Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7936
Gene name
LocationContig_90:52575..54279
Strand+
Gene length (bp)1704
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.7E-30 132 350
PF00271 Helicase_C Helicase conserved C-terminal domain 3.3E-19 421 535
PF04851 ResIII Type III restriction enzyme, res subunit 6.3E-05 131 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBR1|MRH4_NEUCR ATP-dependent RNA helicase mrh4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-15 PE=3 SV=1 6 567 0.0E+00
sp|A4QTC6|MRH4_MAGO7 ATP-dependent RNA helicase MRH4, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MRH4 PE=3 SV=1 2 567 0.0E+00
sp|A1DGF2|MRH4_NEOFI ATP-dependent RNA helicase mrh4, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mrh4 PE=3 SV=1 7 567 2.0E-170
sp|A2QZ71|MRH4_ASPNC ATP-dependent RNA helicase mrh4, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mrh4 PE=3 SV=2 1 567 2.0E-169
sp|Q4X1X0|MRH4_ASPFU ATP-dependent RNA helicase mrh4, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrh4 PE=3 SV=1 7 567 6.0E-168
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBR1|MRH4_NEUCR ATP-dependent RNA helicase mrh4, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-15 PE=3 SV=1 6 567 0.0E+00
sp|A4QTC6|MRH4_MAGO7 ATP-dependent RNA helicase MRH4, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MRH4 PE=3 SV=1 2 567 0.0E+00
sp|A1DGF2|MRH4_NEOFI ATP-dependent RNA helicase mrh4, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mrh4 PE=3 SV=1 7 567 2.0E-170
sp|A2QZ71|MRH4_ASPNC ATP-dependent RNA helicase mrh4, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mrh4 PE=3 SV=2 1 567 2.0E-169
sp|Q4X1X0|MRH4_ASPFU ATP-dependent RNA helicase mrh4, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrh4 PE=3 SV=1 7 567 6.0E-168
sp|Q2TZH2|MRH4_ASPOR ATP-dependent RNA helicase mrh4, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mrh4 PE=3 SV=1 7 567 7.0E-167
sp|Q0C9E8|MRH4_ASPTN ATP-dependent RNA helicase mrh4, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mrh4 PE=3 SV=2 7 567 2.0E-166
sp|A1CSR1|MRH4_ASPCL ATP-dependent RNA helicase mrh4, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mrh4 PE=3 SV=2 7 567 1.0E-165
sp|A7EWH6|MRH4_SCLS1 ATP-dependent RNA helicase mrh4, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mrh4 PE=3 SV=1 9 567 3.0E-162
sp|Q1E9B7|MRH4_COCIM ATP-dependent RNA helicase MRH4, mitochondrial OS=Coccidioides immitis (strain RS) GN=MRH4 PE=3 SV=1 2 567 5.0E-157
sp|Q5AZY1|MRH4_EMENI ATP-dependent RNA helicase mrh4, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrh4 PE=3 SV=1 8 561 3.0E-154
sp|Q0U397|MRH4_PHANO ATP-dependent RNA helicase MRH4, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MRH4 PE=3 SV=2 8 567 1.0E-148
sp|A6RCJ9|MRH4_AJECN ATP-dependent RNA helicase MRH4, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MRH4 PE=3 SV=1 7 567 1.0E-136
sp|Q2H679|MRH4_CHAGB ATP-dependent RNA helicase MRH4, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MRH4 PE=3 SV=1 1 567 4.0E-117
sp|A7TE77|MRH4_VANPO ATP-dependent RNA helicase MRH4, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MRH4 PE=3 SV=1 84 544 1.0E-54
sp|Q6C3J3|MRH4_YARLI ATP-dependent RNA helicase MRH4, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRH4 PE=3 SV=1 52 550 2.0E-54
sp|A3LT90|MRH4_PICST ATP-dependent RNA helicase MRH4, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MRH4 PE=3 SV=2 156 563 3.0E-54
sp|P53166|MRH4_YEAST ATP-dependent RNA helicase MRH4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRH4 PE=1 SV=1 104 544 4.0E-52
sp|A6ZUB2|MRH4_YEAS7 ATP-dependent RNA helicase MRH4, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=MRH4 PE=3 SV=1 104 544 4.0E-52
sp|A5E5F7|MRH4_LODEL ATP-dependent RNA helicase MRH4, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MRH4 PE=3 SV=1 104 563 7.0E-52
sp|Q6BV94|MRH4_DEBHA ATP-dependent RNA helicase MRH4, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRH4 PE=3 SV=1 104 563 1.0E-51
sp|Q755C5|MRH4_ASHGO ATP-dependent RNA helicase MRH4, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRH4 PE=3 SV=1 105 545 4.0E-51
sp|Q6CWQ5|MRH4_KLULA ATP-dependent RNA helicase MRH4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRH4 PE=3 SV=1 129 545 3.0E-49
sp|A5DR68|MRH4_PICGU ATP-dependent RNA helicase MRH4, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MRH4 PE=3 SV=2 104 553 9.0E-48
sp|Q6FJJ8|MRH4_CANGA ATP-dependent RNA helicase MRH4, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRH4 PE=3 SV=1 105 543 2.0E-46
sp|Q59S59|MRH4_CANAL ATP-dependent RNA helicase MRH4, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRH4 PE=3 SV=1 104 563 4.0E-45
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 71 548 2.0E-37
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 101 550 5.0E-37
sp|Q56X76|RH39_ARATH DEAD-box ATP-dependent RNA helicase 39 OS=Arabidopsis thaliana GN=RH39 PE=2 SV=2 120 566 5.0E-37
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 101 543 6.0E-37
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 101 559 2.0E-36
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 101 550 7.0E-36
sp|Q5VRY0|RH39_ORYSJ DEAD-box ATP-dependent RNA helicase 39 OS=Oryza sativa subsp. japonica GN=Os01g0184500 PE=2 SV=1 103 566 9.0E-36
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 101 550 1.0E-35
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 101 550 1.0E-35
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 118 543 2.0E-35
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 118 543 2.0E-35
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 101 548 6.0E-35
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 131 543 1.0E-34
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 104 543 2.0E-34
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 131 543 2.0E-34
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 104 543 4.0E-34
sp|Q91372|DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis GN=ddx4 PE=2 SV=1 104 543 5.0E-34
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 131 543 5.0E-34
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 101 547 6.0E-34
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 101 543 6.0E-34
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 104 543 7.0E-34
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 104 543 1.0E-33
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 101 559 1.0E-33
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 101 541 2.0E-33
sp|P0CQ74|DED1_CRYNJ ATP-dependent RNA helicase ded1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DED1 PE=3 SV=1 130 559 2.0E-33
sp|P0CQ75|DED1_CRYNB ATP-dependent RNA helicase ded1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DED1 PE=3 SV=1 130 559 2.0E-33
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 104 543 3.0E-33
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 165 543 8.0E-33
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 104 543 1.0E-32
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 165 559 1.0E-32
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 165 550 1.0E-32
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 101 541 1.0E-32
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 165 559 1.0E-32
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 165 559 1.0E-32
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 165 559 1.0E-32
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 165 550 2.0E-32
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 165 559 2.0E-32
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 101 550 3.0E-32
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 165 550 3.0E-32
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 165 559 3.0E-32
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 165 550 4.0E-32
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 101 548 5.0E-32
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 131 556 5.0E-32
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 165 541 5.0E-32
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 165 559 6.0E-32
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 160 556 6.0E-32
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 131 553 7.0E-32
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 101 543 7.0E-32
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 131 543 1.0E-31
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 131 553 2.0E-31
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 131 552 2.0E-31
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 131 558 3.0E-31
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 101 550 3.0E-31
sp|Q9CWT6|DDX28_MOUSE Probable ATP-dependent RNA helicase DDX28 OS=Mus musculus GN=Ddx28 PE=2 SV=2 129 535 3.0E-31
sp|P0CQ76|DBP2_CRYNJ ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP2 PE=3 SV=1 124 538 3.0E-31
sp|P0CQ77|DBP2_CRYNB ATP-dependent RNA helicase DBP2-A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP2 PE=3 SV=1 124 538 3.0E-31
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 101 548 5.0E-31
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 121 550 5.0E-31
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 104 541 5.0E-31
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 131 553 5.0E-31
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 131 552 6.0E-31
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 101 543 8.0E-31
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 101 541 9.0E-31
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 130 552 1.0E-30
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 101 541 1.0E-30
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 131 558 1.0E-30
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 131 558 1.0E-30
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 113 550 2.0E-30
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 101 550 2.0E-30
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 131 552 3.0E-30
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 104 543 3.0E-30
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 131 558 3.0E-30
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 149 559 5.0E-30
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 131 558 5.0E-30
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 131 558 6.0E-30
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 130 559 8.0E-30
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 104 543 9.0E-30
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 101 550 9.0E-30
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 130 559 9.0E-30
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 131 558 2.0E-29
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 104 543 2.0E-29
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 104 543 2.0E-29
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 104 543 2.0E-29
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 104 543 2.0E-29
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 130 552 3.0E-29
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 131 552 4.0E-29
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 104 543 4.0E-29
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 130 552 5.0E-29
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 131 556 6.0E-29
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 131 552 7.0E-29
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 129 550 1.0E-28
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 130 559 1.0E-28
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 130 559 1.0E-28
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 101 543 1.0E-28
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 130 558 2.0E-28
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 131 548 3.0E-28
sp|Q5K5B6|RH57_ORYSJ DEAD-box ATP-dependent RNA helicase 57 OS=Oryza sativa subsp. japonica GN=Os07g0647900 PE=2 SV=2 131 549 3.0E-28
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 126 550 3.0E-28
sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 104 543 4.0E-28
sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 129 559 5.0E-28
sp|Q26696|DDX17_TRYBB Putative DEAD-box RNA helicase HEL64 OS=Trypanosoma brucei brucei GN=HEL64 PE=3 SV=1 108 543 5.0E-28
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 165 540 1.0E-27
sp|Q9NXZ2|DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens GN=DDX43 PE=2 SV=2 131 550 1.0E-27
sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens GN=DDX53 PE=1 SV=3 88 550 1.0E-27
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 105 550 1.0E-27
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 131 559 2.0E-27
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 131 548 3.0E-27
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 131 553 3.0E-27
sp|A3LQW7|DBP2_PICST ATP-dependent RNA helicase DBP2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP2 PE=3 SV=1 165 528 5.0E-27
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 131 559 7.0E-27
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 131 560 8.0E-27
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 131 538 8.0E-27
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 131 560 9.0E-27
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 104 543 1.0E-26
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 108 549 1.0E-26
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 165 552 2.0E-26
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 107 549 2.0E-26
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 131 548 3.0E-26
sp|Q1E9T9|DBP7_COCIM ATP-dependent RNA helicase DBP7 OS=Coccidioides immitis (strain RS) GN=DBP7 PE=3 SV=1 103 548 4.0E-26
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 113 553 4.0E-26
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 131 543 4.0E-26
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 131 557 4.0E-26
sp|Q3EBD3|RH41_ARATH DEAD-box ATP-dependent RNA helicase 41 OS=Arabidopsis thaliana GN=RH41 PE=2 SV=1 131 559 4.0E-26
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 104 543 5.0E-26
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 102 548 5.0E-26
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 131 541 6.0E-26
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 131 565 6.0E-26
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 131 548 6.0E-26
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 118 564 8.0E-26
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 101 550 9.0E-26
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 113 553 1.0E-25
sp|Q4R4T6|DDX28_MACFA Probable ATP-dependent RNA helicase DDX28 OS=Macaca fascicularis GN=DDX28 PE=2 SV=1 129 552 1.0E-25
sp|A5DS77|DBP2_LODEL ATP-dependent RNA helicase DBP2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP2 PE=3 SV=1 149 528 1.0E-25
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 131 562 1.0E-25
sp|Q0E2Z7|RH41_ORYSJ DEAD-box ATP-dependent RNA helicase 41 OS=Oryza sativa subsp. japonica GN=Os02g0201900 PE=2 SV=2 129 549 2.0E-25
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 131 548 2.0E-25
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 130 549 2.0E-25
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 131 567 2.0E-25
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 71 558 3.0E-25
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 105 548 3.0E-25
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 131 549 4.0E-25
sp|Q1DMX8|PRP28_COCIM Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Coccidioides immitis (strain RS) GN=PRP28 PE=3 SV=2 111 562 5.0E-25
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 131 540 5.0E-25
sp|P23394|PRP28_YEAST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP28 PE=1 SV=2 6 556 5.0E-25
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 100 552 8.0E-25
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 131 557 9.0E-25
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 131 557 9.0E-25
sp|A5DDF4|PRP5_PICGU Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP5 PE=3 SV=2 100 564 1.0E-24
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 107 543 1.0E-24
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 97 548 1.0E-24
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 165 548 2.0E-24
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 131 548 2.0E-24
sp|Q5T1V6|DDX59_HUMAN Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens GN=DDX59 PE=1 SV=1 130 550 2.0E-24
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 131 562 2.0E-24
sp|A3LNL1|PRP28_PICST Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP28 PE=3 SV=2 126 563 3.0E-24
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 131 548 3.0E-24
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 131 548 3.0E-24
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 165 533 3.0E-24
sp|Q8GUG7|RH50_ARATH DEAD-box ATP-dependent RNA helicase 50 OS=Arabidopsis thaliana GN=RH50 PE=2 SV=2 109 543 4.0E-24
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 131 549 4.0E-24
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 131 549 4.0E-24
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 123 549 4.0E-24
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 131 540 4.0E-24
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 165 548 5.0E-24
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 131 562 5.0E-24
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 131 562 5.0E-24
sp|Q9DBN9|DDX59_MOUSE Probable ATP-dependent RNA helicase DDX59 OS=Mus musculus GN=Ddx59 PE=1 SV=1 131 550 6.0E-24
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 130 564 6.0E-24
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 131 562 6.0E-24
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 131 543 6.0E-24
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 105 544 7.0E-24
sp|C4K8M8|RHLB_HAMD5 ATP-dependent RNA helicase RhlB OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rhlB PE=3 SV=1 105 544 7.0E-24
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 131 562 8.0E-24
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 131 565 8.0E-24
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 105 548 1.0E-23
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 105 548 1.0E-23
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 105 548 1.0E-23
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 165 552 1.0E-23
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 130 543 1.0E-23
sp|Q0CF43|DBP7_ASPTN ATP-dependent RNA helicase dbp7 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp7 PE=3 SV=2 103 543 2.0E-23
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 131 543 2.0E-23
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 131 543 2.0E-23
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 131 549 2.0E-23
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 122 543 2.0E-23
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 105 544 2.0E-23
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 131 557 2.0E-23
sp|Q59W52|PRP28_CANAL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP28 PE=3 SV=1 131 548 3.0E-23
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 117 548 3.0E-23
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 131 562 3.0E-23
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 105 544 3.0E-23
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 131 557 3.0E-23
sp|A5D7C1|DDX52_BOVIN Probable ATP-dependent RNA helicase DDX52 OS=Bos taurus GN=DDX52 PE=2 SV=1 101 549 3.0E-23
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 130 549 3.0E-23
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 165 549 3.0E-23
sp|P0CQ79|DBP3_CRYNB ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP3 PE=3 SV=1 131 562 4.0E-23
sp|B1JQ11|RHLB_YERPY ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|Q66G19|RHLB_YERPS ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|A4TRC8|RHLB_YERPP ATP-dependent RNA helicase RhlB OS=Yersinia pestis (strain Pestoides F) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|Q1CNK3|RHLB_YERPN ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|Q8ZAD8|RHLB_YERPE ATP-dependent RNA helicase RhlB OS=Yersinia pestis GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|B2K046|RHLB_YERPB ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|Q1CBQ4|RHLB_YERPA ATP-dependent RNA helicase RhlB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|A7FD47|RHLB_YERP3 ATP-dependent RNA helicase RhlB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|P0CQ78|DBP3_CRYNJ ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP3 PE=3 SV=1 131 562 5.0E-23
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 104 544 5.0E-23
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 123 549 5.0E-23
sp|A8G828|RHLB_SERP5 ATP-dependent RNA helicase RhlB OS=Serratia proteamaculans (strain 568) GN=rhlB PE=3 SV=1 105 544 5.0E-23
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 104 544 5.0E-23
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 130 549 5.0E-23
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 104 544 5.0E-23
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 131 564 6.0E-23
sp|A9MJ29|RHLB_SALAR ATP-dependent RNA helicase RhlB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rhlB PE=3 SV=1 105 544 6.0E-23
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 100 541 6.0E-23
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 102 548 6.0E-23
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 111 548 7.0E-23
sp|Q2HEB0|PRP28_CHAGB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP28 PE=3 SV=1 131 558 7.0E-23
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 165 543 8.0E-23
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 105 544 1.0E-22
sp|Q4I7F9|PRP28_GIBZE Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP28 PE=3 SV=1 111 548 1.0E-22
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 131 543 1.0E-22
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 104 544 1.0E-22
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 104 544 1.0E-22
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 104 544 1.0E-22
sp|B1KQF6|RHLB_SHEWM ATP-dependent RNA helicase RhlB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rhlB PE=3 SV=1 105 544 1.0E-22
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 113 559 1.0E-22
sp|A8GZJ0|RHLB_SHEPA ATP-dependent RNA helicase RhlB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rhlB PE=3 SV=1 132 544 1.0E-22
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 130 549 1.0E-22
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 113 560 1.0E-22
sp|Q99PT0|DDX52_RAT Probable ATP-dependent RNA helicase DDX52 OS=Rattus norvegicus GN=Ddx52 PE=2 SV=1 101 549 1.0E-22
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 131 543 1.0E-22
sp|B0TJ29|RHLB_SHEHH ATP-dependent RNA helicase RhlB OS=Shewanella halifaxensis (strain HAW-EB4) GN=rhlB PE=3 SV=1 132 544 1.0E-22
sp|Q6CDN5|DBP6_YARLI ATP-dependent RNA helicase DBP6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP6 PE=3 SV=1 104 566 1.0E-22
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 105 544 2.0E-22
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 219 548 2.0E-22
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 131 543 2.0E-22
sp|Q8K301|DDX52_MOUSE Probable ATP-dependent RNA helicase DDX52 OS=Mus musculus GN=Ddx52 PE=2 SV=2 101 549 2.0E-22
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 123 549 2.0E-22
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 131 543 2.0E-22
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 130 543 2.0E-22
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 130 543 2.0E-22
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 104 548 2.0E-22
sp|P0A2P0|RHLB_SALTY ATP-dependent RNA helicase RhlB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhlB PE=3 SV=2 105 544 2.0E-22
sp|P0A2P1|RHLB_SALTI ATP-dependent RNA helicase RhlB OS=Salmonella typhi GN=rhlB PE=3 SV=2 105 544 2.0E-22
sp|B4TNT3|RHLB_SALSV ATP-dependent RNA helicase RhlB OS=Salmonella schwarzengrund (strain CVM19633) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|C0Q2V9|RHLB_SALPC ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi C (strain RKS4594) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|A9MXF3|RHLB_SALPB ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|B4SZ26|RHLB_SALNS ATP-dependent RNA helicase RhlB OS=Salmonella newport (strain SL254) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|B4TB13|RHLB_SALHS ATP-dependent RNA helicase RhlB OS=Salmonella heidelberg (strain SL476) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|B5RFS3|RHLB_SALG2 ATP-dependent RNA helicase RhlB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|B5QVH2|RHLB_SALEP ATP-dependent RNA helicase RhlB OS=Salmonella enteritidis PT4 (strain P125109) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|Q57HT6|RHLB_SALCH ATP-dependent RNA helicase RhlB OS=Salmonella choleraesuis (strain SC-B67) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|B5EZ40|RHLB_SALA4 ATP-dependent RNA helicase RhlB OS=Salmonella agona (strain SL483) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|A8ACT3|RHLB_CITK8 ATP-dependent RNA helicase RhlB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 131 543 2.0E-22
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 131 563 2.0E-22
sp|B5FN74|RHLB_SALDC ATP-dependent RNA helicase RhlB OS=Salmonella dublin (strain CT_02021853) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|B5BIS9|RHLB_SALPK ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi A (strain AKU_12601) GN=rhlB PE=3 SV=1 105 544 2.0E-22
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 228 548 3.0E-22
sp|Q6CCZ1|PRP5_YARLI Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP5 PE=3 SV=1 101 560 3.0E-22
sp|Q4WV71|DBP7_ASPFU ATP-dependent RNA helicase dbp7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp7 PE=3 SV=1 103 543 3.0E-22
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 131 558 4.0E-22
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 122 543 4.0E-22
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 165 552 4.0E-22
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 104 548 4.0E-22
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 165 548 4.0E-22
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 105 544 5.0E-22
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 131 543 6.0E-22
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 130 543 6.0E-22
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 100 548 7.0E-22
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 105 544 7.0E-22
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 105 544 7.0E-22
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 102 548 7.0E-22
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 131 543 7.0E-22
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 118 543 7.0E-22
sp|Q6CT46|DBP3_KLULA ATP-dependent RNA helicase DBP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP3 PE=3 SV=1 131 543 7.0E-22
sp|Q86IZ9|DDX52_DICDI Probable ATP-dependent RNA helicase ddx52 OS=Dictyostelium discoideum GN=ddx52 PE=3 SV=1 131 548 8.0E-22
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 131 543 9.0E-22
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 105 544 9.0E-22
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 131 549 9.0E-22
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 104 550 9.0E-22
sp|Q9Y2R4|DDX52_HUMAN Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens GN=DDX52 PE=1 SV=3 101 549 1.0E-21
sp|P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP5 PE=1 SV=2 104 558 1.0E-21
sp|A6ZNQ1|DBP5_YEAS7 ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP5 PE=3 SV=1 104 558 1.0E-21
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 130 543 1.0E-21
sp|A5DIX5|ROK1_PICGU ATP-dependent RNA helicase ROK1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ROK1 PE=3 SV=2 100 549 1.0E-21
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 131 543 1.0E-21
sp|A1SAL1|RHLB_SHEAM ATP-dependent RNA helicase RhlB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rhlB PE=3 SV=1 132 544 1.0E-21
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 105 544 1.0E-21
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 129 543 1.0E-21
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 129 543 1.0E-21
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 122 550 1.0E-21
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 131 543 1.0E-21
sp|B7VME9|RHLB_VIBTL ATP-dependent RNA helicase RhlB OS=Vibrio tasmaniensis (strain LGP32) GN=rhlB PE=3 SV=1 105 544 1.0E-21
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 131 548 1.0E-21
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 102 548 1.0E-21
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 132 543 2.0E-21
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 131 543 2.0E-21
sp|B2VG58|RHLB_ERWT9 ATP-dependent RNA helicase RhlB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rhlB PE=3 SV=1 105 544 2.0E-21
sp|Q8XAT4|RHLB_ECO57 ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 GN=rhlB PE=3 SV=3 105 544 2.0E-21
sp|O01836|GLH3_CAEEL ATP-dependent RNA helicase glh-3 OS=Caenorhabditis elegans GN=glh-3 PE=1 SV=1 101 548 2.0E-21
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 131 548 2.0E-21
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 132 544 2.0E-21
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 131 548 2.0E-21
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 100 552 2.0E-21
sp|B7LU75|RHLB_ESCF3 ATP-dependent RNA helicase RhlB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhlB PE=3 SV=1 105 544 2.0E-21
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 104 548 2.0E-21
sp|Q7SEL0|PRP28_NEUCR Pre-mRNA-splicing ATP-dependent RNA helicase prp-28 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-28 PE=3 SV=1 131 558 2.0E-21
sp|B5YY28|RHLB_ECO5E ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhlB PE=3 SV=1 105 544 2.0E-21
sp|B7NTG2|RHLB_ECO7I ATP-dependent RNA helicase RhlB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhlB PE=3 SV=1 105 544 2.0E-21
sp|B5XYY9|RHLB_KLEP3 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae (strain 342) GN=rhlB PE=3 SV=1 105 544 2.0E-21
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 102 548 2.0E-21
sp|Q3YVI4|RHLB_SHISS ATP-dependent RNA helicase RhlB OS=Shigella sonnei (strain Ss046) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|P0A8K0|RHLB_SHIFL ATP-dependent RNA helicase RhlB OS=Shigella flexneri GN=rhlB PE=3 SV=2 105 544 3.0E-21
sp|Q1R4F9|RHLB_ECOUT ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain UTI89 / UPEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B6I4B6|RHLB_ECOSE ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SE11) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|P0A8J8|RHLB_ECOLI ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12) GN=rhlB PE=1 SV=2 105 544 3.0E-21
sp|B1IWC0|RHLB_ECOLC ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|P0A8J9|RHLB_ECOL6 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhlB PE=3 SV=2 105 544 3.0E-21
sp|Q0TAU3|RHLB_ECOL5 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|A1AHV0|RHLB_ECOK1 ATP-dependent RNA helicase RhlB OS=Escherichia coli O1:K1 / APEC GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|A8A6N4|RHLB_ECOHS ATP-dependent RNA helicase RhlB OS=Escherichia coli O9:H4 (strain HS) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B1X9Z4|RHLB_ECODH ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / DH10B) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|C4ZZ48|RHLB_ECOBW ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B7M5C7|RHLB_ECO8A ATP-dependent RNA helicase RhlB OS=Escherichia coli O8 (strain IAI1) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B7MR01|RHLB_ECO81 ATP-dependent RNA helicase RhlB OS=Escherichia coli O81 (strain ED1a) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B7L8B6|RHLB_ECO55 ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain 55989 / EAEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B7MGJ1|RHLB_ECO45 ATP-dependent RNA helicase RhlB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B7UMN5|RHLB_ECO27 ATP-dependent RNA helicase RhlB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|A7ZTY2|RHLB_ECO24 ATP-dependent RNA helicase RhlB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 107 548 3.0E-21
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 113 541 3.0E-21
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 165 548 3.0E-21
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 165 548 3.0E-21
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 131 548 3.0E-21
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 101 543 3.0E-21
sp|B7NF85|RHLB_ECOLU ATP-dependent RNA helicase RhlB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B1LLV3|RHLB_ECOSM ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 131 548 3.0E-21
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 132 544 3.0E-21
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 105 543 3.0E-21
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 105 544 3.0E-21
sp|B8CHZ1|RHLB_SHEPW ATP-dependent RNA helicase RhlB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rhlB PE=3 SV=1 132 544 4.0E-21
sp|Q9NUL7|DDX28_HUMAN Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens GN=DDX28 PE=1 SV=2 129 552 5.0E-21
sp|A7EGG4|PRP28_SCLS1 Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp28 PE=3 SV=1 131 562 5.0E-21
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 131 543 5.0E-21
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 165 549 5.0E-21
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 131 548 5.0E-21
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 131 537 6.0E-21
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 104 548 6.0E-21
sp|A6TGG9|RHLB_KLEP7 ATP-dependent RNA helicase RhlB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rhlB PE=3 SV=1 105 544 6.0E-21
sp|Q7MGP7|RHLB_VIBVY ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain YJ016) GN=rhlB PE=3 SV=1 132 544 6.0E-21
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 131 543 6.0E-21
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 131 567 7.0E-21
sp|A7MQI2|RHLB_CROS8 ATP-dependent RNA helicase RhlB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhlB PE=3 SV=1 105 544 7.0E-21
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 105 540 7.0E-21
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 105 544 8.0E-21
sp|Q31UK5|RHLB_SHIBS ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 4 (strain Sb227) GN=rhlB PE=3 SV=1 132 544 8.0E-21
sp|B2TU12|RHLB_SHIB3 ATP-dependent RNA helicase RhlB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rhlB PE=3 SV=1 132 544 8.0E-21
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 104 549 8.0E-21
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 131 557 9.0E-21
sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 129 557 9.0E-21
sp|A5DZX2|DBP5_LODEL ATP-dependent RNA helicase DBP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP5 PE=3 SV=1 104 546 1.0E-20
sp|Q5ANB2|DBP10_CANAL ATP-dependent RNA helicase DBP10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP10 PE=3 SV=1 131 548 1.0E-20
sp|Q8X0X2|DBP5_NEUCR ATP-dependent RNA helicase dbp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-5 PE=3 SV=1 104 567 1.0E-20
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 131 567 1.0E-20
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 92 552 1.0E-20
sp|Q8GXD6|RH49_ARATH DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2 97 543 1.0E-20
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 131 559 1.0E-20
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 131 559 1.0E-20
sp|Q8DDN6|RHLB_VIBVU ATP-dependent RNA helicase RhlB OS=Vibrio vulnificus (strain CMCP6) GN=rhlB PE=3 SV=1 132 544 1.0E-20
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 101 548 1.0E-20
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 131 552 1.0E-20
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 131 543 1.0E-20
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 104 549 1.0E-20
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 104 550 1.0E-20
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 131 543 2.0E-20
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 131 552 2.0E-20
sp|A6RJA2|PRP28_BOTFB Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Botryotinia fuckeliana (strain B05.10) GN=prp28 PE=3 SV=1 131 562 2.0E-20
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 131 561 2.0E-20
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 131 548 2.0E-20
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 131 548 2.0E-20
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 105 544 2.0E-20
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 105 544 2.0E-20
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 105 544 2.0E-20
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 125 567 2.0E-20
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 104 543 2.0E-20
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 131 549 2.0E-20
sp|A0KEG9|RHLB_AERHH ATP-dependent RNA helicase RhlB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rhlB PE=3 SV=1 100 544 2.0E-20
sp|Q9CAI7|IF4A3_ARATH Eukaryotic initiation factor 4A-3 OS=Arabidopsis thaliana GN=TIF4A-3 PE=1 SV=1 224 557 3.0E-20
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 111 543 3.0E-20
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 132 544 3.0E-20
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 131 543 3.0E-20
sp|A7MXT4|RHLB_VIBCB ATP-dependent RNA helicase RhlB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rhlB PE=3 SV=1 132 544 3.0E-20
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 131 543 3.0E-20
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 104 552 3.0E-20
sp|Q4P7Z8|DBP5_USTMA ATP-dependent RNA helicase DBP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP5 PE=3 SV=1 131 541 3.0E-20
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 119 548 3.0E-20
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 131 543 3.0E-20
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 101 543 3.0E-20
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 118 543 4.0E-20
sp|A4WG30|RHLB_ENT38 ATP-dependent RNA helicase RhlB OS=Enterobacter sp. (strain 638) GN=rhlB PE=3 SV=1 132 544 4.0E-20
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 123 565 5.0E-20
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 130 543 5.0E-20
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 130 543 5.0E-20
sp|A4RIF1|DBP5_MAGO7 ATP-dependent RNA helicase DBP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP5 PE=3 SV=2 113 554 5.0E-20
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 165 549 5.0E-20
sp|Q9C8J1|RH34_ARATH DEAD-box ATP-dependent RNA helicase 34 OS=Arabidopsis thaliana GN=RH34 PE=2 SV=2 227 552 5.0E-20
sp|Q2NQB2|RHLB_SODGM ATP-dependent RNA helicase RhlB OS=Sodalis glossinidius (strain morsitans) GN=rhlB PE=3 SV=1 105 544 6.0E-20
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 131 552 6.0E-20
sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 131 548 6.0E-20
sp|Q6FKN8|DBP5_CANGA ATP-dependent RNA helicase DBP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP5 PE=3 SV=1 1 541 6.0E-20
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 165 543 6.0E-20
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 105 544 6.0E-20
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 131 548 6.0E-20
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 129 550 7.0E-20
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 104 552 8.0E-20
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 113 544 8.0E-20
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 131 548 8.0E-20
sp|Q9FZ92|RH44_ARATH Putative DEAD-box ATP-dependent RNA helicase 44 OS=Arabidopsis thaliana GN=RH44 PE=5 SV=2 167 567 9.0E-20
sp|A5DU73|PRP28_LODEL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP28 PE=3 SV=1 131 548 9.0E-20
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 119 548 9.0E-20
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 103 552 9.0E-20
sp|Q0DLB9|RH17_ORYSJ DEAD-box ATP-dependent RNA helicase 17 OS=Oryza sativa subsp. japonica GN=Os05g0110500 PE=2 SV=2 104 543 9.0E-20
sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 129 557 9.0E-20
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 117 548 9.0E-20
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 117 548 1.0E-19
sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 104 543 1.0E-19
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 104 563 1.0E-19
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 130 541 1.0E-19
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 113 550 1.0E-19
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 113 550 1.0E-19
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 113 550 1.0E-19
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 113 550 1.0E-19
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 129 543 1.0E-19
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 129 550 1.0E-19
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 129 544 2.0E-19
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 165 552 2.0E-19
sp|A1SZG4|RHLB_PSYIN ATP-dependent RNA helicase RhlB OS=Psychromonas ingrahamii (strain 37) GN=rhlB PE=3 SV=1 132 544 2.0E-19
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 165 543 2.0E-19
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 129 544 2.0E-19
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 131 557 2.0E-19
sp|Q81E85|CSHC_BACCR DEAD-box ATP-dependent RNA helicase CshC OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshC PE=2 SV=1 109 563 2.0E-19
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 131 543 2.0E-19
sp|P0CR06|DBP10_CRYNJ ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP10 PE=3 SV=1 130 548 2.0E-19
sp|P0CR07|DBP10_CRYNB ATP-dependent RNA helicase DBP10 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP10 PE=3 SV=1 130 548 2.0E-19
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 122 566 2.0E-19
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 165 543 2.0E-19
sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A OS=Zea mays PE=2 SV=1 225 557 2.0E-19
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 113 543 2.0E-19
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 131 552 2.0E-19
sp|Q6CDS6|ROK1_YARLI ATP-dependent RNA helicase ROK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROK1 PE=3 SV=1 100 548 3.0E-19
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 131 548 3.0E-19
sp|Q15N18|RHLB_PSEA6 ATP-dependent RNA helicase RhlB OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rhlB PE=3 SV=1 132 544 3.0E-19
sp|Q818H2|CSHB_BACCR DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshB PE=2 SV=1 104 543 3.0E-19
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 131 543 3.0E-19
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 121 552 3.0E-19
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 125 560 3.0E-19
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 94 552 3.0E-19
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 132 544 4.0E-19
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 116 548 4.0E-19
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 131 549 4.0E-19
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 131 567 4.0E-19
sp|P41382|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1 224 558 4.0E-19
sp|P41376|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1 224 550 5.0E-19
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 113 548 5.0E-19
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 111 548 5.0E-19
sp|Q6NZQ2|DDX31_MOUSE Probable ATP-dependent RNA helicase DDX31 OS=Mus musculus GN=Ddx31 PE=2 SV=2 95 552 5.0E-19
sp|Q40467|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1 224 550 5.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0016787 hydrolase activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2069
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5955
Ophiocordyceps australis map64 (Brazil) OphauB2|7936 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06489
Ophiocordyceps camponoti-rufipedis Ophun1|6388
Ophiocordyceps kimflemingae Ophio5|2975
Ophiocordyceps subramaniannii Hirsu2|2390

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7936
MSRQAKQRKPSRMVLADHVHRFPLSRRPAGHQQDDHPSGINRTTVNVDKLRRPRPRANAPDAEGKEKQRRVAGQR
KVLKMHQVLAEVSGGSRALARTQALPYDSFDQFDLLPALKTAVLDEVFAGLTDITPTPVQRLAIPALLDQPGPGQ
PKKRNQELQTFLLAAETGSGKTLAYLLPVVDAIKEIEAADDRIKAYNQRRQIEEERQRASSHKKMKPFDEPHPTM
TRPKAIVLVPTSELCEQVQKVAKSLSHVSRFKTRVLSSDLSPKQIHRSVFDPMGVDLIVSTPHLLSSIAESEPNI
LAQVGYLVIDEADSLMDLSFLPVTLKIVERSMPSLKQLICCSATIPRKLNHFLATNFPKMQRITTPNLHAIPRRV
QLGVIDVSKEPYRNNKNLACAQAIYSICRSSSEKQATVHEGDIDVRRILVFVNERKKTEEVAEFLRSKGIDAQPL
HRDSEENRHENVLDAFTTSNPLRIPAQQGHKSSGPFSLANAKVLVVTDIASRGIDTLAVRHVILYDVPHTSIDFI
HRIGRAGRMGRRGRAVVLAGNSDRKDVIADVRESMFRGQALI*
Coding >OphauB2|7936
ATGTCGCGCCAGGCCAAGCAACGGAAGCCATCGCGCATGGTGCTAGCAGATCACGTCCATCGCTTTCCGCTGTCT
CGTCGGCCCGCCGGACACCAACAAGATGACCATCCTAGTGGCATCAACAGGACAACGGTCAATGTCGACAAGCTC
CGTCGGCCTCGTCCCAGGGCCAACGCTCCAGATGCCGAGGGTAAAGAGAAACAACGGCGGGTCGCAGGCCAAAGA
AAAGTGCTCAAGATGCACCAAGTCCTGGCCGAGGTTTCTGGCGGCAGCCGCGCCTTGGCCAGGACGCAGGCGCTG
CCCTACGACTCTTTTGATCAGTTTGATCTGCTGCCCGCCCTCAAGACTGCTGTCCTGGACGAGGTCTTTGCCGGA
TTAACAGACATTACCCCGACGCCTGTCCAGCGGCTCGCTATCCCTGCCCTTCTCGACCAGCCAGGGCCCGGGCAA
CCGAAGAAACGAAACCAAGAGTTGCAGACTTTCTTGCTTGCAGCAGAGACGGGCTCCGGCAAGACGCTGGCATAT
CTCTTGCCCGTTGTTGATGCAATCAAGGAAATTGAGGCCGCCGATGATCGCATCAAGGCCTACAATCAACGCCGC
CAAATCGAAGAGGAACGGCAACGTGCCTCTTCACACAAGAAAATGAAGCCTTTTGACGAGCCTCACCCAACCATG
ACGCGTCCCAAAGCTATTGTCCTTGTTCCTACCTCGGAGCTGTGTGAACAGGTTCAGAAAGTCGCCAAGTCGCTA
TCGCATGTGTCACGTTTTAAAACTCGTGTGCTCTCATCGGATCTGTCCCCCAAGCAGATACATCGCAGCGTCTTT
GATCCTATGGGGGTTGATCTAATCGTTTCTACGCCTCATCTACTCTCCTCGATTGCAGAGTCAGAGCCCAATATA
CTCGCCCAGGTCGGCTACCTCGTGATCGATGAGGCCGACTCGCTCATGGACCTGAGTTTTCTCCCAGTCACCTTG
AAGATTGTTGAGCGCAGCATGCCCTCCCTCAAGCAGTTGATCTGTTGCTCCGCTACTATTCCGCGGAAACTCAAC
CACTTTCTCGCCACCAATTTCCCCAAAATGCAGCGCATCACCACACCTAATCTGCACGCCATTCCTCGGCGCGTG
CAACTTGGAGTCATTGATGTCTCCAAGGAGCCATACCGCAACAACAAGAACCTTGCCTGTGCTCAGGCAATCTAC
AGCATCTGTCGCAGCTCATCCGAGAAACAAGCAACGGTGCACGAAGGCGACATTGATGTCCGTCGGATCCTCGTG
TTTGTGAATGAGCGCAAGAAAACAGAAGAGGTTGCCGAGTTTCTTCGCTCCAAGGGAATCGATGCTCAGCCACTT
CACAGAGATAGTGAGGAGAATCGACACGAGAATGTACTCGATGCCTTCACGACATCCAACCCTTTGAGAATCCCA
GCTCAGCAGGGTCACAAGAGCTCAGGGCCTTTTTCCTTGGCAAATGCAAAAGTTCTCGTTGTGACCGATATTGCA
TCCCGGGGCATCGATACGCTGGCTGTACGGCACGTCATCTTGTACGATGTGCCTCACACTTCGATTGACTTTATT
CATCGCATCGGCCGGGCTGGTCGTATGGGGCGTCGTGGGCGGGCCGTCGTGTTGGCCGGCAACAGTGACCGAAAA
GACGTCATTGCCGATGTTAGAGAAAGCATGTTTAGGGGCCAGGCACTTATTTAG
Transcript >OphauB2|7936
ATGTCGCGCCAGGCCAAGCAACGGAAGCCATCGCGCATGGTGCTAGCAGATCACGTCCATCGCTTTCCGCTGTCT
CGTCGGCCCGCCGGACACCAACAAGATGACCATCCTAGTGGCATCAACAGGACAACGGTCAATGTCGACAAGCTC
CGTCGGCCTCGTCCCAGGGCCAACGCTCCAGATGCCGAGGGTAAAGAGAAACAACGGCGGGTCGCAGGCCAAAGA
AAAGTGCTCAAGATGCACCAAGTCCTGGCCGAGGTTTCTGGCGGCAGCCGCGCCTTGGCCAGGACGCAGGCGCTG
CCCTACGACTCTTTTGATCAGTTTGATCTGCTGCCCGCCCTCAAGACTGCTGTCCTGGACGAGGTCTTTGCCGGA
TTAACAGACATTACCCCGACGCCTGTCCAGCGGCTCGCTATCCCTGCCCTTCTCGACCAGCCAGGGCCCGGGCAA
CCGAAGAAACGAAACCAAGAGTTGCAGACTTTCTTGCTTGCAGCAGAGACGGGCTCCGGCAAGACGCTGGCATAT
CTCTTGCCCGTTGTTGATGCAATCAAGGAAATTGAGGCCGCCGATGATCGCATCAAGGCCTACAATCAACGCCGC
CAAATCGAAGAGGAACGGCAACGTGCCTCTTCACACAAGAAAATGAAGCCTTTTGACGAGCCTCACCCAACCATG
ACGCGTCCCAAAGCTATTGTCCTTGTTCCTACCTCGGAGCTGTGTGAACAGGTTCAGAAAGTCGCCAAGTCGCTA
TCGCATGTGTCACGTTTTAAAACTCGTGTGCTCTCATCGGATCTGTCCCCCAAGCAGATACATCGCAGCGTCTTT
GATCCTATGGGGGTTGATCTAATCGTTTCTACGCCTCATCTACTCTCCTCGATTGCAGAGTCAGAGCCCAATATA
CTCGCCCAGGTCGGCTACCTCGTGATCGATGAGGCCGACTCGCTCATGGACCTGAGTTTTCTCCCAGTCACCTTG
AAGATTGTTGAGCGCAGCATGCCCTCCCTCAAGCAGTTGATCTGTTGCTCCGCTACTATTCCGCGGAAACTCAAC
CACTTTCTCGCCACCAATTTCCCCAAAATGCAGCGCATCACCACACCTAATCTGCACGCCATTCCTCGGCGCGTG
CAACTTGGAGTCATTGATGTCTCCAAGGAGCCATACCGCAACAACAAGAACCTTGCCTGTGCTCAGGCAATCTAC
AGCATCTGTCGCAGCTCATCCGAGAAACAAGCAACGGTGCACGAAGGCGACATTGATGTCCGTCGGATCCTCGTG
TTTGTGAATGAGCGCAAGAAAACAGAAGAGGTTGCCGAGTTTCTTCGCTCCAAGGGAATCGATGCTCAGCCACTT
CACAGAGATAGTGAGGAGAATCGACACGAGAATGTACTCGATGCCTTCACGACATCCAACCCTTTGAGAATCCCA
GCTCAGCAGGGTCACAAGAGCTCAGGGCCTTTTTCCTTGGCAAATGCAAAAGTTCTCGTTGTGACCGATATTGCA
TCCCGGGGCATCGATACGCTGGCTGTACGGCACGTCATCTTGTACGATGTGCCTCACACTTCGATTGACTTTATT
CATCGCATCGGCCGGGCTGGTCGTATGGGGCGTCGTGGGCGGGCCGTCGTGTTGGCCGGCAACAGTGACCGAAAA
GACGTCATTGCCGATGTTAGAGAAAGCATGTTTAGGGGCCAGGCACTTATTTAG
Gene >OphauB2|7936
ATGTCGCGCCAGGCCAAGCAACGGAAGCCATCGCGCATGGTGCTAGCAGATCACGTCCATCGCTTTCCGCTGTCT
CGTCGGCCCGCCGGACACCAACAAGATGACCATCCTAGTGGCATCAACAGGACAACGGTCAATGTCGACAAGCTC
CGTCGGCCTCGTCCCAGGGCCAACGCTCCAGATGCCGAGGGTAAAGAGAAACAACGGCGGGTCGCAGGCCAAAGA
AAAGTGCTCAAGATGCACCAAGTCCTGGCCGAGGTTTCTGGCGGCAGCCGCGCCTTGGCCAGGACGCAGGCGCTG
CCCTACGACTCTTTTGATCAGTTTGATCTGCTGCCCGCCCTCAAGACTGCTGTCCTGGACGAGGTCTTTGCCGGA
TTAACAGACATTACCCCGACGCCTGTCCAGCGGCTCGCTATCCCTGCCCTTCTCGACCAGCCAGGGCCCGGGCAA
CCGAAGAAACGAAACCAAGAGTTGCAGACTTTCTTGCTTGCAGCAGAGACGGGCTCCGGCAAGACGCTGGCATAT
CTCTTGCCCGTTGTTGATGCAATCAAGGAAATTGAGGCCGCCGATGATCGCATCAAGGCCTACAATCAACGCCGC
CAAATCGAAGAGGAACGGCAACGTGCCTCTTCACACAAGAAAATGAAGCCTTTTGACGAGCCTCACCCAACCATG
ACGCGTCCCAAAGCTATTGTCCTTGTTCCTACCTCGGAGCTGTGTGAACAGGTTCAGAAAGTCGCCAAGTCGCTA
TCGCATGTGTCACGTTTTAAAACTCGTGTGCTCTCATCGGATCTGTCCCCCAAGCAGATACATCGCAGCGTCTTT
GATCCTATGGGGGTTGATCTAATCGTTTCTACGCCTCATCTACTCTCCTCGATTGCAGAGTCAGAGCCCAATATA
CTCGCCCAGGTCGGCTACCTCGTGATCGATGAGGCCGACTCGCTCATGGACCTGAGTTTTCTCCCAGTCACCTTG
AAGATTGTTGAGCGCAGCATGCCCTCCCTCAAGCAGTTGATCTGTTGCTCCGCTACTATTCCGCGGAAACTCAAC
CACTTTCTCGCCACCAATTTCCCCAAAATGCAGCGCATCACCACACCTAATCTGCACGCCATTCCTCGGCGCGTG
CAACTTGGAGTCATTGATGTCTCCAAGGAGCCATACCGCAACAACAAGAACCTTGCCTGTGCTCAGGCAATCTAC
AGCATCTGTCGCAGCTCATCCGAGAAACAAGCAACGGTGCACGAAGGCGACATTGATGTCCGTCGGATCCTCGTG
TTTGTGAATGAGCGCAAGAAAACAGAAGAGGTTGCCGAGTTTCTTCGCTCCAAGGGAATCGATGCTCAGCCACTT
CACAGAGATAGTGAGGAGAATCGACACGAGAATGTACTCGATGCCTTCACGACATCCAACCCTTTGAGAATCCCA
GCTCAGCAGGGTCACAAGAGCTCAGGGCCTTTTTCCTTGGCAAATGCAAAAGTTCTCGTTGTGACCGATATTGCA
TCCCGGGGCATCGATACGCTGGCTGTACGGCACGTCATCTTGTACGATGTGCCTCACACTTCGATTGACTTTATT
CATCGCATCGGCCGGGCTGGTCGTATGGGGCGTCGTGGGCGGGCCGTCGTGTTGGCCGGCAACAGTGACCGAAAA
GACGTCATTGCCGATGTTAGAGAAAGCATGTTTAGGGGCCAGGCACTTATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail