Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7929
Gene name
LocationContig_90:37719..38812
Strand+
Gene length (bp)1093
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 7.6E-20 6 218

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12415|TFC7_YEAST Transcription factor tau 55 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFC7 PE=1 SV=1 1 263 1.0E-30
sp|P53929|YNK8_YEAST Uncharacterized protein YNL108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL108C PE=1 SV=1 1 261 6.0E-27
sp|Q9VCE9|UBS3A_DROME Protein UBASH3A homolog OS=Drosophila melanogaster GN=CG13604 PE=2 SV=1 5 199 9.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2066
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7507
Ophiocordyceps australis map64 (Brazil) OphauB2|7929 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06492
Ophiocordyceps camponoti-rufipedis Ophun1|7607
Ophiocordyceps kimflemingae Ophio5|2970
Ophiocordyceps subramaniannii Hirsu2|2384

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7929
MSLEKIYIIRHGFRSNWTVDPATGIYSAYIPSPTGIPADPALTAHGVAQAKELARHLMTLDPPIEAVYSSPFYRC
VETLAPFMRLHQEQYPHQEIKIVPEDGIREWFGSAPFHHPQPATADLLKSLFPAIDDSLVSVVVPSSRGETLAQL
QHRIAVALRGIIARCDADGRRALLVCTHAAVVIMLGRILTGQVPASPDEEDFKAFTCGLSVYSRGDCRGSPSAYL
NGTCASSETDRNIIGGWTCDLNSDCSFLSGGEERGWKMSADESFPGTSSLSQGDAKSKF*
Coding >OphauB2|7929
ATGTCGCTGGAAAAAATATACATTATACGCCATGGGTTCCGCTCCAACTGGACCGTCGATCCTGCTACGGGGATT
TACTCTGCATACATACCTTCTCCGACAGGCATCCCCGCGGATCCGGCCCTGACAGCGCACGGCGTTGCACAGGCC
AAAGAGCTGGCTCGACACCTCATGACGCTCGACCCGCCCATCGAGGCTGTCTACTCGAGCCCATTCTATCGGTGC
GTTGAGACTTTGGCGCCGTTTATGCGGCTCCATCAAGAACAATACCCGCACCAGGAAATCAAGATTGTCCCCGAA
GATGGAATCCGCGAATGGTTCGGATCCGCTCCTTTCCATCACCCCCAGCCAGCCACAGCGGATCTCCTCAAGAGT
CTCTTCCCTGCAATAGACGATTCGCTAGTGTCTGTGGTGGTGCCATCGAGCAGGGGTGAGACGTTGGCCCAGCTG
CAGCATCGCATCGCTGTTGCGCTCAGGGGCATCATTGCGCGCTGTGATGCCGACGGAAGACGCGCCCTTCTTGTC
TGCACTCATGCAGCCGTCGTTATCATGTTAGGCCGCATTCTCACAGGTCAGGTGCCAGCAAGCCCTGATGAGGAA
GACTTTAAAGCCTTCACCTGTGGTCTGAGCGTCTATAGCCGCGGTGATTGCAGGGGCTCTCCATCGGCATACCTA
AATGGCACCTGTGCTAGCAGCGAAACGGACAGGAATATCATAGGAGGCTGGACCTGTGATCTCAATAGCGACTGC
AGCTTCTTAAGCGGTGGTGAAGAGAGAGGCTGGAAAATGTCGGCCGACGAGTCGTTTCCAGGCACCTCATCCTTG
TCACAAGGCGATGCTAAGTCCAAGTTTTAG
Transcript >OphauB2|7929
ATGTCGCTGGAAAAAATATACATTATACGCCATGGGTTCCGCTCCAACTGGACCGTCGATCCTGCTACGGGGATT
TACTCTGCATACATACCTTCTCCGACAGGCATCCCCGCGGATCCGGCCCTGACAGCGCACGGCGTTGCACAGGCC
AAAGAGCTGGCTCGACACCTCATGACGCTCGACCCGCCCATCGAGGCTGTCTACTCGAGCCCATTCTATCGGTGC
GTTGAGACTTTGGCGCCGTTTATGCGGCTCCATCAAGAACAATACCCGCACCAGGAAATCAAGATTGTCCCCGAA
GATGGAATCCGCGAATGGTTCGGATCCGCTCCTTTCCATCACCCCCAGCCAGCCACAGCGGATCTCCTCAAGAGT
CTCTTCCCTGCAATAGACGATTCGCTAGTGTCTGTGGTGGTGCCATCGAGCAGGGGTGAGACGTTGGCCCAGCTG
CAGCATCGCATCGCTGTTGCGCTCAGGGGCATCATTGCGCGCTGTGATGCCGACGGAAGACGCGCCCTTCTTGTC
TGCACTCATGCAGCCGTCGTTATCATGTTAGGCCGCATTCTCACAGGTCAGGTGCCAGCAAGCCCTGATGAGGAA
GACTTTAAAGCCTTCACCTGTGGTCTGAGCGTCTATAGCCGCGGTGATTGCAGGGGCTCTCCATCGGCATACCTA
AATGGCACCTGTGCTAGCAGCGAAACGGACAGGAATATCATAGGAGGCTGGACCTGTGATCTCAATAGCGACTGC
AGCTTCTTAAGCGGTGGTGAAGAGAGAGGCTGGAAAATGTCGGCCGACGAGTCGTTTCCAGGCACCTCATCCTTG
TCACAAGGCGATGCTAAGTCCAAGTTTTAG
Gene >OphauB2|7929
ATGTCGCTGGAAAAAATATACATTATACGCCATGGGGTAAGGGTGGCCCTTGACCACAGTTCATTGTGTAGGTAT
TAATAGTTTTTGATGGCGGATGCAGTTCCGCTCCAACTGGACCGTCGATCCTGCTACGGGGATTTACTCTGCATA
CATACCTTCTCCGACAGGCATCCCCGCGGATCCGGCCCTGACAGCGCACGGCGTTGCACAGGCCAAAGAGCTGGC
TCGACACCTCATGACGCTCGACCCGCCCATCGAGGCTGTCTACTCGAGCCCATTCTATCGGTGCGTTGAGACTTT
GGCGCCGTTTATGCGGCTCCATCAAGAACAATACCCGCACCAGGAAATCAAGATTGTCCCCGAAGATGGAATCCG
CGAATGGTTCGGATCCGCTCCTTTCCATCACCCCCAGCCAGCCACAGCGGATCTCCTCAAGAGTCTCTTCCCTGC
AATAGACGATTCGCTAGTGTCTGTGGTGGTGCCATCGAGCAGGGGTGAGACGTTGGCCCAGCTGCAGCATCGCAT
CGCTGTTGCGCTCAGGGGCATCATTGCGCGCTGTGATGCCGACGGAAGACGCGCCCTTCTTGTCTGCACTCATGC
AGCCGTCGTTATCATGTTAGGCCGCATTCTCACAGGTCAGGTGCCAGCAAGCCCTGATGAGGAAGACTTTAAAGC
CTTCACCTGTGGTCTGAGCGTCTATAGCCGCGGTGATTGCAGGGGCTCTCCATCGGCATACCTAAATGGCACCTG
TGCTAGCAGCGGTAAGTCGAGTCCGGCCAACATGCTCTTGAGGCTTGTTGGCTCTCTTCTGCGACGGCATCTAAG
TCGCATCCACATTTGGTTGACGTAGAGTAGAAACGGACAGGAATATCATAGGAGGCTGGACCTGTGATCTCAATA
GCGACTGCAGCTTCTTAAGCGGTGGTGAAGAGAGAGGCTGGTGCGTACATTCGCACTGTCTACATCGTGGCTCAC
CTATCTATTTTTGTCAACTTGATGGCGGCTAATTTTGCCCTCTAGGAAAATGTCGGCCGACGAGTCGTTTCCAGG
CACCTCATCCTTGTCACAAGGCGATGCTAAGTCCAAGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail