Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7952
Gene name
LocationContig_91:21461..22859
Strand+
Gene length (bp)1398
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain 5.4E-85 69 300
PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain 1.2E-23 297 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27121|DCOR_NEUCR Ornithine decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-1 PE=2 SV=1 34 445 0.0E+00
sp|Q9UQW9|DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spe1 PE=2 SV=1 36 437 4.0E-145
sp|P08432|DCOR_YEAST Ornithine decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE1 PE=1 SV=1 36 437 8.0E-143
sp|P27119|DCOR_MUSPA Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2 SV=1 33 435 2.0E-128
sp|P00860|DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus GN=Odc1 PE=1 SV=2 33 435 1.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27121|DCOR_NEUCR Ornithine decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-1 PE=2 SV=1 34 445 0.0E+00
sp|Q9UQW9|DCOR_SCHPO Ornithine decarboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spe1 PE=2 SV=1 36 437 4.0E-145
sp|P08432|DCOR_YEAST Ornithine decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE1 PE=1 SV=1 36 437 8.0E-143
sp|P27119|DCOR_MUSPA Ornithine decarboxylase OS=Mus pahari GN=Odc1 PE=2 SV=1 33 435 2.0E-128
sp|P00860|DCOR_MOUSE Ornithine decarboxylase OS=Mus musculus GN=Odc1 PE=1 SV=2 33 435 1.0E-127
sp|P09057|DCOR_RAT Ornithine decarboxylase OS=Rattus norvegicus GN=Odc1 PE=1 SV=1 33 435 1.0E-127
sp|P27120|DCOR1_XENLA Ornithine decarboxylase 1 OS=Xenopus laevis GN=odc1-a PE=2 SV=1 44 445 1.0E-127
sp|P27118|DCOR_CHICK Ornithine decarboxylase (Fragment) OS=Gallus gallus GN=ODC1 PE=2 SV=1 44 424 1.0E-126
sp|P27117|DCOR_BOVIN Ornithine decarboxylase OS=Bos taurus GN=ODC1 PE=2 SV=1 34 435 2.0E-126
sp|P11926|DCOR_HUMAN Ornithine decarboxylase OS=Homo sapiens GN=ODC1 PE=1 SV=2 44 435 3.0E-126
sp|Q9I8S4|AZIN2_XENLA Antizyme inhibitor 2 OS=Xenopus laevis GN=azin2 PE=2 SV=1 39 427 4.0E-125
sp|P07805|DCOR_TRYBB Ornithine decarboxylase OS=Trypanosoma brucei brucei PE=1 SV=2 50 437 3.0E-118
sp|P78599|DCOR_CANAL Ornithine decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPE1 PE=3 SV=1 34 435 2.0E-116
sp|P14019|DCOR_CRIGR Ornithine decarboxylase OS=Cricetulus griseus GN=ODC1 PE=2 SV=3 33 435 4.0E-116
sp|P41931|DCOR_CAEEL Ornithine decarboxylase OS=Caenorhabditis elegans GN=odc-1 PE=3 SV=2 60 436 2.0E-108
sp|Q54UF3|DCOR_DICDI Probable ornithine decarboxylase OS=Dictyostelium discoideum GN=odc PE=3 SV=1 60 424 4.0E-101
sp|P40807|DCOR1_DROME Ornithine decarboxylase 1 OS=Drosophila melanogaster GN=Odc1 PE=2 SV=3 66 425 9.0E-97
sp|P49725|DCOR_PANRE Ornithine decarboxylase OS=Panagrellus redivivus GN=ODC PE=2 SV=1 59 433 3.0E-96
sp|Q8BVM4|AZIN2_MOUSE Antizyme inhibitor 2 OS=Mus musculus GN=Azin2 PE=1 SV=1 59 442 2.0E-95
sp|Q96A70|AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens GN=AZIN2 PE=1 SV=1 64 442 1.0E-94
sp|P50134|DCOR_DATST Ornithine decarboxylase OS=Datura stramonium PE=2 SV=1 48 433 2.0E-94
sp|Q5R7K3|AZIN1_PONAB Antizyme inhibitor 1 OS=Pongo abelii GN=AZIN1 PE=2 SV=1 61 424 3.0E-94
sp|O14977|AZIN1_HUMAN Antizyme inhibitor 1 OS=Homo sapiens GN=AZIN1 PE=1 SV=2 61 424 9.0E-94
sp|Q8S3N2|DCOR_CAPAN Ornithine decarboxylase OS=Capsicum annuum GN=ODC PE=2 SV=1 59 433 1.0E-93
sp|O22616|DCOR_SOLLC Ornithine decarboxylase OS=Solanum lycopersicum GN=ODC PE=2 SV=2 16 433 1.0E-92
sp|O35484|AZIN1_MOUSE Antizyme inhibitor 1 OS=Mus musculus GN=Azin1 PE=1 SV=1 61 424 5.0E-92
sp|Q63764|AZIN1_RAT Antizyme inhibitor 1 OS=Rattus norvegicus GN=Azin1 PE=1 SV=1 61 412 1.0E-91
sp|P27116|DCOR_LEIDO Ornithine decarboxylase OS=Leishmania donovani PE=3 SV=1 61 426 5.0E-86
sp|P40808|DCOR2_DROME Ornithine decarboxylase 2 OS=Drosophila melanogaster GN=Odc2 PE=3 SV=2 38 424 5.0E-82
sp|D4A693|AZIN2_RAT Antizyme inhibitor 2 OS=Rattus norvegicus GN=Azin2 PE=1 SV=2 59 442 2.0E-60
sp|O50657|DCLO_SELRU Lysine/ornithine decarboxylase OS=Selenomonas ruminantium GN=ldc PE=1 SV=1 64 432 1.0E-57
sp|P56129|DCDA_HELPY Diaminopimelate decarboxylase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lysA PE=3 SV=1 52 422 6.0E-24
sp|B4XMC6|DCDA_HELPX Diaminopimelate decarboxylase OS=Helicobacter pylori GN=lysA PE=1 SV=1 52 422 5.0E-23
sp|Q92445|DCOR_PARBR Ornithine decarboxylase (Fragment) OS=Paracoccidioides brasiliensis GN=ODC PE=3 SV=1 217 296 1.0E-22
sp|Q9ZME5|DCDA_HELPJ Diaminopimelate decarboxylase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lysA PE=3 SV=1 52 422 9.0E-22
sp|P19572|DCDA_PSEAE Diaminopimelate decarboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lysA PE=3 SV=2 90 431 8.0E-21
sp|Q9KVL7|DCDA_VIBCH Diaminopimelate decarboxylase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lysA PE=1 SV=1 90 422 3.0E-19
sp|Q9Z661|DCDA_ZYMMO Diaminopimelate decarboxylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lysA PE=3 SV=1 90 422 2.0E-18
sp|Q9RTK2|DCDA_DEIRA Diaminopimelate decarboxylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=lysA PE=3 SV=1 89 432 2.0E-17
sp|O05321|DCDA_PSEFL Diaminopimelate decarboxylase OS=Pseudomonas fluorescens GN=lysA PE=3 SV=1 90 422 2.0E-17
sp|O29458|DCDA_ARCFU Diaminopimelate decarboxylase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=lysA PE=3 SV=1 47 431 4.0E-17
sp|O27390|DCDA_METTH Diaminopimelate decarboxylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=lysA PE=3 SV=1 71 431 5.0E-17
sp|Q9JXM2|DCDA_NEIMB Diaminopimelate decarboxylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=lysA PE=3 SV=1 90 431 2.0E-16
sp|Q9PII5|DCDA_CAMJE Diaminopimelate decarboxylase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lysA PE=3 SV=1 89 313 5.0E-16
sp|Q9JWA6|DCDA_NEIMA Diaminopimelate decarboxylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lysA PE=3 SV=1 79 431 5.0E-16
sp|O67262|DCDA_AQUAE Diaminopimelate decarboxylase OS=Aquifex aeolicus (strain VF5) GN=lysA PE=1 SV=1 79 431 2.0E-15
sp|P44316|DCDA_HAEIN Diaminopimelate decarboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lysA PE=3 SV=1 90 431 3.0E-14
sp|Q58497|DCDA_METJA Diaminopimelate decarboxylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=lysA PE=1 SV=1 78 422 5.0E-13
sp|Q9X1K5|DCDA_THEMA Diaminopimelate decarboxylase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lysA PE=1 SV=1 88 431 6.0E-12
sp|Q9KCM5|DCDA_BACHD Diaminopimelate decarboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lysA PE=3 SV=1 90 315 1.0E-11
sp|Q9ZBH5|DCDA_STRCO Diaminopimelate decarboxylase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lysA PE=3 SV=1 80 422 3.0E-11
sp|Q5HG20|DCDA_STAAC Diaminopimelate decarboxylase OS=Staphylococcus aureus (strain COL) GN=lysA PE=3 SV=1 74 422 7.0E-11
sp|E0IWI3|DCDA_ECOLW Diaminopimelate decarboxylase OS=Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W) GN=lysA PE=1 SV=1 71 422 1.0E-10
sp|P00861|DCDA_ECOLI Diaminopimelate decarboxylase OS=Escherichia coli (strain K12) GN=lysA PE=1 SV=1 71 422 1.0E-10
sp|Q2L4H3|BTRK_BACCI L-glutamyl-[BtrI acyl-carrier protein] decarboxylase OS=Bacillus circulans GN=btrK PE=1 SV=2 61 413 2.0E-10
sp|Q9HK20|DCDA_THEAC Diaminopimelate decarboxylase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=lysA PE=3 SV=2 85 423 3.0E-10
sp|O69203|DCDA_ACTPA Diaminopimelate decarboxylase OS=Actinosynnema pretiosum subsp. auranticum GN=lysA PE=3 SV=1 66 263 1.0E-08
sp|Q6ZG77|DCDA_ORYSJ Probable diaminopimelate decarboxylase, chloroplastic OS=Oryza sativa subsp. japonica GN=LYSA PE=2 SV=1 64 422 2.0E-08
sp|P23630|DCDA_BACSU Diaminopimelate decarboxylase OS=Bacillus subtilis (strain 168) GN=lysA PE=3 SV=5 90 422 2.0E-08
sp|Q7TUJ9|SPEA_PROMM Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus (strain MIT 9313) GN=speA PE=3 SV=1 85 318 2.0E-07
sp|Q8A800|DCDA_BACTN Diaminopimelate decarboxylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lysA PE=3 SV=1 84 422 3.0E-07
sp|A5GWM2|SPEA_SYNR3 Biosynthetic arginine decarboxylase OS=Synechococcus sp. (strain RCC307) GN=speA PE=3 SV=1 90 320 5.0E-07
sp|Q7V3M9|SPEA_PROMP Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=speA PE=3 SV=1 66 310 7.0E-07
sp|A2CDK1|SPEA_PROM3 Biosynthetic arginine decarboxylase OS=Prochlorococcus marinus (strain MIT 9303) GN=speA PE=3 SV=1 85 315 1.0E-06
sp|B3EAF3|SPEA_GEOLS Biosynthetic arginine decarboxylase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=speA PE=3 SV=1 8 314 2.0E-06
sp|Q8RQM6|DCDA_COREF Diaminopimelate decarboxylase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=lysA PE=3 SV=1 90 425 6.0E-06
sp|Q50140|DCDA_MYCLE Diaminopimelate decarboxylase OS=Mycobacterium leprae (strain TN) GN=lysA PE=3 SV=2 90 435 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup719
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1730
Ophiocordyceps australis map64 (Brazil) OphauB2|7952 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03518
Ophiocordyceps camponoti-rufipedis Ophun1|4614
Ophiocordyceps kimflemingae Ophio5|8481
Ophiocordyceps subramaniannii Hirsu2|1681

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7952
MVMATAVLDNYSPNIAKHGHMLVKKPLYQSHAVLDAQQLIGEALHQRVTRINHDDCEPGDEDTFFVADLGEVYRQ
QLRWKKNLPRIKPFYAVKCNPDPQVLRLLAALGNGFDCASKGEIEQVLAMGVSPERIIYAQPCKTSSYLRYVKAA
GVKQMTFDNADELCKIAKHFPDAELFLRITTDDTSSMCRLSMKFGAALDTTPALLAVAKKLDLNVVGVSFHVGSG
ASDAGAYLKAVRDAHAVFTTARDLGFSMRTLDVGGGFCGDSFEKMAGTLRDACDDYFPAGCGVDIIAEPGRYFVS
SAFTIACNIIARRTIEDPALGDQGYMVYVNDGVYGNFSSIMFDHQHPMARILCSRGKTLYKTKASLPCGPDEGAE
YSIWGPTCDGIDRITASTHFTTILDVGDWLYFENMGAYTKCSATQFNGFSNSHDVIYVCSELGARALLDI*
Coding >OphauB2|7952
ATGGTTATGGCAACAGCAGTCCTTGACAACTATTCTCCAAACATCGCCAAACATGGACACATGTTGGTCAAGAAG
CCTCTTTACCAGAGCCATGCTGTCCTTGACGCCCAGCAGCTCATTGGCGAGGCTCTTCACCAGCGTGTGACGCGT
ATCAATCATGACGATTGCGAGCCTGGAGACGAAGACACCTTCTTCGTTGCTGACCTTGGCGAGGTCTACCGCCAG
CAACTCCGCTGGAAGAAGAATCTGCCTCGCATCAAGCCCTTTTATGCGGTCAAATGCAACCCTGACCCCCAGGTC
CTTCGCCTTTTGGCGGCATTGGGCAACGGCTTCGACTGTGCCTCCAAGGGCGAGATTGAACAAGTCCTTGCCATG
GGCGTTAGCCCTGAGCGCATCATTTATGCCCAGCCTTGCAAGACCAGCTCCTATCTCCGATATGTCAAGGCAGCC
GGCGTCAAGCAAATGACGTTTGACAATGCCGATGAGCTGTGCAAGATTGCCAAGCACTTTCCCGACGCTGAGCTT
TTCCTTCGTATCACGACGGACGACACGTCGAGCATGTGCCGCCTCAGCATGAAGTTTGGTGCTGCCCTTGATACC
ACTCCAGCTCTCCTGGCTGTGGCCAAGAAGCTTGACCTCAATGTTGTCGGTGTCAGCTTTCATGTTGGATCCGGT
GCATCGGACGCCGGCGCATACCTCAAGGCTGTTCGCGACGCCCACGCTGTCTTTACTACGGCACGAGACCTTGGC
TTCTCCATGCGCACTCTTGACGTTGGAGGTGGATTTTGCGGAGATTCATTCGAGAAGATGGCTGGAACACTGCGC
GACGCATGTGACGACTATTTCCCTGCTGGATGTGGTGTCGACATCATTGCCGAGCCAGGCCGCTACTTTGTCTCG
TCGGCCTTTACCATTGCCTGCAACATTATTGCTCGTCGCACTATTGAAGACCCAGCTCTAGGCGACCAAGGCTAC
ATGGTTTACGTCAACGATGGTGTTTATGGCAACTTTTCGAGCATCATGTTTGACCACCAGCATCCCATGGCTCGC
ATTCTTTGCTCGCGCGGCAAGACGCTTTACAAGACCAAGGCGAGCCTGCCCTGTGGTCCTGATGAAGGCGCTGAG
TATTCGATCTGGGGTCCAACCTGTGATGGCATCGACCGCATCACTGCCAGCACTCATTTTACCACGATTCTCGAC
GTGGGTGACTGGCTCTACTTTGAAAATATGGGTGCATACACCAAGTGCTCCGCCACGCAATTCAATGGCTTTTCC
AACTCGCACGATGTTATTTATGTGTGCAGCGAACTCGGAGCTAGGGCGCTTCTTGACATTTAG
Transcript >OphauB2|7952
ATGGTTATGGCAACAGCAGTCCTTGACAACTATTCTCCAAACATCGCCAAACATGGACACATGTTGGTCAAGAAG
CCTCTTTACCAGAGCCATGCTGTCCTTGACGCCCAGCAGCTCATTGGCGAGGCTCTTCACCAGCGTGTGACGCGT
ATCAATCATGACGATTGCGAGCCTGGAGACGAAGACACCTTCTTCGTTGCTGACCTTGGCGAGGTCTACCGCCAG
CAACTCCGCTGGAAGAAGAATCTGCCTCGCATCAAGCCCTTTTATGCGGTCAAATGCAACCCTGACCCCCAGGTC
CTTCGCCTTTTGGCGGCATTGGGCAACGGCTTCGACTGTGCCTCCAAGGGCGAGATTGAACAAGTCCTTGCCATG
GGCGTTAGCCCTGAGCGCATCATTTATGCCCAGCCTTGCAAGACCAGCTCCTATCTCCGATATGTCAAGGCAGCC
GGCGTCAAGCAAATGACGTTTGACAATGCCGATGAGCTGTGCAAGATTGCCAAGCACTTTCCCGACGCTGAGCTT
TTCCTTCGTATCACGACGGACGACACGTCGAGCATGTGCCGCCTCAGCATGAAGTTTGGTGCTGCCCTTGATACC
ACTCCAGCTCTCCTGGCTGTGGCCAAGAAGCTTGACCTCAATGTTGTCGGTGTCAGCTTTCATGTTGGATCCGGT
GCATCGGACGCCGGCGCATACCTCAAGGCTGTTCGCGACGCCCACGCTGTCTTTACTACGGCACGAGACCTTGGC
TTCTCCATGCGCACTCTTGACGTTGGAGGTGGATTTTGCGGAGATTCATTCGAGAAGATGGCTGGAACACTGCGC
GACGCATGTGACGACTATTTCCCTGCTGGATGTGGTGTCGACATCATTGCCGAGCCAGGCCGCTACTTTGTCTCG
TCGGCCTTTACCATTGCCTGCAACATTATTGCTCGTCGCACTATTGAAGACCCAGCTCTAGGCGACCAAGGCTAC
ATGGTTTACGTCAACGATGGTGTTTATGGCAACTTTTCGAGCATCATGTTTGACCACCAGCATCCCATGGCTCGC
ATTCTTTGCTCGCGCGGCAAGACGCTTTACAAGACCAAGGCGAGCCTGCCCTGTGGTCCTGATGAAGGCGCTGAG
TATTCGATCTGGGGTCCAACCTGTGATGGCATCGACCGCATCACTGCCAGCACTCATTTTACCACGATTCTCGAC
GTGGGTGACTGGCTCTACTTTGAAAATATGGGTGCATACACCAAGTGCTCCGCCACGCAATTCAATGGCTTTTCC
AACTCGCACGATGTTATTTATGTGTGCAGCGAACTCGGAGCTAGGGCGCTTCTTGACATTTAG
Gene >OphauB2|7952
ATGGTTATGGCAACAGCAGTCCTTGACAACTATTCTCCAAACATCGCCAAACATGGACACATGTTGGTCAAGAAG
CCTCTTTACCAGAGCCATGCTGTCCTTGACGCCCAGCAGCTCATTGGCGAGGCTCTTCACCAGCGTGTGACGCGT
ATCAATCATGACGATTGCGAGCCTGGAGACGAAGACACCTTCTTCGTTGCTGACCTTGGCGAGGTCTACCGCCAG
CAACTCCGCTGGAAGAAGAATCTGCCTCGCATCAAGCCCTTTTATGGTGAGTTGCCATGTTAGTTGCCTCGTATG
CAAATCAACATGCCAACTAATGCCGGCCCAGCGGTCAAATGCAACCCTGACCCCCAGGTCCTTCGCCTTTTGGCG
GCATTGGGCAACGGCTTCGACTGTGCCTCCAAGGGCGAGATTGAACAAGTCCTTGCCATGGGCGTTAGCCCTGAG
CGCATCATTTATGCCCAGCCTTGCAAGACCAGCTCCTATCTCCGATATGTCAAGGCAGCCGGCGTCAAGCAAATG
ACGTTTGACAATGCCGATGAGCTGTGCAAGATTGCCAAGCACTTTCCCGACGCTGAGCTTTTCCTTCGTATCACG
ACGGACGACACGTCGAGCATGTGCCGCCTCAGCATGAAGTTTGGTGCTGCCCTTGATACCACTCCAGCTCTCCTG
GCTGTGGCCAAGAAGCTTGACCTCAATGTTGTCGGTGTCAGCTTTCATGTTGGATCCGGTGCATCGGACGCCGGC
GCATACCTCAAGGCTGTTCGCGACGCCCACGCTGTCTTTACTACGGCACGAGACCTTGGCTTCTCCATGCGCACT
CTTGACGTTGGAGGTGGATTTTGCGGAGATTCATTCGAGAAGATGGCTGGAACACTGCGCGACGCATGTGACGAC
TATTTCCCTGCTGGATGTGGTGTCGACATCATTGCCGAGCCAGGCCGCTACTTTGTCTCGTCGGCCTTTACCATT
GCCTGCAACATTATTGCTCGTCGCACTATTGAAGACCCAGCTCTAGGCGACCAAGGCTACATGGTTTACGTCAAC
GATGGTGTTTATGGCAACTTTTCGAGCATCATGTTTGACCACCAGCATCCCATGGCTCGCATTCTTTGCTCGCGC
GGCAAGACGCTTTACAAGACCAAGGCGAGCCTGCCCTGTGGTCCTGATGAAGGCGCTGAGTATTCGATCTGGGGT
CCAACCTGTGATGGCATCGACCGCATCACTGCCAGCACTCATTTTACCACGATTCTCGACGTGGGTGACTGGCTC
TACTTTGAAAATATGGGTGCATACACCAAGTGCTCCGCCACGCAATTCAATGGCTTTTCCAACTCGCACGATGTT
ATTTATGTGTGCAGCGAACTCGGAGCTAGGGCGCTTCTTGACATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail