Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7945
Gene name
LocationContig_90:74719..78180
Strand+
Gene length (bp)3461
Transcript length (bp)3336
Coding sequence length (bp)3336
Protein length (aa) 1112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 7.3E-07 603 635
PF00806 PUF Pumilio-family RNA binding repeat 2.5E-02 638 670
PF00806 PUF Pumilio-family RNA binding repeat 2.4E-02 681 698
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.4E-12 395 453

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 395 900 1.0E-127
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 391 883 2.0E-120
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 523 899 4.0E-92
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 405 923 8.0E-91
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 589 874 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60059|YG58_SCHPO Pumilio domain-containing protein C56F2.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC56F2.08c PE=1 SV=1 395 900 1.0E-127
sp|Q9P789|YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP35G2.14 PE=1 SV=2 391 883 2.0E-120
sp|P47135|JSN1_YEAST Protein JSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JSN1 PE=1 SV=1 523 899 4.0E-92
sp|Q12221|PUF2_YEAST mRNA-binding protein PUF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF2 PE=1 SV=1 405 923 8.0E-91
sp|Q92359|YDHE_SCHPO Pumilio domain-containing protein C6G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G9.14 PE=3 SV=1 589 874 4.0E-25
sp|P25339|PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF4 PE=1 SV=2 604 869 3.0E-19
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 591 871 2.0E-18
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 591 871 2.0E-17
sp|Q9LVC3|PUM12_ARATH Pumilio homolog 12 OS=Arabidopsis thaliana GN=APUM12 PE=2 SV=2 591 767 3.0E-17
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 591 871 3.0E-17
sp|Q9LM20|PUM8_ARATH Putative pumilio homolog 8, chloroplastic OS=Arabidopsis thaliana GN=APUM8 PE=3 SV=2 598 828 5.0E-16
sp|Q9LDW3|PUM11_ARATH Pumilio homolog 11 OS=Arabidopsis thaliana GN=APUM11 PE=3 SV=2 590 767 1.0E-15
sp|Q1PFN9|PUM9_ARATH Pumilio homolog 9 OS=Arabidopsis thaliana GN=APUM9 PE=2 SV=1 576 834 2.0E-15
sp|Q9SS47|PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana GN=APUM4 PE=1 SV=2 598 871 3.0E-14
sp|Q9LJX4|PUM5_ARATH Pumilio homolog 5 OS=Arabidopsis thaliana GN=APUM5 PE=1 SV=2 591 871 5.0E-14
sp|Q9LP21|PUM10_ARATH Putative pumilio homolog 10 OS=Arabidopsis thaliana GN=APUM10 PE=3 SV=2 595 865 2.0E-13
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 576 855 2.0E-12
sp|Q9C9R6|PUM7_ARATH Putative pumilio homolog 7, chloroplastic OS=Arabidopsis thaliana GN=APUM7 PE=3 SV=2 598 829 5.0E-12
sp|P25822|PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster GN=pum PE=1 SV=2 590 834 4.0E-11
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 590 810 7.0E-11
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 590 810 7.0E-11
sp|E3WDQ9|PUM2_XENLA Pumilio homolog 2 OS=Xenopus laevis GN=pum2 PE=1 SV=1 590 810 9.0E-11
sp|Q9ZW02|PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana GN=APUM3 PE=1 SV=1 573 815 1.0E-10
sp|Q07807|PUF3_YEAST mRNA-binding protein PUF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUF3 PE=1 SV=1 588 872 1.0E-10
sp|Q09829|YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.03c PE=3 SV=1 599 844 1.0E-10
sp|Q9ZW07|PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana GN=APUM1 PE=1 SV=1 573 815 1.0E-10
sp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana GN=APUM6 PE=1 SV=1 576 779 2.0E-10
sp|Q8TB72|PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens GN=PUM2 PE=1 SV=2 576 789 3.0E-10
sp|Q80U58|PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus GN=Pum2 PE=1 SV=2 576 789 3.0E-10
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 590 810 6.0E-10
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 590 810 8.0E-10
sp|O94462|PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=puf3 PE=2 SV=4 605 815 9.0E-10
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 590 810 9.0E-10
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 576 789 1.0E-09
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 590 825 1.0E-09
sp|Q2VB19|PUM1_CHICK Pumilio homolog 1 OS=Gallus gallus GN=PUM1 PE=2 SV=1 590 825 2.0E-09
sp|Q66KI6|PUM1_XENLA Pumilio homolog 1 OS=Xenopus laevis GN=pum1 PE=1 SV=1 576 778 2.0E-09
sp|Q80U78|PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus GN=Pum1 PE=1 SV=2 576 789 4.0E-09
sp|Q14671|PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens GN=PUM1 PE=1 SV=3 576 789 5.0E-09
sp|Q5R5X3|PUM1_PONAB Pumilio homolog 1 OS=Pongo abelii GN=PUM1 PE=2 SV=1 576 778 5.0E-09
sp|Q9ZW06|PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana GN=APUM2 PE=1 SV=1 573 815 2.0E-08
sp|P32831|NGR1_YEAST Negative growth regulatory protein NGR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGR1 PE=1 SV=2 393 471 1.0E-06
sp|Q8LPQ9|FPA_ARATH Flowering time control protein FPA OS=Arabidopsis thaliana GN=FPA PE=2 SV=2 381 486 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup474
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5945
Ophiocordyceps australis map64 (Brazil) OphauB2|7945 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06480
Ophiocordyceps camponoti-rufipedis Ophun1|1610
Ophiocordyceps camponoti-rufipedis Ophun1|2376
Ophiocordyceps kimflemingae Ophio5|8585
Ophiocordyceps subramaniannii Hirsu2|10454

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7945
MAANSRSGAGSPSHEMAGSSRLFSKRAREIQAQEGIPGLPINPWGGPPTSGNSTPLRENIPESPTDGFPDFGQLP
TPESLPQTRRARAGTVPSRFSPGGPANGLLNVPNIAPVSTRATPSQTPYNKSPSPSLEHAENTSSGSTLLSRLRA
GSMPQRSPFHPMTSTGSPFGPSIFSSNWNPASVGRERASTLASIASIGSNGPSSPAQSQFSREGGGESNVHMRTL
DYLGLAETPQPPRAQLATPYLANMTYSTQPSRFRSYSVNNKDKYADEEDDYEDYAAALQDQLAATQAAIHNHNLA
VQAFVNQASATRPRAHTAGVLDAPGSRFVPSYAGPSSGAPSNLASAAGEMRGPDKHEYDDLAQAMAGVSIGRSMS
GNAGLLSAEEQGLEGPTSALWLGGVPTSTTTSTLTEMFKAHGSILSARVLTHKNCGFVNFEKVESAMSAKSSLNG
KEIFPGAGPIRINFAKPPSASNTPGPDGVFPSPSPDPFGKGQEGAHGAASAGTAGQGTSAGTSAPSLGEMTADIV
EIVVQFGATEEDKSHISHCVKSALHYQGYAEEIPPIREPSQTRVHDAPRLRDIRKRIDNQLMPQAEIESVAMDML
PEIAELSSDYLGNTVVQKLFEHCSDPVRDAMLDKIAPHLAEIGVHKNGTWAAQKIIDVCKTRNQMSIIVEHLRRY
TVLLFLDQYGNYVLQGCLKFGSPFNDFIFETMLSRLWDIAQGRFGARAMRACLESHHSSKNQQRMLAAAIALNSV
PLATNANGALLLTWLLDTCTFPQRRTVLSPRLEPCLVHLCTHKVAYLTVLKVINQKAEADARDAMLRAMFFSPND
QVLEAILSDHSCGATLIFKVLTTPFFDDRIRAQVVENVKRVLCGIKAQPNQGYKRLMDEVGLLIRGPASSRDGTG
PSEQRQRPGPRQGGPNGQHAHGKQAYLSAAASQAPFDAMYAVPRNDSTDASLASFPGYGQSLMYNATAAGTVNSA
INLQQLHYQQSLMAARSAPQLNYNFPPQTNYGPYGAPNATVDPYRQQSVANGTPVQMPSPQLSHMAGNQGSYGQT
GFGLPMGAAFSYGNLGGMQGINYMQQDANSNTNSNNATANSQHHNSHNNHNNSNSRRGRVR*
Coding >OphauB2|7945
ATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGATGGCTGGATCGAGCCGCCTCTTCTCCAAA
AGAGCACGCGAGATTCAGGCTCAAGAAGGCATTCCTGGCCTACCTATCAATCCGTGGGGAGGTCCTCCTACAAGC
GGCAACTCAACACCCTTGCGCGAGAATATTCCAGAGTCTCCGACGGACGGATTTCCCGACTTTGGTCAGCTACCG
ACGCCTGAGAGTCTTCCTCAGACACGTCGAGCAAGAGCTGGCACGGTCCCTTCGCGTTTTTCTCCCGGTGGCCCA
GCCAACGGTCTGTTGAACGTGCCAAATATTGCCCCCGTCTCTACCAGGGCTACTCCCTCTCAAACACCTTATAAC
AAATCCCCATCCCCTAGTCTTGAGCACGCTGAAAATACATCGAGCGGCTCCACGCTTTTGTCGCGACTAAGGGCC
GGGTCTATGCCACAGCGCAGCCCCTTTCACCCTATGACGAGTACTGGCTCTCCTTTTGGGCCCTCAATTTTTAGT
AGTAACTGGAACCCAGCGAGTGTGGGCCGCGAGAGAGCATCTACTCTTGCGAGTATTGCTAGCATTGGCTCCAAC
GGACCCAGTTCTCCAGCGCAGTCACAATTCTCGAGAGAAGGTGGCGGAGAGTCCAACGTGCACATGCGCACGCTT
GACTATCTGGGACTTGCAGAGACACCGCAGCCCCCAAGAGCTCAACTAGCAACCCCTTATCTGGCCAATATGACT
TATTCAACGCAGCCAAGTCGCTTTCGCTCCTATTCAGTCAACAACAAGGACAAGTACGCAGATGAGGAAGACGAC
TATGAGGACTATGCCGCTGCGCTACAGGACCAACTAGCTGCCACACAGGCGGCCATTCACAACCACAACTTGGCT
GTGCAGGCTTTTGTCAATCAGGCATCTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGATGCTCCTGGA
AGTCGTTTCGTGCCCTCGTATGCAGGCCCCAGCTCGGGTGCGCCCAGCAACCTGGCGTCAGCCGCCGGGGAGATG
CGTGGGCCGGACAAGCACGAGTATGACGATTTGGCCCAGGCCATGGCGGGCGTGAGCATTGGCAGATCTATGAGT
GGCAACGCGGGCCTGTTGAGCGCCGAGGAGCAAGGGCTAGAAGGCCCAACGAGTGCCCTGTGGCTCGGAGGAGTG
CCAACGTCGACGACGACATCGACGCTGACTGAGATGTTCAAGGCACATGGCTCTATTTTGTCTGCTCGCGTTCTC
ACGCACAAGAATTGCGGATTTGTCAATTTTGAAAAGGTTGAGAGCGCCATGTCGGCCAAGAGCAGCCTCAACGGC
AAGGAGATTTTTCCTGGCGCAGGCCCCATTCGTATCAATTTTGCCAAGCCGCCTTCGGCCTCCAACACTCCTGGT
CCCGACGGCGTCTTCCCTTCGCCCAGCCCAGATCCCTTTGGCAAAGGCCAAGAAGGTGCGCACGGCGCCGCCTCT
GCCGGCACGGCGGGACAGGGCACAAGCGCGGGCACAAGTGCGCCGTCGCTGGGTGAAATGACGGCGGACATTGTG
GAAATCGTGGTGCAGTTTGGGGCGACTGAGGAGGATAAGAGCCACATCAGCCACTGCGTCAAGTCTGCCCTTCAC
TACCAGGGCTATGCCGAGGAGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGTGTTCATGATGCTCCGAGGCTC
AGAGACATCCGCAAGCGCATTGACAATCAGCTGATGCCGCAAGCCGAGATAGAAAGCGTGGCCATGGACATGCTG
CCAGAGATTGCAGAGCTCTCGTCGGACTACTTGGGCAACACTGTGGTGCAGAAGCTGTTTGAGCACTGTTCGGAC
CCGGTGCGGGATGCCATGCTGGACAAGATTGCGCCACACCTGGCTGAGATTGGCGTGCACAAGAATGGCACCTGG
GCCGCGCAAAAGATTATCGACGTTTGCAAGACGCGGAACCAAATGTCCATTATTGTTGAGCACTTGCGTCGGTAC
ACGGTGCTCCTGTTTTTGGACCAGTATGGCAACTATGTCTTGCAGGGATGCCTCAAGTTTGGCTCGCCCTTCAAC
GACTTCATCTTTGAGACGATGCTGAGCCGCCTGTGGGACATTGCCCAAGGCCGCTTTGGCGCACGTGCCATGAGG
GCCTGTCTGGAGAGCCACCATTCTAGTAAGAACCAGCAGCGCATGCTGGCCGCCGCCATTGCTCTCAACAGTGTC
CCGCTGGCCACCAATGCCAATGGCGCCTTGCTCCTCACCTGGCTGCTTGATACCTGCACATTTCCCCAGCGACGC
ACCGTCTTGTCTCCCCGCCTGGAGCCGTGTCTGGTGCATCTCTGCACCCACAAGGTGGCCTATCTTACCGTCCTC
AAGGTTATCAACCAAAAGGCCGAGGCAGACGCACGTGATGCCATGCTCAGGGCCATGTTCTTCTCGCCCAATGAC
CAGGTGCTCGAGGCAATTCTGAGCGATCATTCGTGTGGCGCAACGCTCATCTTCAAGGTGCTGACGACGCCCTTT
TTCGACGATAGGATCAGGGCGCAGGTGGTGGAGAATGTGAAGCGCGTCCTGTGCGGCATCAAGGCCCAGCCCAAC
CAGGGCTACAAGCGCCTCATGGACGAGGTTGGCCTCTTGATCAGGGGGCCAGCATCAAGCCGCGATGGCACTGGG
CCTTCGGAGCAGCGCCAGCGCCCCGGCCCAAGGCAAGGCGGCCCCAACGGGCAGCATGCCCATGGCAAGCAGGCC
TACTTGAGTGCCGCCGCCAGCCAAGCGCCCTTTGATGCAATGTATGCCGTGCCCAGAAACGACAGCACTGACGCC
AGTCTGGCCAGCTTCCCAGGCTATGGTCAGAGCCTCATGTACAATGCCACTGCGGCAGGCACCGTCAACTCAGCC
ATTAATTTGCAGCAGCTGCATTACCAGCAGAGCTTGATGGCAGCCAGGAGCGCGCCGCAGCTCAACTATAACTTT
CCTCCCCAAACCAACTACGGCCCCTATGGCGCCCCCAACGCAACCGTGGACCCCTACCGCCAGCAAAGTGTAGCC
AATGGCACTCCTGTGCAAATGCCGTCGCCACAGCTCTCTCATATGGCGGGCAACCAGGGCTCGTACGGCCAAACT
GGCTTTGGCCTGCCCATGGGAGCCGCCTTTAGCTATGGAAACCTTGGCGGCATGCAGGGCATCAACTACATGCAG
CAAGATGCCAATAGCAATACCAATAGCAACAATGCTACTGCAAACAGTCAGCATCACAACAGTCATAACAATCAC
AACAACAGTAATTCTAGGCGCGGTCGGGTACGTTGA
Transcript >OphauB2|7945
ATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGATGGCTGGATCGAGCCGCCTCTTCTCCAAA
AGAGCACGCGAGATTCAGGCTCAAGAAGGCATTCCTGGCCTACCTATCAATCCGTGGGGAGGTCCTCCTACAAGC
GGCAACTCAACACCCTTGCGCGAGAATATTCCAGAGTCTCCGACGGACGGATTTCCCGACTTTGGTCAGCTACCG
ACGCCTGAGAGTCTTCCTCAGACACGTCGAGCAAGAGCTGGCACGGTCCCTTCGCGTTTTTCTCCCGGTGGCCCA
GCCAACGGTCTGTTGAACGTGCCAAATATTGCCCCCGTCTCTACCAGGGCTACTCCCTCTCAAACACCTTATAAC
AAATCCCCATCCCCTAGTCTTGAGCACGCTGAAAATACATCGAGCGGCTCCACGCTTTTGTCGCGACTAAGGGCC
GGGTCTATGCCACAGCGCAGCCCCTTTCACCCTATGACGAGTACTGGCTCTCCTTTTGGGCCCTCAATTTTTAGT
AGTAACTGGAACCCAGCGAGTGTGGGCCGCGAGAGAGCATCTACTCTTGCGAGTATTGCTAGCATTGGCTCCAAC
GGACCCAGTTCTCCAGCGCAGTCACAATTCTCGAGAGAAGGTGGCGGAGAGTCCAACGTGCACATGCGCACGCTT
GACTATCTGGGACTTGCAGAGACACCGCAGCCCCCAAGAGCTCAACTAGCAACCCCTTATCTGGCCAATATGACT
TATTCAACGCAGCCAAGTCGCTTTCGCTCCTATTCAGTCAACAACAAGGACAAGTACGCAGATGAGGAAGACGAC
TATGAGGACTATGCCGCTGCGCTACAGGACCAACTAGCTGCCACACAGGCGGCCATTCACAACCACAACTTGGCT
GTGCAGGCTTTTGTCAATCAGGCATCTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGATGCTCCTGGA
AGTCGTTTCGTGCCCTCGTATGCAGGCCCCAGCTCGGGTGCGCCCAGCAACCTGGCGTCAGCCGCCGGGGAGATG
CGTGGGCCGGACAAGCACGAGTATGACGATTTGGCCCAGGCCATGGCGGGCGTGAGCATTGGCAGATCTATGAGT
GGCAACGCGGGCCTGTTGAGCGCCGAGGAGCAAGGGCTAGAAGGCCCAACGAGTGCCCTGTGGCTCGGAGGAGTG
CCAACGTCGACGACGACATCGACGCTGACTGAGATGTTCAAGGCACATGGCTCTATTTTGTCTGCTCGCGTTCTC
ACGCACAAGAATTGCGGATTTGTCAATTTTGAAAAGGTTGAGAGCGCCATGTCGGCCAAGAGCAGCCTCAACGGC
AAGGAGATTTTTCCTGGCGCAGGCCCCATTCGTATCAATTTTGCCAAGCCGCCTTCGGCCTCCAACACTCCTGGT
CCCGACGGCGTCTTCCCTTCGCCCAGCCCAGATCCCTTTGGCAAAGGCCAAGAAGGTGCGCACGGCGCCGCCTCT
GCCGGCACGGCGGGACAGGGCACAAGCGCGGGCACAAGTGCGCCGTCGCTGGGTGAAATGACGGCGGACATTGTG
GAAATCGTGGTGCAGTTTGGGGCGACTGAGGAGGATAAGAGCCACATCAGCCACTGCGTCAAGTCTGCCCTTCAC
TACCAGGGCTATGCCGAGGAGATTCCTCCGATTCGCGAGCCGTCTCAGACGCGTGTTCATGATGCTCCGAGGCTC
AGAGACATCCGCAAGCGCATTGACAATCAGCTGATGCCGCAAGCCGAGATAGAAAGCGTGGCCATGGACATGCTG
CCAGAGATTGCAGAGCTCTCGTCGGACTACTTGGGCAACACTGTGGTGCAGAAGCTGTTTGAGCACTGTTCGGAC
CCGGTGCGGGATGCCATGCTGGACAAGATTGCGCCACACCTGGCTGAGATTGGCGTGCACAAGAATGGCACCTGG
GCCGCGCAAAAGATTATCGACGTTTGCAAGACGCGGAACCAAATGTCCATTATTGTTGAGCACTTGCGTCGGTAC
ACGGTGCTCCTGTTTTTGGACCAGTATGGCAACTATGTCTTGCAGGGATGCCTCAAGTTTGGCTCGCCCTTCAAC
GACTTCATCTTTGAGACGATGCTGAGCCGCCTGTGGGACATTGCCCAAGGCCGCTTTGGCGCACGTGCCATGAGG
GCCTGTCTGGAGAGCCACCATTCTAGTAAGAACCAGCAGCGCATGCTGGCCGCCGCCATTGCTCTCAACAGTGTC
CCGCTGGCCACCAATGCCAATGGCGCCTTGCTCCTCACCTGGCTGCTTGATACCTGCACATTTCCCCAGCGACGC
ACCGTCTTGTCTCCCCGCCTGGAGCCGTGTCTGGTGCATCTCTGCACCCACAAGGTGGCCTATCTTACCGTCCTC
AAGGTTATCAACCAAAAGGCCGAGGCAGACGCACGTGATGCCATGCTCAGGGCCATGTTCTTCTCGCCCAATGAC
CAGGTGCTCGAGGCAATTCTGAGCGATCATTCGTGTGGCGCAACGCTCATCTTCAAGGTGCTGACGACGCCCTTT
TTCGACGATAGGATCAGGGCGCAGGTGGTGGAGAATGTGAAGCGCGTCCTGTGCGGCATCAAGGCCCAGCCCAAC
CAGGGCTACAAGCGCCTCATGGACGAGGTTGGCCTCTTGATCAGGGGGCCAGCATCAAGCCGCGATGGCACTGGG
CCTTCGGAGCAGCGCCAGCGCCCCGGCCCAAGGCAAGGCGGCCCCAACGGGCAGCATGCCCATGGCAAGCAGGCC
TACTTGAGTGCCGCCGCCAGCCAAGCGCCCTTTGATGCAATGTATGCCGTGCCCAGAAACGACAGCACTGACGCC
AGTCTGGCCAGCTTCCCAGGCTATGGTCAGAGCCTCATGTACAATGCCACTGCGGCAGGCACCGTCAACTCAGCC
ATTAATTTGCAGCAGCTGCATTACCAGCAGAGCTTGATGGCAGCCAGGAGCGCGCCGCAGCTCAACTATAACTTT
CCTCCCCAAACCAACTACGGCCCCTATGGCGCCCCCAACGCAACCGTGGACCCCTACCGCCAGCAAAGTGTAGCC
AATGGCACTCCTGTGCAAATGCCGTCGCCACAGCTCTCTCATATGGCGGGCAACCAGGGCTCGTACGGCCAAACT
GGCTTTGGCCTGCCCATGGGAGCCGCCTTTAGCTATGGAAACCTTGGCGGCATGCAGGGCATCAACTACATGCAG
CAAGATGCCAATAGCAATACCAATAGCAACAATGCTACTGCAAACAGTCAGCATCACAACAGTCATAACAATCAC
AACAACAGTAATTCTAGGCGCGGTCGGGTACGTTGA
Gene >OphauB2|7945
ATGGCTGCCAACTCTCGGTCCGGGGCTGGTTCTCCGTCGCATGAGATGGCTGGATCGAGCCGCCTCTTCTCCAAA
AGGTTCGTGTTTGCATATTTAAAAAAAAAAAAAAAAAAAAAAAAAAGTTCAAGCCGTATCCAGCCTTTTCTTTTC
TATTTACCAATGCTAATCCTGGTTTGCTTTTGCTGCTGTTCTTTCTTGCCAGAGCACGCGAGATTCAGGCTCAAG
AAGGCATTCCTGGCCTACCTATCAATCCGTGGGGAGGTCCTCCTACAAGCGGCAACTCAACACCCTTGCGCGAGA
ATATTCCAGAGTCTCCGACGGACGGATTTCCCGACTTTGGTCAGCTACCGACGCCTGAGAGTCTTCCTCAGACAC
GTCGAGCAAGAGCTGGCACGGTCCCTTCGCGTTTTTCTCCCGGTGGCCCAGCCAACGGTCTGTTGAACGTGCCAA
ATATTGCCCCCGTCTCTACCAGGGCTACTCCCTCTCAAACACCTTATAACAAATCCCCATCCCCTAGTCTTGAGC
ACGCTGAAAATACATCGAGCGGCTCCACGCTTTTGTCGCGACTAAGGGCCGGGTCTATGCCACAGCGCAGCCCCT
TTCACCCTATGACGAGTACTGGCTCTCCTTTTGGGCCCTCAATTTTTAGTAGTAACTGGAACCCAGCGAGTGTGG
GCCGCGAGAGAGCATCTACTCTTGCGAGTATTGCTAGCATTGGCTCCAACGGACCCAGTTCTCCAGCGCAGTCAC
AATTCTCGAGAGAAGGTGGCGGAGAGTCCAACGTGCACATGCGCACGCTTGACTATCTGGGACTTGCAGAGACAC
CGCAGCCCCCAAGAGCTCAACTAGCAACCCCTTATCTGGCCAATATGACTTATTCAACGCAGCCAAGTCGCTTTC
GCTCCTATTCAGTCAACAACAAGGACAAGTACGCAGATGAGGAAGACGACTATGAGGACTATGCCGCTGCGCTAC
AGGACCAACTAGCTGCCACACAGGCGGCCATTCACAACCACAACTTGGCTGTGCAGGCTTTTGTCAATCAGGCAT
CTGCCACGCGGCCGCGTGCTCACACTGCGGGCGTCTTGGATGCTCCTGGAAGTCGTTTCGTGCCCTCGTATGCAG
GCCCCAGCTCGGGTGCGCCCAGCAACCTGGCGTCAGCCGCCGGGGAGATGCGTGGGCCGGACAAGCACGAGTATG
ACGATTTGGCCCAGGCCATGGCGGGCGTGAGCATTGGCAGATCTATGAGTGGCAACGCGGGCCTGTTGAGCGCCG
AGGAGCAAGGGCTAGAAGGCCCAACGAGTGCCCTGTGGCTCGGAGGAGTGCCAACGTCGACGACGACATCGACGC
TGACTGAGATGTTCAAGGCACATGGCTCTATTTTGTCTGCTCGCGTTCTCACGCACAAGAATTGCGGATTTGTCA
ATTTTGAAAAGGTTGAGAGCGCCATGTCGGCCAAGAGCAGCCTCAACGGCAAGGAGATTTTTCCTGGCGCAGGCC
CCATTCGTATCAATTTTGCCAAGCCGCCTTCGGCCTCCAACACTCCTGGTCCCGACGGCGTCTTCCCTTCGCCCA
GCCCAGATCCCTTTGGCAAAGGCCAAGAAGGTGCGCACGGCGCCGCCTCTGCCGGCACGGCGGGACAGGGCACAA
GCGCGGGCACAAGTGCGCCGTCGCTGGGTGAAATGACGGCGGACATTGTGGAAATCGTGGTGCAGTTTGGGGCGA
CTGAGGAGGATAAGAGCCACATCAGCCACTGCGTCAAGTCTGCCCTTCACTACCAGGGCTATGCCGAGGAGATTC
CTCCGATTCGCGAGCCGTCTCAGACGCGTGTTCATGATGCTCCGAGGCTCAGAGACATCCGCAAGCGCATTGACA
ATCAGCTGATGCCGCAAGCCGAGATAGAAAGCGTGGCCATGGACATGCTGCCAGAGATTGCAGAGCTCTCGTCGG
ACTACTTGGGCAACACTGTGGTGCAGAAGCTGTTTGAGCACTGTTCGGACCCGGTGCGGGATGCCATGCTGGACA
AGATTGCGCCACACCTGGCTGAGATTGGCGTGCACAAGAATGGCACCTGGGCCGCGCAAAAGATTATCGACGTTT
GCAAGACGCGGAACCAAATGTCCATTATTGTTGAGCACTTGCGTCGGTACACGGTGCTCCTGTTTTTGGACCAGT
ATGGCAACTATGTCTTGCAGGGATGCCTCAAGTTTGGCTCGCCCTTCAACGACTTCATCTTTGAGACGATGCTGA
GCCGCCTGTGGGACATTGCCCAAGGCCGCTTTGGCGCACGTGCCATGAGGGCCTGTCTGGAGAGCCACCATTCTA
GTAAGAACCAGCAGCGCATGCTGGCCGCCGCCATTGCTCTCAACAGTGTCCCGCTGGCCACCAATGCCAATGGCG
CCTTGCTCCTCACCTGGCTGCTTGATACCTGCACATTTCCCCAGCGACGCACCGTCTTGTCTCCCCGCCTGGAGC
CGTGTCTGGTGCATCTCTGCACCCACAAGGTGGCCTATCTTACCGTCCTCAAGGTTATCAACCAAAAGGCCGAGG
CAGACGCACGTGATGCCATGCTCAGGGCCATGTTCTTCTCGCCCAATGACCAGGTGCTCGAGGCAATTCTGAGCG
ATCATTCGTGTGGCGCAACGCTCATCTTCAAGGTGCTGACGACGCCCTTTTTCGACGATAGGATCAGGGCGCAGG
TGGTGGAGAATGTGAAGCGCGTCCTGTGCGGCATCAAGGCCCAGCCCAACCAGGGCTACAAGCGCCTCATGGACG
AGGTTGGCCTCTTGATCAGGGGGCCAGCATCAAGCCGCGATGGCACTGGGCCTTCGGAGCAGCGCCAGCGCCCCG
GCCCAAGGCAAGGCGGCCCCAACGGGCAGCATGCCCATGGCAAGCAGGCCTACTTGAGTGCCGCCGCCAGCCAAG
CGCCCTTTGATGCAATGTATGCCGTGCCCAGAAACGACAGCACTGACGCCAGTCTGGCCAGCTTCCCAGGCTATG
GTCAGAGCCTCATGTACAATGCCACTGCGGCAGGCACCGTCAACTCAGCCATTAATTTGCAGCAGCTGCATTACC
AGCAGAGCTTGATGGCAGCCAGGAGCGCGCCGCAGCTCAACTATAACTTTCCTCCCCAAACCAACTACGGCCCCT
ATGGCGCCCCCAACGCAACCGTGGACCCCTACCGCCAGCAAAGTGTAGCCAATGGCACTCCTGTGCAAATGCCGT
CGCCACAGCTCTCTCATATGGCGGGCAACCAGGGCTCGTACGGCCAAACTGGCTTTGGCCTGCCCATGGGAGCCG
CCTTTAGCTATGGAAACCTTGGCGGCATGCAGGGCATCAACTACATGCAGCAAGATGCCAATAGCAATACCAATA
GCAACAATGCTACTGCAAACAGTCAGCATCACAACAGTCATAACAATCACAACAACAGTAATTCTAGGCGCGGTC
GGGTACGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail