Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7950
Gene name
LocationContig_91:13002..14535
Strand-
Gene length (bp)1533
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09728 Taxilin Myosin-like coiled-coil protein 1.0E-98 38 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NUQ3|TXLNG_HUMAN Gamma-taxilin OS=Homo sapiens GN=TXLNG PE=1 SV=2 42 332 8.0E-27
sp|Q8BHN1|TXLNG_MOUSE Gamma-taxilin OS=Mus musculus GN=Txlng PE=1 SV=1 18 332 8.0E-27
sp|P40222|TXLNA_HUMAN Alpha-taxilin OS=Homo sapiens GN=TXLNA PE=1 SV=3 42 332 1.0E-25
sp|Q6PAM1|TXLNA_MOUSE Alpha-taxilin OS=Mus musculus GN=Txlna PE=1 SV=1 42 332 1.0E-25
sp|Q8N3L3|TXLNB_HUMAN Beta-taxilin OS=Homo sapiens GN=TXLNB PE=1 SV=3 42 334 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NUQ3|TXLNG_HUMAN Gamma-taxilin OS=Homo sapiens GN=TXLNG PE=1 SV=2 42 332 8.0E-27
sp|Q8BHN1|TXLNG_MOUSE Gamma-taxilin OS=Mus musculus GN=Txlng PE=1 SV=1 18 332 8.0E-27
sp|P40222|TXLNA_HUMAN Alpha-taxilin OS=Homo sapiens GN=TXLNA PE=1 SV=3 42 332 1.0E-25
sp|Q6PAM1|TXLNA_MOUSE Alpha-taxilin OS=Mus musculus GN=Txlna PE=1 SV=1 42 332 1.0E-25
sp|Q8N3L3|TXLNB_HUMAN Beta-taxilin OS=Homo sapiens GN=TXLNB PE=1 SV=3 42 334 2.0E-18
sp|Q8VBT1|TXLNB_MOUSE Beta-taxilin OS=Mus musculus GN=Txlnb PE=1 SV=2 42 334 9.0E-17
sp|Q9I969|TXLNB_CHICK Beta-taxilin OS=Gallus gallus GN=TXLNB PE=2 SV=1 20 334 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0019905 syntaxin binding Yes
GO:0005515 protein binding No
GO:0000149 SNARE binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7950
MDSTEASRLLQARITQLEQDAAGEKDQELEIEREVKRANRDLMQQVAKLDDMQKIEHLARRSSELLADMRRLEKE
NQKNKKRGDTLQKERDASRSELGKTIGLKEKLEKLCRELQRDNNKMKNENKELQTLQKRNAAAWDEKYDSLLSKL
EGYQEDKDVPRKQVVDIGMDELFRVRFKSFIEQYELRELHFHSLMRQKELEVQYHLARYEREKKSAETESSKSRQ
LQNQVQTFSKTETELRNQLNVYVDKFKQVEDTLNNSNDLFLSFRKEMEDMSKKGKKLEKENETLRRHKEATAANV
IRMAEERQDWKKKWEASEKKSNKLMSIIQQMQQQGRKVPASMSSTLESCHDNGQGGGEGDDSDYSEEAEDEELSE
FDEDTEDEAQPAQQQGRPIKYGPERPPQHQQQQRLPPPPPPPQSATNGL*
Coding >OphauB2|7950
ATGGATTCTACCGAAGCCTCGCGCCTTTTACAGGCCAGAATTACCCAACTGGAGCAGGATGCCGCCGGTGAAAAA
GACCAAGAGCTCGAAATAGAGCGCGAAGTCAAGAGAGCGAACCGCGACCTCATGCAGCAGGTGGCAAAACTCGAC
GACATGCAAAAGATTGAACACCTGGCCCGGCGTTCGAGCGAGCTTCTTGCCGACATGCGACGACTTGAAAAGGAA
AACCAGAAAAACAAAAAGCGTGGTGATACCTTGCAAAAAGAGCGCGACGCCAGCAGGTCTGAGCTTGGCAAGACC
ATTGGACTCAAGGAGAAGCTGGAAAAACTCTGCCGTGAGCTGCAAAGAGACAACAACAAGATGAAGAACGAGAAC
AAGGAGCTCCAAACTTTGCAGAAGCGCAATGCTGCGGCTTGGGATGAAAAGTATGACTCCCTTCTATCCAAGTTG
GAAGGTTACCAGGAAGACAAGGACGTGCCCCGTAAGCAGGTCGTCGATATCGGAATGGACGAGCTATTCCGTGTG
CGTTTCAAGTCGTTTATTGAGCAGTATGAATTGCGGGAGCTGCATTTTCATTCACTCATGCGCCAGAAGGAACTT
GAAGTCCAATATCACTTGGCACGTTACGAAAGAGAAAAGAAGTCTGCCGAGACTGAAAGTTCCAAGTCACGTCAG
CTCCAAAATCAAGTGCAAACCTTTTCTAAAACGGAAACAGAATTACGCAACCAGCTCAATGTTTACGTGGATAAA
TTTAAGCAGGTTGAAGATACATTGAACAACAGTAACGACTTATTCCTGTCCTTTCGTAAGGAGATGGAAGACATG
TCCAAGAAGGGTAAGAAGCTGGAAAAGGAGAACGAAACGTTGCGTCGACACAAGGAGGCAACTGCGGCCAATGTT
ATCCGAATGGCTGAAGAGCGCCAGGACTGGAAAAAAAAGTGGGAGGCGTCGGAGAAGAAGTCGAATAAGCTCATG
AGCATTATCCAGCAGATGCAGCAGCAGGGTCGCAAGGTGCCGGCGTCGATGAGTAGCACGCTGGAGAGTTGCCAC
GACAACGGCCAAGGCGGAGGCGAAGGAGATGATAGCGACTACTCTGAAGAAGCCGAAGACGAGGAGCTTAGTGAG
TTTGACGAGGATACGGAAGACGAGGCTCAGCCAGCACAGCAGCAGGGTCGGCCCATCAAGTATGGACCTGAGCGG
CCACCGCAGCACCAGCAACAGCAGAGGCTACCTCCGCCTCCCCCGCCGCCCCAGTCGGCAACTAATGGGCTGTAG
Transcript >OphauB2|7950
ATGGATTCTACCGAAGCCTCGCGCCTTTTACAGGCCAGAATTACCCAACTGGAGCAGGATGCCGCCGGTGAAAAA
GACCAAGAGCTCGAAATAGAGCGCGAAGTCAAGAGAGCGAACCGCGACCTCATGCAGCAGGTGGCAAAACTCGAC
GACATGCAAAAGATTGAACACCTGGCCCGGCGTTCGAGCGAGCTTCTTGCCGACATGCGACGACTTGAAAAGGAA
AACCAGAAAAACAAAAAGCGTGGTGATACCTTGCAAAAAGAGCGCGACGCCAGCAGGTCTGAGCTTGGCAAGACC
ATTGGACTCAAGGAGAAGCTGGAAAAACTCTGCCGTGAGCTGCAAAGAGACAACAACAAGATGAAGAACGAGAAC
AAGGAGCTCCAAACTTTGCAGAAGCGCAATGCTGCGGCTTGGGATGAAAAGTATGACTCCCTTCTATCCAAGTTG
GAAGGTTACCAGGAAGACAAGGACGTGCCCCGTAAGCAGGTCGTCGATATCGGAATGGACGAGCTATTCCGTGTG
CGTTTCAAGTCGTTTATTGAGCAGTATGAATTGCGGGAGCTGCATTTTCATTCACTCATGCGCCAGAAGGAACTT
GAAGTCCAATATCACTTGGCACGTTACGAAAGAGAAAAGAAGTCTGCCGAGACTGAAAGTTCCAAGTCACGTCAG
CTCCAAAATCAAGTGCAAACCTTTTCTAAAACGGAAACAGAATTACGCAACCAGCTCAATGTTTACGTGGATAAA
TTTAAGCAGGTTGAAGATACATTGAACAACAGTAACGACTTATTCCTGTCCTTTCGTAAGGAGATGGAAGACATG
TCCAAGAAGGGTAAGAAGCTGGAAAAGGAGAACGAAACGTTGCGTCGACACAAGGAGGCAACTGCGGCCAATGTT
ATCCGAATGGCTGAAGAGCGCCAGGACTGGAAAAAAAAGTGGGAGGCGTCGGAGAAGAAGTCGAATAAGCTCATG
AGCATTATCCAGCAGATGCAGCAGCAGGGTCGCAAGGTGCCGGCGTCGATGAGTAGCACGCTGGAGAGTTGCCAC
GACAACGGCCAAGGCGGAGGCGAAGGAGATGATAGCGACTACTCTGAAGAAGCCGAAGACGAGGAGCTTAGTGAG
TTTGACGAGGATACGGAAGACGAGGCTCAGCCAGCACAGCAGCAGGGTCGGCCCATCAAGTATGGACCTGAGCGG
CCACCGCAGCACCAGCAACAGCAGAGGCTACCTCCGCCTCCCCCGCCGCCCCAGTCGGCAACTAATGGGCTGTAG
Gene >OphauB2|7950
ATGGATTCTACCGAAGCCTCGCGCCTTTTACAGGCCAGAATTACCCAACTGGAGCAGGATGCCGCCGGTGAAAAA
GACCAAGAGCTCGAAATAGGTTGGCCTTTTGCCTGTTGGCCCGGTGCTTTGCGACGTGCTATGGGATTTGCTGAC
ATTTGATTGCCAGAGCGCGAAGTCAAGAGAGCGAACCGCGACCTCATGCAGCAGGTGGCAAAACTCGACGACATG
CAAAAGATTGAACACCTGGCCCGGCGTTCGAGCGAGCTTCTTGCCGACATGCGACGACTTGAAAAGGAAAACCAG
AAAAACAAAAAGCGTGGTGATACCTTGCAAAAAGAGCGCGACGCCAGCAGGTCTGAGCTTGGCAAGACCATTGGA
CTCAAGGAGAAGCTGGAAAAACTCTGCCGTGAGCTGCAAAGAGACAACAACAAGATGAAGGTTTGCTTGTCACCT
TGCGCGTGTCATCTTGCCAGAGACGCTGACAAATAGGCAGAACGAGAACAAGGAGCTCCAAACTTTGCAGAAGCG
CAATGCTGCGGCTTGGGATGAAAAGTATGACTCCCTTCTATCCAAGTTGGAAGGTTACCAGGAAGACAAGGACGT
GCCCCGTAAGCAGGTCGTCGATATCGGAATGGACGAGCTGTGAGTCGCTTCTCGATGAGGAATGTTGTTGCCATC
CCGCTCGCTGCTGACTTGATGGCCGCAGATTCCGTGTGCGTTTCAAGTCGTTTATTGAGCAGTATGAATTGCGGG
AGCTGCATTTTCATTCACTCATGCGCCAGAAGGAACTTGAAGTCCAATATCACTTGGCACGTTACGAAAGAGAAA
AGAAGTCTGCCGAGACTGAAAGTTCCAAGTCACGTCAGCTCCAAAATCAAGTGCAAACCTTTTCTAAAACGGAAA
CAGAATTACGCAACCAGCTCAATGTTTACGTGGATAAATTTAAGCAGGTTTGTTGTACTATGAGTTGGTAGACAA
GGAACACACAAGAGGAAGCTAACGATGGCTGCTCACCGACAGGTTGAAGATACATTGAACAACAGTAACGACTTA
TTCCTGTCCTTTCGTAAGGAGATGGAAGACATGTCCAAGAAGGGTAAGAAGCTGGAAAAGGAGAACGAAACGTTG
CGTCGACACAAGGAGGCAACTGCGGCCAATGTTATCCGAATGGCTGAAGAGCGCCAGGACTGGAAAAAAAAGTGG
GAGGCGTCGGAGAAGAAGTCGAATAAGCTCATGAGCATTATCCAGCAGATGCAGCAGCAGGGTCGCAAGGTGCCG
GCGTCGATGAGTAGCACGCTGGAGAGTTGCCACGACAACGGCCAAGGCGGAGGCGAAGGAGATGATAGCGACTAC
TCTGAAGAAGCCGAAGACGAGGAGCTTAGTGAGTTTGACGAGGATACGGAAGACGAGGCTCAGCCAGCACAGCAG
CAGGGTCGGCCCATCAAGTATGGACCTGAGCGGCCACCGCAGCACCAGCAACAGCAGAGGCTACCTCCGCCTCCC
CCGCCGCCCCAGTCGGCAACTAATGGGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail