Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7952
Gene name
LocationContig_91:21461..22859
Strand+
Gene length (bp)1398
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain 5.4E-85 69 300
PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain 1.2E-23 297 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27121|DCOR_NEUCR Ornithine decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-1 PE=2 SV=1 34 445 0.0E+00
sp|Q9UQW9|DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spe1 PE=2 SV=1 36 437 4.0E-145
sp|P08432|DCOR_YEAST Ornithine decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE1 PE=1 SV=1 36 437 8.0E-143
sp|P27119|DCOR_MUSPA Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2 SV=1 33 435 2.0E-128
sp|P00860|DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus GN=Odc1 PE=1 SV=2 33 435 1.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27121|DCOR_NEUCR Ornithine decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-1 PE=2 SV=1 34 445 0.0E+00
sp|Q9UQW9|DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spe1 PE=2 SV=1 36 437 4.0E-145
sp|P08432|DCOR_YEAST Ornithine decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE1 PE=1 SV=1 36 437 8.0E-143
sp|P27119|DCOR_MUSPA Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2 SV=1 33 435 2.0E-128
sp|P00860|DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus GN=Odc1 PE=1 SV=2 33 435 1.0E-127
sp|P09057|DCOR_RAT Ornithine decarboxylase OS=Rattus norvegicus GN=Odc1 PE=1 SV=1 33 435 1.0E-127
sp|P27120|DCOR1_XENLA Ornithine decarboxylase 1 OS=Xenopus laevis GN=odc1-a PE=2 SV=1 44 445 1.0E-127
sp|P27118|DCOR_CHICK Ornithine decarboxylase (Fragment) OS=Gallus gallus GN=ODC1 PE=2 SV=1 44 424 1.0E-126
sp|P27117|DCOR_BOVIN Ornithine decarboxylase OS=Bos taurus GN=ODC1 PE=2 SV=1 34 435 2.0E-126
sp|P11926|DCOR_HUMAN Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE=1 SV=2 44 435 3.0E-126
sp|Q9I8S4|AZIN2_XENLA Antizyme inhibitor 2 OS=Xenopus laevis GN=azin2 PE=2 SV=1 39 427 4.0E-125
sp|P07805|DCOR_TRYBB Ornithine decarboxylase OS=Trypanosoma brucei brucei PE=1 SV=2 50 437 3.0E-118
sp|P78599|DCOR_CANAL Ornithine decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPE1 PE=3 SV=1 34 435 2.0E-116
sp|P14019|DCOR_CRIGR Ornithine decarboxylase OS=Cricetulus griseus GN=ODC1 PE=2 SV=3 33 435 4.0E-116
sp|P41931|DCOR_CAEEL Ornithine decarboxylase OS=Caenorhabditis elegans GN=odc-1 PE=3 SV=2 60 436 2.0E-108
sp|Q54UF3|DCOR_DICDI Probable ornithine decarboxylase OS=Dictyostelium discoideum GN=odc PE=3 SV=1 60 424 4.0E-101
sp|P40807|DCOR1_DROME Ornithine decarboxylase 1 OS=Drosophila melanogaster GN=Odc1 PE=2 SV=3 66 425 9.0E-97
sp|P49725|DCOR_PANRE Ornithine decarboxylase OS=Panagrellus redivivus GN=ODC PE=2 SV=1 59 433 3.0E-96
sp|Q8BVM4|AZIN2_MOUSE Antizyme inhibitor 2 OS=Mus musculus GN=Azin2 PE=1 SV=1 59 442 2.0E-95
sp|Q96A70|AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens GN=AZIN2 PE=1 SV=1 64 442 1.0E-94
sp|P50134|DCOR_DATST Ornithine decarboxylase OS=Datura stramonium PE=2 SV=1 48 433 2.0E-94
sp|Q5R7K3|AZIN1_PONAB Antizyme inhibitor 1 OS=Pongo abelii GN=AZIN1 PE=2 SV=1 61 424 3.0E-94
sp|O14977|AZIN1_HUMAN Antizyme inhibitor 1 OS=Homo sapiens GN=AZIN1 PE=1 SV=2 61 424 9.0E-94
sp|Q8S3N2|DCOR_CAPAN Ornithine decarboxylase OS=Capsicum annuum GN=ODC PE=2 SV=1 59 433 1.0E-93
sp|O22616|DCOR_SOLLC Ornithine decarboxylase OS=Solanum lycopersicum GN=ODC PE=2 SV=2 16 433 1.0E-92
sp|O35484|AZIN1_MOUSE Antizyme inhibitor 1 OS=Mus musculus GN=Azin1 PE=1 SV=1 61 424 5.0E-92
sp|Q63764|AZIN1_RAT Antizyme inhibitor 1 OS=Rattus norvegicus GN=Azin1 PE=1 SV=1 61 412 1.0E-91
sp|P27116|DCOR_LEIDO Ornithine decarboxylase OS=Leishmania donovani PE=3 SV=1 61 426 5.0E-86
sp|P40808|DCOR2_DROME Ornithine decarboxylase 2 OS=Drosophila melanogaster GN=Odc2 PE=3 SV=2 38 424 5.0E-82
sp|D4A693|AZIN2_RAT Antizyme inhibitor 2 OS=Rattus norvegicus GN=Azin2 PE=1 SV=2 59 442 2.0E-60
sp|O50657|DCLO_SELRU Lysine/ornithine decarboxylase OS=Selenomonas ruminantium GN=ldc PE=1 SV=1 64 432 1.0E-57
sp|P56129|DCDA_HELPY Diaminopimelate decarboxylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysA PE=3 SV=1 52 422 6.0E-24
sp|B4XMC6|DCDA_HELPX Diaminopimelate decarboxylase OS=Helicobacter pylori GN=lysA PE=1 SV=1 52 422 5.0E-23
sp|Q92445|DCOR_PARBR Ornithine decarboxylase (Fragment) OS=Paracoccidioides brasiliensis GN=ODC PE=3 SV=1 217 296 1.0E-22
sp|Q9ZME5|DCDA_HELPJ Diaminopimelate decarboxylase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysA PE=3 SV=1 52 422 9.0E-22
sp|P19572|DCDA_PSEAE Diaminopimelate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysA PE=3 SV=2 90 431 8.0E-21
sp|Q9KVL7|DCDA_VIBCH Diaminopimelate decarboxylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lysA PE=1 SV=1 90 422 3.0E-19
sp|Q9Z661|DCDA_ZYMMO Diaminopimelate decarboxylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lysA PE=3 SV=1 90 422 2.0E-18
sp|Q9RTK2|DCDA_DEIRA Diaminopimelate decarboxylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lysA PE=3 SV=1 89 432 2.0E-17
sp|O05321|DCDA_PSEFL Diaminopimelate decarboxylase OS=Pseudomonas fluorescens GN=lysA PE=3 SV=1 90 422 2.0E-17
sp|O29458|DCDA_ARCFU Diaminopimelate decarboxylase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=lysA PE=3 SV=1 47 431 4.0E-17
sp|O27390|DCDA_METTH Diaminopimelate decarboxylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=lysA PE=3 SV=1 71 431 5.0E-17
sp|Q9JXM2|DCDA_NEIMB Diaminopimelate decarboxylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lysA PE=3 SV=1 90 431 2.0E-16
sp|Q9PII5|DCDA_CAMJE Diaminopimelate decarboxylase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lysA PE=3 SV=1 89 313 5.0E-16
sp|Q9JWA6|DCDA_NEIMA Diaminopimelate decarboxylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lysA PE=3 SV=1 79 431 5.0E-16
sp|O67262|DCDA_AQUAE Diaminopimelate decarboxylase OS=Aquifex aeolicus (strain VF5) GN=lysA PE=1 SV=1 79 431 2.0E-15
sp|P44316|DCDA_HAEIN Diaminopimelate decarboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lysA PE=3 SV=1 90 431 3.0E-14
sp|Q58497|DCDA_METJA Diaminopimelate decarboxylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=lysA PE=1 SV=1 78 422 5.0E-13
sp|Q9X1K5|DCDA_THEMA Diaminopimelate decarboxylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lysA PE=1 SV=1 88 431 6.0E-12
sp|Q9KCM5|DCDA_BACHD Diaminopimelate decarboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lysA PE=3 SV=1 90 315 1.0E-11
sp|Q9ZBH5|DCDA_STRCO Diaminopimelate decarboxylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lysA PE=3 SV=1 80 422 3.0E-11
sp|Q5HG20|DCDA_STAAC Diaminopimelate decarboxylase OS=Staphylococcus aureus (strain COL) GN=lysA PE=3 SV=1 74 422 7.0E-11
sp|E0IWI3|DCDA_ECOLW Diaminopimelate decarboxylase OS=Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W) GN=lysA PE=1 SV=1 71 422 1.0E-10
sp|P00861|DCDA_ECOLI Diaminopimelate decarboxylase OS=Escherichia coli (strain K12) GN=lysA PE=1 SV=1 71 422 1.0E-10
sp|Q2L4H3|BTRK_BACCI L-glutamyl-[BtrI acyl-carrier protein] decarboxylase OS=Bacillus circulans GN=btrK PE=1 SV=2 61 413 2.0E-10
sp|Q9HK20|DCDA_THEAC Diaminopimelate decarboxylase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lysA PE=3 SV=2 85 423 3.0E-10
sp|O69203|DCDA_ACTPA Diaminopimelate decarboxylase OS=Actinosynnema pretiosum subsp. auranticum GN=lysA PE=3 SV=1 66 263 1.0E-08
sp|Q6ZG77|DCDA_ORYSJ Probable diaminopimelate decarboxylase, chloroplastic OS=Oryza sativa subsp. japonica GN=LYSA PE=2 SV=1 64 422 2.0E-08
sp|P23630|DCDA_BACSU Diaminopimelate decarboxylase OS=Bacillus subtilis (strain 168) GN=lysA PE=3 SV=5 90 422 2.0E-08
sp|Q7TUJ9|SPEA_PROMM Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus (strain MIT 9313) GN=speA PE=3 SV=1 85 318 2.0E-07
sp|Q8A800|DCDA_BACTN Diaminopimelate decarboxylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lysA PE=3 SV=1 84 422 3.0E-07
sp|A5GWM2|SPEA_SYNR3 Biosynthetic arginine decarboxylase OS=Synechococcus sp. (strain RCC307) GN=speA PE=3 SV=1 90 320 5.0E-07
sp|Q7V3M9|SPEA_PROMP Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=speA PE=3 SV=1 66 310 7.0E-07
sp|A2CDK1|SPEA_PROM3 Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus (strain MIT 9303) GN=speA PE=3 SV=1 85 315 1.0E-06
sp|B3EAF3|SPEA_GEOLS Biosynthetic arginine decarboxylase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=speA PE=3 SV=1 8 314 2.0E-06
sp|Q8RQM6|DCDA_COREF Diaminopimelate decarboxylase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=lysA PE=3 SV=1 90 425 6.0E-06
sp|Q50140|DCDA_MYCLE Diaminopimelate decarboxylase OS=Mycobacterium leprae (strain TN) GN=lysA PE=3 SV=2 90 435 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7952
MVMATAVLDNYSPNIAKHGHMLVKKPLYQSHAVLDAQQLIGEALHQRVTRINHDDCEPGDEDTFFVADLGEVYRQ
QLRWKKNLPRIKPFYAVKCNPDPQVLRLLAALGNGFDCASKGEIEQVLAMGVSPERIIYAQPCKTSSYLRYVKAA
GVKQMTFDNADELCKIAKHFPDAELFLRITTDDTSSMCRLSMKFGAALDTTPALLAVAKKLDLNVVGVSFHVGSG
ASDAGAYLKAVRDAHAVFTTARDLGFSMRTLDVGGGFCGDSFEKMAGTLRDACDDYFPAGCGVDIIAEPGRYFVS
SAFTIACNIIARRTIEDPALGDQGYMVYVNDGVYGNFSSIMFDHQHPMARILCSRGKTLYKTKASLPCGPDEGAE
YSIWGPTCDGIDRITASTHFTTILDVGDWLYFENMGAYTKCSATQFNGFSNSHDVIYVCSELGARALLDI*
Coding >OphauB2|7952
ATGGTTATGGCAACAGCAGTCCTTGACAACTATTCTCCAAACATCGCCAAACATGGACACATGTTGGTCAAGAAG
CCTCTTTACCAGAGCCATGCTGTCCTTGACGCCCAGCAGCTCATTGGCGAGGCTCTTCACCAGCGTGTGACGCGT
ATCAATCATGACGATTGCGAGCCTGGAGACGAAGACACCTTCTTCGTTGCTGACCTTGGCGAGGTCTACCGCCAG
CAACTCCGCTGGAAGAAGAATCTGCCTCGCATCAAGCCCTTTTATGCGGTCAAATGCAACCCTGACCCCCAGGTC
CTTCGCCTTTTGGCGGCATTGGGCAACGGCTTCGACTGTGCCTCCAAGGGCGAGATTGAACAAGTCCTTGCCATG
GGCGTTAGCCCTGAGCGCATCATTTATGCCCAGCCTTGCAAGACCAGCTCCTATCTCCGATATGTCAAGGCAGCC
GGCGTCAAGCAAATGACGTTTGACAATGCCGATGAGCTGTGCAAGATTGCCAAGCACTTTCCCGACGCTGAGCTT
TTCCTTCGTATCACGACGGACGACACGTCGAGCATGTGCCGCCTCAGCATGAAGTTTGGTGCTGCCCTTGATACC
ACTCCAGCTCTCCTGGCTGTGGCCAAGAAGCTTGACCTCAATGTTGTCGGTGTCAGCTTTCATGTTGGATCCGGT
GCATCGGACGCCGGCGCATACCTCAAGGCTGTTCGCGACGCCCACGCTGTCTTTACTACGGCACGAGACCTTGGC
TTCTCCATGCGCACTCTTGACGTTGGAGGTGGATTTTGCGGAGATTCATTCGAGAAGATGGCTGGAACACTGCGC
GACGCATGTGACGACTATTTCCCTGCTGGATGTGGTGTCGACATCATTGCCGAGCCAGGCCGCTACTTTGTCTCG
TCGGCCTTTACCATTGCCTGCAACATTATTGCTCGTCGCACTATTGAAGACCCAGCTCTAGGCGACCAAGGCTAC
ATGGTTTACGTCAACGATGGTGTTTATGGCAACTTTTCGAGCATCATGTTTGACCACCAGCATCCCATGGCTCGC
ATTCTTTGCTCGCGCGGCAAGACGCTTTACAAGACCAAGGCGAGCCTGCCCTGTGGTCCTGATGAAGGCGCTGAG
TATTCGATCTGGGGTCCAACCTGTGATGGCATCGACCGCATCACTGCCAGCACTCATTTTACCACGATTCTCGAC
GTGGGTGACTGGCTCTACTTTGAAAATATGGGTGCATACACCAAGTGCTCCGCCACGCAATTCAATGGCTTTTCC
AACTCGCACGATGTTATTTATGTGTGCAGCGAACTCGGAGCTAGGGCGCTTCTTGACATTTAG
Transcript >OphauB2|7952
ATGGTTATGGCAACAGCAGTCCTTGACAACTATTCTCCAAACATCGCCAAACATGGACACATGTTGGTCAAGAAG
CCTCTTTACCAGAGCCATGCTGTCCTTGACGCCCAGCAGCTCATTGGCGAGGCTCTTCACCAGCGTGTGACGCGT
ATCAATCATGACGATTGCGAGCCTGGAGACGAAGACACCTTCTTCGTTGCTGACCTTGGCGAGGTCTACCGCCAG
CAACTCCGCTGGAAGAAGAATCTGCCTCGCATCAAGCCCTTTTATGCGGTCAAATGCAACCCTGACCCCCAGGTC
CTTCGCCTTTTGGCGGCATTGGGCAACGGCTTCGACTGTGCCTCCAAGGGCGAGATTGAACAAGTCCTTGCCATG
GGCGTTAGCCCTGAGCGCATCATTTATGCCCAGCCTTGCAAGACCAGCTCCTATCTCCGATATGTCAAGGCAGCC
GGCGTCAAGCAAATGACGTTTGACAATGCCGATGAGCTGTGCAAGATTGCCAAGCACTTTCCCGACGCTGAGCTT
TTCCTTCGTATCACGACGGACGACACGTCGAGCATGTGCCGCCTCAGCATGAAGTTTGGTGCTGCCCTTGATACC
ACTCCAGCTCTCCTGGCTGTGGCCAAGAAGCTTGACCTCAATGTTGTCGGTGTCAGCTTTCATGTTGGATCCGGT
GCATCGGACGCCGGCGCATACCTCAAGGCTGTTCGCGACGCCCACGCTGTCTTTACTACGGCACGAGACCTTGGC
TTCTCCATGCGCACTCTTGACGTTGGAGGTGGATTTTGCGGAGATTCATTCGAGAAGATGGCTGGAACACTGCGC
GACGCATGTGACGACTATTTCCCTGCTGGATGTGGTGTCGACATCATTGCCGAGCCAGGCCGCTACTTTGTCTCG
TCGGCCTTTACCATTGCCTGCAACATTATTGCTCGTCGCACTATTGAAGACCCAGCTCTAGGCGACCAAGGCTAC
ATGGTTTACGTCAACGATGGTGTTTATGGCAACTTTTCGAGCATCATGTTTGACCACCAGCATCCCATGGCTCGC
ATTCTTTGCTCGCGCGGCAAGACGCTTTACAAGACCAAGGCGAGCCTGCCCTGTGGTCCTGATGAAGGCGCTGAG
TATTCGATCTGGGGTCCAACCTGTGATGGCATCGACCGCATCACTGCCAGCACTCATTTTACCACGATTCTCGAC
GTGGGTGACTGGCTCTACTTTGAAAATATGGGTGCATACACCAAGTGCTCCGCCACGCAATTCAATGGCTTTTCC
AACTCGCACGATGTTATTTATGTGTGCAGCGAACTCGGAGCTAGGGCGCTTCTTGACATTTAG
Gene >OphauB2|7952
ATGGTTATGGCAACAGCAGTCCTTGACAACTATTCTCCAAACATCGCCAAACATGGACACATGTTGGTCAAGAAG
CCTCTTTACCAGAGCCATGCTGTCCTTGACGCCCAGCAGCTCATTGGCGAGGCTCTTCACCAGCGTGTGACGCGT
ATCAATCATGACGATTGCGAGCCTGGAGACGAAGACACCTTCTTCGTTGCTGACCTTGGCGAGGTCTACCGCCAG
CAACTCCGCTGGAAGAAGAATCTGCCTCGCATCAAGCCCTTTTATGGTGAGTTGCCATGTTAGTTGCCTCGTATG
CAAATCAACATGCCAACTAATGCCGGCCCAGCGGTCAAATGCAACCCTGACCCCCAGGTCCTTCGCCTTTTGGCG
GCATTGGGCAACGGCTTCGACTGTGCCTCCAAGGGCGAGATTGAACAAGTCCTTGCCATGGGCGTTAGCCCTGAG
CGCATCATTTATGCCCAGCCTTGCAAGACCAGCTCCTATCTCCGATATGTCAAGGCAGCCGGCGTCAAGCAAATG
ACGTTTGACAATGCCGATGAGCTGTGCAAGATTGCCAAGCACTTTCCCGACGCTGAGCTTTTCCTTCGTATCACG
ACGGACGACACGTCGAGCATGTGCCGCCTCAGCATGAAGTTTGGTGCTGCCCTTGATACCACTCCAGCTCTCCTG
GCTGTGGCCAAGAAGCTTGACCTCAATGTTGTCGGTGTCAGCTTTCATGTTGGATCCGGTGCATCGGACGCCGGC
GCATACCTCAAGGCTGTTCGCGACGCCCACGCTGTCTTTACTACGGCACGAGACCTTGGCTTCTCCATGCGCACT
CTTGACGTTGGAGGTGGATTTTGCGGAGATTCATTCGAGAAGATGGCTGGAACACTGCGCGACGCATGTGACGAC
TATTTCCCTGCTGGATGTGGTGTCGACATCATTGCCGAGCCAGGCCGCTACTTTGTCTCGTCGGCCTTTACCATT
GCCTGCAACATTATTGCTCGTCGCACTATTGAAGACCCAGCTCTAGGCGACCAAGGCTACATGGTTTACGTCAAC
GATGGTGTTTATGGCAACTTTTCGAGCATCATGTTTGACCACCAGCATCCCATGGCTCGCATTCTTTGCTCGCGC
GGCAAGACGCTTTACAAGACCAAGGCGAGCCTGCCCTGTGGTCCTGATGAAGGCGCTGAGTATTCGATCTGGGGT
CCAACCTGTGATGGCATCGACCGCATCACTGCCAGCACTCATTTTACCACGATTCTCGACGTGGGTGACTGGCTC
TACTTTGAAAATATGGGTGCATACACCAAGTGCTCCGCCACGCAATTCAATGGCTTTTCCAACTCGCACGATGTT
ATTTATGTGTGCAGCGAACTCGGAGCTAGGGCGCTTCTTGACATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail