Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7928
Gene name
LocationContig_90:34118..36221
Strand+
Gene length (bp)2103
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 7.0E-01 326 348
PF13516 LRR_6 Leucine Rich repeat 1.7E-03 421 443
PF13516 LRR_6 Leucine Rich repeat 3.4E-01 503 521
PF12937 F-box-like F-box-like 2.3E-09 183 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 186 588 1.0E-38
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 186 613 4.0E-38
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 186 588 1.0E-37
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 186 613 1.0E-37
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 186 613 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 186 588 1.0E-38
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 186 613 4.0E-38
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 186 588 1.0E-37
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 186 613 1.0E-37
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 186 613 1.0E-37
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 186 588 2.0E-37
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 186 588 2.0E-37
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 186 612 1.0E-33
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 186 475 3.0E-29
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 184 568 2.0E-19
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 184 568 1.0E-18
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 184 568 7.0E-18
sp|Q9Z0Z3|SKP2_MOUSE S-phase kinase-associated protein 2 OS=Mus musculus GN=Skp2 PE=1 SV=1 183 477 7.0E-18
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 186 589 7.0E-18
sp|Q13309|SKP2_HUMAN S-phase kinase-associated protein 2 OS=Homo sapiens GN=SKP2 PE=1 SV=2 183 477 5.0E-17
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 186 586 2.0E-16
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 254 481 4.0E-16
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 216 527 6.0E-14
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 186 586 3.0E-12
sp|Q0VD31|FBXL4_BOVIN F-box/LRR-repeat protein 4 OS=Bos taurus GN=FBXL4 PE=2 SV=1 182 540 3.0E-12
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 189 542 7.0E-12
sp|Q9UKA2|FBXL4_HUMAN F-box/LRR-repeat protein 4 OS=Homo sapiens GN=FBXL4 PE=1 SV=2 163 535 1.0E-11
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 189 542 2.0E-11
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 189 542 2.0E-11
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 168 545 1.0E-10
sp|Q8BH70|FBXL4_MOUSE F-box/LRR-repeat protein 4 OS=Mus musculus GN=Fbxl4 PE=1 SV=1 182 460 2.0E-10
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 172 468 4.0E-10
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 271 603 4.0E-10
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 307 516 5.0E-10
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 168 545 7.0E-10
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 306 535 1.0E-09
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 232 525 7.0E-09
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 175 460 7.0E-09
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 185 439 8.0E-09
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 382 532 1.0E-08
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 183 475 1.0E-08
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 323 588 2.0E-08
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 273 532 2.0E-08
sp|Q6PB97|FXL19_MOUSE F-box/LRR-repeat protein 19 OS=Mus musculus GN=Fbxl19 PE=2 SV=1 186 489 2.0E-08
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 301 465 3.0E-08
sp|Q6PCT2|FXL19_HUMAN F-box/LRR-repeat protein 19 OS=Homo sapiens GN=FBXL19 PE=1 SV=3 186 489 3.0E-08
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 185 502 4.0E-08
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 185 401 5.0E-08
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 260 465 6.0E-08
sp|O74783|POF2_SCHPO SCF E3 ubiquitin ligase complex F-box protein pof2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof2 PE=1 SV=1 186 551 6.0E-08
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 304 516 7.0E-08
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 260 462 1.0E-07
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 323 525 3.0E-07
sp|Q640I9|KDM2B_XENLA Lysine-specific demethylase 2B OS=Xenopus laevis GN=kdm2b PE=2 SV=1 186 465 3.0E-07
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 288 462 4.0E-07
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 422 581 5.0E-07
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 288 462 6.0E-07
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 299 542 8.0E-07
sp|Q8RWU5|FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana GN=FBL3 PE=2 SV=1 269 549 8.0E-07
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 297 465 9.0E-07
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 185 401 1.0E-06
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 274 551 2.0E-06
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 288 462 2.0E-06
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 194 520 3.0E-06
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 194 520 3.0E-06
sp|A2RT62|FXL16_MOUSE F-box/LRR-repeat protein 16 OS=Mus musculus GN=Fbxl16 PE=1 SV=1 194 526 3.0E-06
sp|Q0P4D1|AMN1_DANRE Protein AMN1 homolog OS=Danio rerio GN=amn1 PE=2 SV=1 423 531 6.0E-06
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 410 622 7.0E-06
sp|Q9C626|FB37_ARATH F-box protein At1g47056 OS=Arabidopsis thaliana GN=At1g47056 PE=2 SV=1 303 543 8.0E-06
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 410 622 9.0E-06
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 337 535 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7928
MALGSDDGLPAPGAPSSTSFGLQGHHPSAPELPNKAKGRHRLLRGLQRISSSPSLNGLRRSKSVGSPYSTRSTLS
CVSLAAPGPSQTPPAPRCSSPLVSQTSSHSISTAPMSLRTPTATSDSPLYSDPTQDYLAVRKIENTISPTSPAIS
TLPTELRCSRLEGQQSRNRSNCHALQRPLFSFWDNMPYEISIQIFSHLKPKELARASRVGKLFHQFCFDGQLWTS
LDASSFYREIPAESLTRIILAAGPFVKNLNLRGCVQIEHYKRTEAIISACNNLVNATLEGCHNFPKGAVHSLLKS
NENLVHLNLTGLSAVTNSSCRLIAQSCPRLESLNVSWCEKVRARGIKAVIESCSRLKDLRAGEVRGFDDLAVARS
IFESNNLEKLVLCGCLELSDDALRIMMHGDDPEIDILTYKPLVPPRKLRHLDLSRCHRLSSEGVKAIAHVTPYLQ
GLQLSGCKTLTDGAIEPILASTPSLTLLELEEMAQLTNSLLADHLARSPCVSRLEHLSLSYCENIGDIGMLPVMQ
NCVGLRSADLDNTRISDLVLAEAAALVLKRSSRSRNANTKPKFTLQLAVYDCQNVTWTGIREILFRNTQVRPVPG
IPGHITYPTEAIGLKCFYGFQMTVDEHQKRVLQGDLDSANRLERKWSEYMQASEDAEADVTAYGRRRRRAREAQA
AHLEEEDGGVGGRRRARTLGACLVM*
Coding >OphauB2|7928
ATGGCTCTTGGCTCCGACGACGGGCTGCCTGCGCCTGGTGCGCCGTCAAGCACCAGCTTTGGCCTTCAAGGCCAC
CATCCGTCGGCGCCCGAGCTGCCCAACAAGGCAAAAGGCCGCCATCGTTTGCTTCGGGGACTGCAGCGCATTTCT
TCTTCGCCGTCGCTCAATGGCCTTCGACGCTCCAAATCAGTTGGCAGTCCCTATAGCACTCGAAGCACCCTTTCT
TGTGTCAGCTTGGCCGCCCCGGGTCCCTCGCAGACGCCGCCTGCTCCTCGATGCTCTTCACCATTGGTCTCGCAG
ACATCTTCTCACTCAATTTCCACTGCTCCCATGTCGCTGCGTACTCCCACTGCAACCAGCGACTCGCCCTTGTAC
AGCGACCCCACCCAAGACTATCTGGCTGTACGAAAGATTGAAAACACCATCTCGCCTACCTCTCCTGCCATTTCC
ACCTTGCCGACGGAGCTCCGGTGCTCAAGGCTTGAAGGACAACAGAGCCGCAACCGGTCAAATTGCCACGCCCTG
CAAAGACCACTCTTCTCTTTCTGGGACAATATGCCCTATGAAATCTCGATACAAATCTTTTCTCATTTAAAACCA
AAGGAGCTGGCCCGGGCATCGAGAGTGGGCAAGTTGTTTCATCAGTTCTGCTTCGATGGTCAGCTCTGGACATCG
CTGGATGCATCCAGCTTTTATCGAGAAATCCCCGCCGAGTCACTTACCAGAATCATTCTCGCTGCTGGCCCCTTT
GTCAAGAACCTGAACCTTCGAGGCTGTGTGCAAATTGAGCACTACAAACGTACAGAAGCCATCATCAGCGCCTGC
AATAATCTTGTCAACGCCACTTTGGAGGGCTGTCACAACTTCCCAAAGGGCGCGGTGCACAGTCTTTTGAAGAGC
AATGAGAATCTGGTTCATCTCAACCTCACAGGGCTCTCTGCTGTTACAAACTCGTCTTGTCGATTAATTGCCCAG
TCGTGCCCTCGCCTAGAGTCGCTCAATGTGTCGTGGTGCGAAAAGGTTAGGGCGCGCGGCATCAAGGCTGTTATC
GAATCATGCTCTAGATTGAAGGACCTGAGAGCCGGTGAAGTCCGCGGATTTGACGATCTTGCCGTTGCCAGATCC
ATCTTCGAGTCAAATAATTTGGAAAAGTTAGTCTTGTGTGGATGCCTGGAGCTTAGCGACGATGCGCTCAGAATC
ATGATGCATGGCGATGATCCAGAGATTGATATTCTGACATACAAGCCCCTCGTACCCCCTCGGAAACTGCGCCAT
CTTGACCTAAGTCGTTGCCATCGTCTTTCGAGCGAAGGAGTCAAGGCCATTGCCCATGTTACTCCCTATCTACAA
GGGCTACAGCTTTCCGGATGCAAGACCTTGACAGACGGAGCAATCGAGCCTATTCTAGCTTCGACGCCCAGCCTC
ACATTGCTAGAACTCGAAGAGATGGCTCAATTGACCAACTCGTTACTTGCCGATCACTTGGCCAGATCTCCTTGC
GTCTCAAGGCTGGAGCATCTATCTCTGAGCTACTGCGAGAACATTGGTGATATTGGGATGCTACCCGTCATGCAA
AATTGTGTTGGGTTGAGAAGTGCCGATTTGGACAATACTCGCATTAGCGATCTGGTCCTTGCCGAAGCTGCTGCT
CTAGTCTTGAAGCGGTCCAGCCGATCAAGAAATGCCAACACGAAGCCAAAATTTACGCTGCAGCTTGCCGTTTAT
GACTGTCAAAACGTCACTTGGACAGGGATCCGCGAGATACTCTTCCGTAACACGCAAGTCCGGCCGGTGCCGGGT
ATACCTGGACACATCACGTACCCTACGGAAGCGATTGGGCTCAAATGTTTTTATGGTTTTCAGATGACTGTCGAT
GAGCACCAGAAGCGTGTTTTGCAAGGTGATCTTGACTCGGCCAACAGATTGGAGAGAAAGTGGTCCGAATACATG
CAAGCCAGCGAGGATGCTGAAGCGGATGTGACAGCTTACGGGAGGCGCCGTCGTCGGGCTAGAGAGGCCCAGGCA
GCACATTTGGAAGAGGAGGATGGAGGCGTGGGCGGTCGCCGAAGAGCCCGGACACTTGGGGCCTGTTTGGTTATG
TGA
Transcript >OphauB2|7928
ATGGCTCTTGGCTCCGACGACGGGCTGCCTGCGCCTGGTGCGCCGTCAAGCACCAGCTTTGGCCTTCAAGGCCAC
CATCCGTCGGCGCCCGAGCTGCCCAACAAGGCAAAAGGCCGCCATCGTTTGCTTCGGGGACTGCAGCGCATTTCT
TCTTCGCCGTCGCTCAATGGCCTTCGACGCTCCAAATCAGTTGGCAGTCCCTATAGCACTCGAAGCACCCTTTCT
TGTGTCAGCTTGGCCGCCCCGGGTCCCTCGCAGACGCCGCCTGCTCCTCGATGCTCTTCACCATTGGTCTCGCAG
ACATCTTCTCACTCAATTTCCACTGCTCCCATGTCGCTGCGTACTCCCACTGCAACCAGCGACTCGCCCTTGTAC
AGCGACCCCACCCAAGACTATCTGGCTGTACGAAAGATTGAAAACACCATCTCGCCTACCTCTCCTGCCATTTCC
ACCTTGCCGACGGAGCTCCGGTGCTCAAGGCTTGAAGGACAACAGAGCCGCAACCGGTCAAATTGCCACGCCCTG
CAAAGACCACTCTTCTCTTTCTGGGACAATATGCCCTATGAAATCTCGATACAAATCTTTTCTCATTTAAAACCA
AAGGAGCTGGCCCGGGCATCGAGAGTGGGCAAGTTGTTTCATCAGTTCTGCTTCGATGGTCAGCTCTGGACATCG
CTGGATGCATCCAGCTTTTATCGAGAAATCCCCGCCGAGTCACTTACCAGAATCATTCTCGCTGCTGGCCCCTTT
GTCAAGAACCTGAACCTTCGAGGCTGTGTGCAAATTGAGCACTACAAACGTACAGAAGCCATCATCAGCGCCTGC
AATAATCTTGTCAACGCCACTTTGGAGGGCTGTCACAACTTCCCAAAGGGCGCGGTGCACAGTCTTTTGAAGAGC
AATGAGAATCTGGTTCATCTCAACCTCACAGGGCTCTCTGCTGTTACAAACTCGTCTTGTCGATTAATTGCCCAG
TCGTGCCCTCGCCTAGAGTCGCTCAATGTGTCGTGGTGCGAAAAGGTTAGGGCGCGCGGCATCAAGGCTGTTATC
GAATCATGCTCTAGATTGAAGGACCTGAGAGCCGGTGAAGTCCGCGGATTTGACGATCTTGCCGTTGCCAGATCC
ATCTTCGAGTCAAATAATTTGGAAAAGTTAGTCTTGTGTGGATGCCTGGAGCTTAGCGACGATGCGCTCAGAATC
ATGATGCATGGCGATGATCCAGAGATTGATATTCTGACATACAAGCCCCTCGTACCCCCTCGGAAACTGCGCCAT
CTTGACCTAAGTCGTTGCCATCGTCTTTCGAGCGAAGGAGTCAAGGCCATTGCCCATGTTACTCCCTATCTACAA
GGGCTACAGCTTTCCGGATGCAAGACCTTGACAGACGGAGCAATCGAGCCTATTCTAGCTTCGACGCCCAGCCTC
ACATTGCTAGAACTCGAAGAGATGGCTCAATTGACCAACTCGTTACTTGCCGATCACTTGGCCAGATCTCCTTGC
GTCTCAAGGCTGGAGCATCTATCTCTGAGCTACTGCGAGAACATTGGTGATATTGGGATGCTACCCGTCATGCAA
AATTGTGTTGGGTTGAGAAGTGCCGATTTGGACAATACTCGCATTAGCGATCTGGTCCTTGCCGAAGCTGCTGCT
CTAGTCTTGAAGCGGTCCAGCCGATCAAGAAATGCCAACACGAAGCCAAAATTTACGCTGCAGCTTGCCGTTTAT
GACTGTCAAAACGTCACTTGGACAGGGATCCGCGAGATACTCTTCCGTAACACGCAAGTCCGGCCGGTGCCGGGT
ATACCTGGACACATCACGTACCCTACGGAAGCGATTGGGCTCAAATGTTTTTATGGTTTTCAGATGACTGTCGAT
GAGCACCAGAAGCGTGTTTTGCAAGGTGATCTTGACTCGGCCAACAGATTGGAGAGAAAGTGGTCCGAATACATG
CAAGCCAGCGAGGATGCTGAAGCGGATGTGACAGCTTACGGGAGGCGCCGTCGTCGGGCTAGAGAGGCCCAGGCA
GCACATTTGGAAGAGGAGGATGGAGGCGTGGGCGGTCGCCGAAGAGCCCGGACACTTGGGGCCTGTTTGGTTATG
TGA
Gene >OphauB2|7928
ATGGCTCTTGGCTCCGACGACGGGCTGCCTGCGCCTGGTGCGCCGTCAAGCACCAGCTTTGGCCTTCAAGGCCAC
CATCCGTCGGCGCCCGAGCTGCCCAACAAGGCAAAAGGCCGCCATCGTTTGCTTCGGGGACTGCAGCGCATTTCT
TCTTCGCCGTCGCTCAATGGCCTTCGACGCTCCAAATCAGTTGGCAGTCCCTATAGCACTCGAAGCACCCTTTCT
TGTGTCAGCTTGGCCGCCCCGGGTCCCTCGCAGACGCCGCCTGCTCCTCGATGCTCTTCACCATTGGTCTCGCAG
ACATCTTCTCACTCAATTTCCACTGCTCCCATGTCGCTGCGTACTCCCACTGCAACCAGCGACTCGCCCTTGTAC
AGCGACCCCACCCAAGACTATCTGGCTGTACGAAAGATTGAAAACACCATCTCGCCTACCTCTCCTGCCATTTCC
ACCTTGCCGACGGAGCTCCGGTGCTCAAGGCTTGAAGGACAACAGAGCCGCAACCGGTCAAATTGCCACGCCCTG
CAAAGACCACTCTTCTCTTTCTGGGACAATATGCCCTATGAAATCTCGATACAAATCTTTTCTCATTTAAAACCA
AAGGAGCTGGCCCGGGCATCGAGAGTGGGCAAGTTGTTTCATCAGTTCTGCTTCGATGGTCAGCTCTGGACATCG
CTGGATGCATCCAGCTTTTATCGAGAAATCCCCGCCGAGTCACTTACCAGAATCATTCTCGCTGCTGGCCCCTTT
GTCAAGAACCTGAACCTTCGAGGCTGTGTGCAAATTGAGCACTACAAACGTACAGAAGCCATCATCAGCGCCTGC
AATAATCTTGTCAACGCCACTTTGGAGGGCTGTCACAACTTCCCAAAGGGCGCGGTGCACAGTCTTTTGAAGAGC
AATGAGAATCTGGTTCATCTCAACCTCACAGGGCTCTCTGCTGTTACAAACTCGTCTTGTCGATTAATTGCCCAG
TCGTGCCCTCGCCTAGAGTCGCTCAATGTGTCGTGGTGCGAAAAGGTTAGGGCGCGCGGCATCAAGGCTGTTATC
GAATCATGCTCTAGATTGAAGGACCTGAGAGCCGGTGAAGTCCGCGGATTTGACGATCTTGCCGTTGCCAGATCC
ATCTTCGAGTCAAATAATTTGGAAAAGTTAGTCTTGTGTGGATGCCTGGAGCTTAGCGACGATGCGCTCAGAATC
ATGATGCATGGCGATGATCCAGAGATTGATATTCTGACATACAAGCCCCTCGTACCCCCTCGGAAACTGCGCCAT
CTTGACCTAAGTCGTTGCCATCGTCTTTCGAGCGAAGGAGTCAAGGCCATTGCCCATGTTACTCCCTATCTACAA
GGGCTACAGCTTTCCGGATGCAAGACCTTGACAGACGGAGCAATCGAGCCTATTCTAGCTTCGACGCCCAGCCTC
ACATTGCTAGAACTCGAAGAGATGGCTCAATTGACCAACTCGTTACTTGCCGATCACTTGGCCAGATCTCCTTGC
GTCTCAAGGCTGGAGCATCTATCTCTGAGCTACTGCGAGAACATTGGTGATATTGGGATGCTACCCGTCATGCAA
AATTGTGTTGGGTTGAGAAGTGCCGATTTGGACAATACTCGCATTAGCGATCTGGTCCTTGCCGAAGCTGCTGCT
CTAGTCTTGAAGCGGTCCAGCCGATCAAGAAATGCCAACACGAAGCCAAAATTTACGCTGCAGCTTGCCGTTTAT
GACTGTCAAAACGTCACTTGGACAGGGATCCGCGAGATACTCTTCCGTAACACGCAAGTCCGGCCGGTGCCGGGT
ATACCTGGACACATCACGTACCCTACGGAAGCGATTGGGCTCAAATGTTTTTATGGTTTTCAGATGACTGTCGAT
GAGCACCAGAAGCGTGTTTTGCAAGGTGATCTTGACTCGGCCAACAGATTGGAGAGAAAGTGGTCCGAATACATG
CAAGCCAGCGAGGATGCTGAAGCGGATGTGACAGCTTACGGGAGGCGCCGTCGTCGGGCTAGAGAGGCCCAGGCA
GCACATTTGGAAGAGGAGGATGGAGGCGTGGGCGGTCGCCGAAGAGCCCGGACACTTGGGGCCTGTTTGGTTATG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail