ACAGGCAAAACCGATCCGGCAGCCGAGGATAAAGAAGGACGAACACCGGTTTACTGGGCCAGGACGCATGGGCAT
GAGGCAATTGTCAAGCTATTGGAGGGCGCGACGAAAATTGGCCCTGAGCAAAGGCATCAAGTTGGAGAGGAAGAG
TCATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail