Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7926
Gene name
LocationContig_90:27157..31007
Strand-
Gene length (bp)3850
Transcript length (bp)3627
Coding sequence length (bp)3627
Protein length (aa) 1209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.0E-55 946 1203
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 7.3E-20 948 1159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTH3|PPK6_SCHPO Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk6 PE=1 SV=2 925 1203 9.0E-85
sp|Q08217|PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK2 PE=1 SV=1 945 1205 5.0E-81
sp|P31374|PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK1 PE=1 SV=2 945 1203 9.0E-81
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 946 1203 3.0E-54
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 944 1203 1.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTH3|PPK6_SCHPO Serine/threonine-protein kinase ppk6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk6 PE=1 SV=2 925 1203 9.0E-85
sp|Q08217|PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK2 PE=1 SV=1 945 1205 5.0E-81
sp|P31374|PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK1 PE=1 SV=2 945 1203 9.0E-81
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 946 1203 3.0E-54
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 944 1203 1.0E-52
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 937 1203 1.0E-40
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 937 1203 1.0E-40
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 943 1203 2.0E-39
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 943 1203 2.0E-39
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 920 1206 2.0E-39
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 920 1206 9.0E-39
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 943 1203 2.0E-38
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 946 1206 2.0E-38
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 920 1206 2.0E-38
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 946 1203 4.0E-38
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 943 1203 5.0E-38
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 946 1203 5.0E-38
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 943 1203 5.0E-38
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 946 1206 6.0E-38
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 946 1203 7.0E-38
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 946 1203 1.0E-37
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 946 1206 1.0E-37
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 929 1206 2.0E-37
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 946 1203 3.0E-37
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 863 1206 6.0E-37
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 919 1206 9.0E-37
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 920 1174 3.0E-36
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 938 1206 4.0E-36
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 943 1174 5.0E-36
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 943 1174 6.0E-36
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 901 1206 4.0E-35
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 939 1205 4.0E-35
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 841 1206 9.0E-35
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 946 1203 1.0E-34
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 946 1203 1.0E-34
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 946 1203 2.0E-34
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 841 1203 5.0E-34
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 946 1207 6.0E-34
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 896 1206 8.0E-34
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 858 1206 1.0E-33
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 935 1205 1.0E-33
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 946 1203 2.0E-33
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 946 1203 4.0E-33
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 937 1205 5.0E-33
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 946 1203 7.0E-33
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 902 1206 7.0E-33
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 903 1206 7.0E-33
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 940 1205 7.0E-33
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 940 1205 9.0E-33
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 952 1203 1.0E-32
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 940 1205 1.0E-32
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 940 1205 1.0E-32
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 940 1205 1.0E-32
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 946 1203 2.0E-32
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 944 1205 2.0E-32
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 943 1203 2.0E-32
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 940 1205 2.0E-32
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 946 1203 2.0E-32
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 942 1203 2.0E-32
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 943 1203 2.0E-32
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 940 1205 3.0E-32
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 946 1205 4.0E-32
sp|Q9P1W9|PIM2_HUMAN Serine/threonine-protein kinase pim-2 OS=Homo sapiens GN=PIM2 PE=1 SV=1 945 1203 4.0E-32
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 940 1205 4.0E-32
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 940 1205 4.0E-32
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 946 1205 4.0E-32
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 917 1205 5.0E-32
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 946 1203 5.0E-32
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 903 1206 5.0E-32
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 931 1203 6.0E-32
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 952 1203 8.0E-32
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 871 1203 8.0E-32
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 952 1203 8.0E-32
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 945 1203 9.0E-32
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 879 1203 2.0E-31
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 890 1207 2.0E-31
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 945 1206 2.0E-31
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 946 1208 3.0E-31
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 936 1156 3.0E-31
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 943 1205 3.0E-31
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 938 1203 6.0E-31
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 943 1203 9.0E-31
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 946 1203 9.0E-31
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 946 1203 1.0E-30
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 940 1203 1.0E-30
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 940 1205 1.0E-30
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 946 1203 1.0E-30
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 946 1203 1.0E-30
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 946 1208 2.0E-30
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 946 1208 2.0E-30
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 897 1206 2.0E-30
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 917 1203 2.0E-30
sp|Q3SZW1|TSSK1_BOVIN Testis-specific serine/threonine-protein kinase 1 OS=Bos taurus GN=TSSK1B PE=2 SV=1 946 1203 2.0E-30
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 942 1203 2.0E-30
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 946 1203 2.0E-30
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 946 1204 3.0E-30
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 936 1203 3.0E-30
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 946 1203 4.0E-30
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 946 1208 4.0E-30
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 938 1205 4.0E-30
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 946 1205 6.0E-30
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 917 1205 6.0E-30
sp|A2KF29|SMKTR_MOUSE Sperm motility kinase Tcr mutant form OS=Mus musculus GN=Smoktcr PE=2 SV=1 946 1203 6.0E-30
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 890 1208 6.0E-30
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 942 1203 7.0E-30
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 915 1205 7.0E-30
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 943 1203 7.0E-30
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 943 1203 8.0E-30
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 913 1207 9.0E-30
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 943 1203 1.0E-29
sp|Q8SW31|KIN1_ENCCU Probable serine/threonine-protein kinase KIN1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=KIN1 PE=3 SV=1 943 1203 1.0E-29
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 884 1207 1.0E-29
sp|Q86V86|PIM3_HUMAN Serine/threonine-protein kinase pim-3 OS=Homo sapiens GN=PIM3 PE=1 SV=3 902 1203 2.0E-29
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 928 1207 3.0E-29
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 939 1208 3.0E-29
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 940 1205 3.0E-29
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 946 1203 3.0E-29
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 946 1205 3.0E-29
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 923 1206 3.0E-29
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 942 1203 4.0E-29
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 937 1192 4.0E-29
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 946 1208 4.0E-29
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 896 1205 4.0E-29
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 946 1203 5.0E-29
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 946 1203 5.0E-29
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 946 1203 6.0E-29
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 943 1203 7.0E-29
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 942 1206 8.0E-29
sp|A0JLX3|SMK4A_MOUSE Sperm motility kinase 4A OS=Mus musculus GN=Smok4a PE=2 SV=2 946 1203 9.0E-29
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 946 1203 1.0E-28
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 944 1203 1.0E-28
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 946 1203 1.0E-28
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 946 1203 1.0E-28
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 946 1203 1.0E-28
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 912 1206 1.0E-28
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 935 1205 1.0E-28
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 942 1203 1.0E-28
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 937 1192 1.0E-28
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 937 1203 1.0E-28
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 930 1205 1.0E-28
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 946 1207 1.0E-28
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 946 1205 1.0E-28
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 944 1203 1.0E-28
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 939 1203 2.0E-28
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 946 1206 2.0E-28
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 943 1160 2.0E-28
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 946 1203 2.0E-28
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 933 1207 2.0E-28
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 942 1206 2.0E-28
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 888 1203 2.0E-28
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 946 1203 3.0E-28
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 942 1203 3.0E-28
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 943 1205 4.0E-28
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 946 1205 4.0E-28
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 937 1156 4.0E-28
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 946 1205 4.0E-28
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 940 1205 4.0E-28
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 899 1206 4.0E-28
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 930 1203 5.0E-28
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 939 1203 5.0E-28
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 944 1203 5.0E-28
sp|Q5XHI9|HUNKA_XENLA Hormonally up-regulated neu tumor-associated kinase homolog A OS=Xenopus laevis GN=hunk-a PE=2 SV=1 943 1203 5.0E-28
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 944 1203 5.0E-28
sp|Q91822|PIM3_XENLA Serine/threonine-protein kinase pim-3 OS=Xenopus laevis GN=pim3 PE=1 SV=1 905 1206 6.0E-28
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 942 1203 7.0E-28
sp|Q9BXA7|TSSK1_HUMAN Testis-specific serine/threonine-protein kinase 1 OS=Homo sapiens GN=TSSK1B PE=1 SV=1 946 1203 8.0E-28
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 903 1205 8.0E-28
sp|P06803|PIM1_MOUSE Serine/threonine-protein kinase pim-1 OS=Mus musculus GN=Pim1 PE=1 SV=2 915 1206 1.0E-27
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 952 1201 1.0E-27
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 939 1205 1.0E-27
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 944 1205 1.0E-27
sp|O70444|PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus GN=Pim3 PE=1 SV=3 902 1208 1.0E-27
sp|P58750|PIM3_MOUSE Serine/threonine-protein kinase pim-3 OS=Mus musculus GN=Pim3 PE=1 SV=1 902 1208 1.0E-27
sp|Q9PU85|PIM3_COTJA Serine/threonine-protein kinase pim-3 OS=Coturnix coturnix japonica GN=PIM3 PE=2 SV=1 902 1208 2.0E-27
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 943 1205 2.0E-27
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 907 1203 2.0E-27
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 944 1203 2.0E-27
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 940 1208 2.0E-27
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 898 1206 2.0E-27
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 914 1203 2.0E-27
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 902 1205 2.0E-27
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 946 1205 2.0E-27
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 946 1205 2.0E-27
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 933 1197 3.0E-27
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 946 1203 3.0E-27
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 937 1205 3.0E-27
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 937 1203 3.0E-27
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 937 1203 4.0E-27
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 937 1205 4.0E-27
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 941 1203 4.0E-27
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 943 1203 5.0E-27
sp|P11309|PIM1_HUMAN Serine/threonine-protein kinase pim-1 OS=Homo sapiens GN=PIM1 PE=1 SV=3 946 1207 5.0E-27
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 946 1205 5.0E-27
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 942 1203 5.0E-27
sp|P26794|PIM1_RAT Serine/threonine-protein kinase pim-1 OS=Rattus norvegicus GN=Pim1 PE=1 SV=1 915 1207 6.0E-27
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 941 1203 6.0E-27
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 937 1203 6.0E-27
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 946 1203 7.0E-27
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 900 1203 8.0E-27
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 946 1203 9.0E-27
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 946 1203 9.0E-27
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 946 1205 1.0E-26
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 946 1205 1.0E-26
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 941 1205 1.0E-26
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 943 1203 1.0E-26
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 917 1208 2.0E-26
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 918 1205 2.0E-26
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 946 1205 2.0E-26
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 937 1203 2.0E-26
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 946 1203 2.0E-26
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 881 1196 2.0E-26
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 946 1171 2.0E-26
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 946 1203 2.0E-26
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 946 1205 2.0E-26
sp|Q8C1R0|TSSK5_MOUSE Testis-specific serine/threonine-protein kinase 5 OS=Mus musculus GN=Tssk5 PE=2 SV=2 1011 1203 2.0E-26
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 919 1207 2.0E-26
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 946 1203 2.0E-26
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 946 1203 2.0E-26
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 1011 1203 2.0E-26
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 937 1205 2.0E-26
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 941 1205 3.0E-26
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 937 1201 3.0E-26
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 937 1203 3.0E-26
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 937 1203 3.0E-26
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 941 1203 3.0E-26
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 940 1207 3.0E-26
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 942 1203 3.0E-26
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 946 1205 4.0E-26
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 899 1196 4.0E-26
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 952 1207 4.0E-26
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 909 1196 4.0E-26
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 938 1205 4.0E-26
sp|Q95LJ0|PIM1_FELCA Serine/threonine-protein kinase pim-1 OS=Felis catus GN=PIM1 PE=2 SV=1 926 1207 5.0E-26
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 940 1208 5.0E-26
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 946 1205 5.0E-26
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 946 1206 6.0E-26
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 936 1203 6.0E-26
sp|Q9N0P9|PIM1_BOVIN Serine/threonine-protein kinase pim-1 OS=Bos taurus GN=PIM1 PE=2 SV=1 946 1207 6.0E-26
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 914 1196 6.0E-26
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 944 1203 6.0E-26
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 937 1203 7.0E-26
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 946 1206 9.0E-26
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 942 1203 9.0E-26
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 940 1156 9.0E-26
sp|Q20443|PRK2_CAEEL Serine/threonine-protein kinase prk-2 OS=Caenorhabditis elegans GN=prk-2 PE=3 SV=2 944 1205 1.0E-25
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 937 1203 1.0E-25
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 946 1203 1.0E-25
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 863 1208 1.0E-25
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 1011 1205 1.0E-25
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 922 1205 1.0E-25
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 933 1207 1.0E-25
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 913 1206 1.0E-25
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 943 1204 2.0E-25
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 946 1205 2.0E-25
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 937 1203 2.0E-25
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 913 1206 2.0E-25
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 946 1160 2.0E-25
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 946 1205 3.0E-25
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 942 1203 3.0E-25
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 936 1192 3.0E-25
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 854 1205 3.0E-25
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 946 1203 4.0E-25
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 952 1201 4.0E-25
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 944 1192 5.0E-25
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 942 1208 5.0E-25
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 939 1208 6.0E-25
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 940 1203 6.0E-25
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 940 1206 6.0E-25
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 940 1205 6.0E-25
sp|B7XHR6|KIN1_ENTBH Probable serine/threonine-protein kinase KIN1 homolog OS=Enterocytozoon bieneusi (strain H348) GN=KIN1 PE=3 SV=1 933 1203 7.0E-25
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 946 1205 7.0E-25
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 939 1207 7.0E-25
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 946 1203 8.0E-25
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 940 1156 8.0E-25
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 922 1208 8.0E-25
sp|Q9URY1|PPK16_SCHPO Serine/threonine-protein kinase ppk16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk16 PE=1 SV=1 946 1205 8.0E-25
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 946 1207 9.0E-25
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 900 1203 1.0E-24
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 946 1203 1.0E-24
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 937 1203 1.0E-24
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 934 1205 1.0E-24
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 946 1203 1.0E-24
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 937 1203 1.0E-24
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 937 1203 1.0E-24
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 937 1203 1.0E-24
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 944 1206 1.0E-24
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 940 1192 2.0E-24
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 939 1207 2.0E-24
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 943 1205 2.0E-24
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 939 1205 2.0E-24
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 935 1205 2.0E-24
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 917 1188 2.0E-24
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 929 1208 2.0E-24
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 940 1192 2.0E-24
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 937 1193 2.0E-24
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 946 1203 2.0E-24
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 937 1203 3.0E-24
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 937 1203 3.0E-24
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 911 1192 3.0E-24
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 917 1192 3.0E-24
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 946 1205 3.0E-24
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 946 1208 3.0E-24
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 946 1203 3.0E-24
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 928 1203 3.0E-24
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 946 1203 4.0E-24
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 909 1208 4.0E-24
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 946 1203 4.0E-24
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 943 1203 4.0E-24
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 943 1208 4.0E-24
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 939 1192 4.0E-24
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 938 1208 4.0E-24
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 938 1207 4.0E-24
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 942 1203 4.0E-24
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 917 1188 4.0E-24
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 938 1205 5.0E-24
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 909 1208 5.0E-24
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 904 1187 5.0E-24
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 940 1207 5.0E-24
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 904 1187 5.0E-24
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 917 1188 5.0E-24
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 934 1208 5.0E-24
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 924 1208 5.0E-24
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 938 1204 5.0E-24
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 945 1203 6.0E-24
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 931 1208 6.0E-24
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 946 1206 6.0E-24
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 924 1208 6.0E-24
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 904 1187 6.0E-24
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 941 1203 6.0E-24
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 942 1205 7.0E-24
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 917 1192 7.0E-24
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 918 1203 7.0E-24
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 939 1203 7.0E-24
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 939 1192 7.0E-24
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 939 1192 7.0E-24
sp|P43292|SRK2G_ARATH Serine/threonine-protein kinase SRK2G OS=Arabidopsis thaliana GN=SRK2G PE=1 SV=2 946 1203 7.0E-24
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 946 1207 7.0E-24
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 943 1208 8.0E-24
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 939 1192 8.0E-24
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 945 1203 8.0E-24
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 900 1208 8.0E-24
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 940 1192 8.0E-24
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 904 1187 9.0E-24
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 946 1206 9.0E-24
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 939 1192 1.0E-23
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 946 1203 1.0E-23
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 937 1192 1.0E-23
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 937 1192 1.0E-23
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 943 1203 1.0E-23
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 946 1203 1.0E-23
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 939 1192 1.0E-23
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 939 1192 1.0E-23
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 943 1203 1.0E-23
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 943 1203 1.0E-23
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 940 1203 1.0E-23
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 938 1192 2.0E-23
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 943 1203 2.0E-23
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 940 1208 2.0E-23
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 916 1208 2.0E-23
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 925 1206 2.0E-23
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 861 1207 2.0E-23
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 946 1205 2.0E-23
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 939 1192 2.0E-23
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 946 1205 2.0E-23
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 924 1187 2.0E-23
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 946 1205 2.0E-23
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 943 1203 2.0E-23
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 939 1203 2.0E-23
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 939 1192 2.0E-23
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 946 1205 2.0E-23
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 945 1203 2.0E-23
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 940 1187 2.0E-23
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 946 1205 2.0E-23
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 944 1205 2.0E-23
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 899 1156 3.0E-23
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 899 1156 3.0E-23
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 940 1208 3.0E-23
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 931 1208 3.0E-23
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 904 1187 3.0E-23
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 929 1205 3.0E-23
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 864 1205 3.0E-23
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 946 1205 3.0E-23
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 944 1207 3.0E-23
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 939 1203 3.0E-23
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 944 1205 3.0E-23
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 944 1205 3.0E-23
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 903 1208 4.0E-23
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 917 1205 4.0E-23
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 903 1208 4.0E-23
sp|Q9SMQ4|SRK2F_ARATH Serine/threonine-protein kinase SRK2F OS=Arabidopsis thaliana GN=SRK2F PE=1 SV=1 943 1203 4.0E-23
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 939 1192 5.0E-23
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 895 1206 5.0E-23
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 946 1203 5.0E-23
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 943 1201 6.0E-23
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 941 1192 6.0E-23
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 944 1205 6.0E-23
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 946 1208 6.0E-23
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 944 1205 6.0E-23
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 944 1205 7.0E-23
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 910 1192 7.0E-23
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 943 1208 7.0E-23
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 917 1203 7.0E-23
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 943 1203 7.0E-23
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 941 1188 8.0E-23
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 943 1203 8.0E-23
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 944 1205 8.0E-23
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 938 1208 8.0E-23
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 943 1203 8.0E-23
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 910 1192 8.0E-23
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 944 1205 8.0E-23
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 946 1205 9.0E-23
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 938 1160 9.0E-23
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 946 1205 9.0E-23
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 940 1205 9.0E-23
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 939 1192 1.0E-22
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 910 1192 1.0E-22
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 942 1206 1.0E-22
sp|Q9D2E1|TSSK3_MOUSE Testis-specific serine/threonine-protein kinase 3 OS=Mus musculus GN=Tssk3 PE=2 SV=1 946 1203 1.0E-22
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 944 1207 1.0E-22
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 926 1188 1.0E-22
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 940 1208 1.0E-22
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 944 1207 1.0E-22
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 946 1205 1.0E-22
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 940 1203 1.0E-22
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 946 1203 1.0E-22
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 942 1203 1.0E-22
sp|Q96PN8|TSSK3_HUMAN Testis-specific serine/threonine-protein kinase 3 OS=Homo sapiens GN=TSSK3 PE=1 SV=1 946 1203 1.0E-22
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 910 1192 1.0E-22
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 936 1203 1.0E-22
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 939 1192 2.0E-22
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 908 1192 2.0E-22
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 925 1170 2.0E-22
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 908 1197 2.0E-22
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 946 1205 2.0E-22
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 944 1203 2.0E-22
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 940 1208 2.0E-22
sp|P07334|CDR1_SCHPO Mitosis inducer protein kinase cdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr1 PE=1 SV=3 940 1203 2.0E-22
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 943 1203 2.0E-22
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 939 1192 2.0E-22
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 935 1206 2.0E-22
sp|Q940H6|SRK2E_ARATH Serine/threonine-protein kinase SRK2E OS=Arabidopsis thaliana GN=SRK2E PE=1 SV=1 946 1203 2.0E-22
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 946 1203 2.0E-22
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 940 1207 2.0E-22
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 946 1203 2.0E-22
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 940 1205 2.0E-22
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 943 1205 2.0E-22
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 940 1192 2.0E-22
sp|O64812|SRK2J_ARATH Serine/threonine-protein kinase SRK2J OS=Arabidopsis thaliana GN=SRK2J PE=1 SV=1 943 1203 3.0E-22
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 910 1185 3.0E-22
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 904 1187 3.0E-22
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 904 1187 3.0E-22
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 931 1192 3.0E-22
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 946 1205 3.0E-22
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 905 1203 3.0E-22
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 940 1207 3.0E-22
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 943 1207 3.0E-22
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 943 1192 3.0E-22
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 940 1192 3.0E-22
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 940 1207 4.0E-22
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 936 1205 4.0E-22
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 943 1203 4.0E-22
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 904 1187 5.0E-22
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 943 1203 5.0E-22
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 946 1203 5.0E-22
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 943 1203 5.0E-22
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 938 1192 5.0E-22
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 943 1203 5.0E-22
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 946 1203 5.0E-22
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 946 1203 5.0E-22
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 938 1206 5.0E-22
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 938 1192 5.0E-22
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 943 1201 6.0E-22
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 946 1205 6.0E-22
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 940 1161 6.0E-22
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 935 1208 7.0E-22
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 938 1192 7.0E-22
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 899 1156 7.0E-22
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 904 1187 7.0E-22
sp|Q7Y0B9|SAPK8_ORYSJ Serine/threonine-protein kinase SAPK8 OS=Oryza sativa subsp. japonica GN=SAPK8 PE=2 SV=1 946 1203 7.0E-22
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 943 1203 8.0E-22
sp|Q75H77|SAPKA_ORYSJ Serine/threonine-protein kinase SAPK10 OS=Oryza sativa subsp. japonica GN=SAPK10 PE=2 SV=1 946 1203 8.0E-22
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 937 1192 8.0E-22
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 944 1192 8.0E-22
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 944 1192 8.0E-22
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 962 1208 8.0E-22
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 940 1187 8.0E-22
sp|Q23551|UNC22_CAEEL Twitchin OS=Caenorhabditis elegans GN=unc-22 PE=1 SV=3 946 1203 9.0E-22
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 946 1205 1.0E-21
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 944 1192 1.0E-21
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 944 1192 1.0E-21
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 940 1161 1.0E-21
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 946 1208 1.0E-21
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 946 1205 1.0E-21
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 866 1205 1.0E-21
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 913 1203 1.0E-21
sp|Q75V57|SAPK9_ORYSJ Serine/threonine-protein kinase SAPK9 OS=Oryza sativa subsp. japonica GN=SAPK9 PE=2 SV=1 946 1203 1.0E-21
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 913 1203 1.0E-21
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 940 1192 1.0E-21
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 944 1192 1.0E-21
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 923 1203 1.0E-21
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 952 1206 6.0E-20
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 952 1205 2.0E-18
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 952 1205 8.0E-18
sp|P31374|PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK1 PE=1 SV=2 648 802 9.0E-15
sp|Q08217|PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK2 PE=1 SV=1 547 801 2.0E-10
sp|P31374|PSK1_YEAST Serine/threonine-protein kinase PSK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK1 PE=1 SV=2 410 465 2.0E-07
sp|Q08217|PSK2_YEAST Serine/threonine-protein kinase PSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSK2 PE=1 SV=1 412 492 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7926
MLPLHHGPLDKTADNSSSQDEAEESRGRESLVPPLSLPKNRSTGNLALTTTHDAVTDRPRYRMSFDAPSMSALDH
DVLTRSPHMVDHEHGPGLSGLRRIRQQHPPSRHPTLPSSAVSSRSHSVAALSRSTSMSGVATTSGSQGQSGGPAS
PSFSEDLSRFPSESLHSFSFAHQSEEFIHNRQSVLKRSMDFIKDRLGWSMSSTQAGLVSAQARVTGDADTQNMLE
LLARANIIGAGNLPNADAFKATGPLTGPAQVTGENVFDVQFTTQPFGVDAAAPDGTSPAALNTVKARVDDDQVES
PTAPAKQWPPGHDSEQSSRTPTNESSTTAQTSPPVSRPISLKRTMTDTLSITVQDKLIDTMTRPFLASQQIVEEP
ANTSPMMAHSVPASKALPSALGPAVHGHTNRWVPAAQAIFTTEAKPPWTIIAANDLACLVFGVTKAEVRKMGILE
VVQEERRAWLERKLLRGDEEDERQHGAPGGKSTTPAASAASTLLGGRTGITAQLLSKPNSRCQAQRGAMTRRAQT
IHSGDPNPPKTRGSGQHRSNLSRGVLLCGDVVPIQKRNGATGSASLWVKEKRVGLIWVLEEIHEDVAYVQLDDDG
IIKGISGAAEPIWGSSIWTRQGLDVARLIPRIPRQGIDPTVGEIDFAQVTRQRYFACPNSGRVNIPCLVEQTRGK
VELRVSTFPHMAGIIVVDPDSLKIRSSNSVFCGALFGYDKADGLSIESLIPDFGKIIHVMTEEDGLQIMDGMVVP
EQRFRRAWAFFALKEHRSNAAAAFLQPDGLPAKHRDGSELKIDVQMRVVESEKQPSIVEETVVEGSDEDEASSPP
DTFTIHRKEMVFALWITYSRHLHAHAPLDVDSPAGSGTLTPLHQPSPGQTPAVHSPMDMTSDDDETRKDLAASPS
PLSELAQGAPLAAPAKPSNNPLSKAADKAPAAKSLEPAPKTSIQDYTIVEDMGQGAYGQVKLARHKQSGNRIVLK
YVTKRRILVDTWTRDRKLGTVPLEIHVLDYLRRPEFRHPNIVEMQGFFEDDINYYIEMAPHGLPGMDLFDYIELR
ANMDEAECRSIFVQVANAIHFLHAKALVVHRDIKDENVILDGEGNIKLIDFGSAAYIKSGPFDVFVGTIDYAAPE
VLAGKPYGGKEQDVWALGILLYTIIYKENPFYSIDEIMDRDLRVPFTISDESIDLVRCMLNRDVEARYNTHQVLS
HAWCKAVE*
Coding >OphauB2|7926
ATGCTGCCCTTGCATCACGGGCCATTAGACAAAACCGCCGACAACAGCTCCAGCCAAGATGAAGCAGAGGAAAGC
AGAGGCCGCGAATCCCTCGTGCCGCCACTGTCACTGCCCAAGAACCGTAGCACGGGCAATTTGGCTCTCACCACG
ACGCACGACGCCGTGACGGATCGGCCTCGCTATCGCATGTCATTTGACGCGCCCTCCATGTCTGCCCTGGATCAT
GACGTTTTGACCAGGTCTCCTCACATGGTTGACCACGAGCATGGCCCCGGTTTGTCGGGCTTGCGCCGCATCCGT
CAGCAGCATCCTCCCTCGCGCCATCCTACTCTGCCCAGCTCAGCCGTTTCCTCGCGTAGTCACTCTGTCGCAGCG
CTCTCTCGCTCCACCTCGATGAGCGGCGTCGCCACCACCTCGGGCTCCCAAGGTCAGTCTGGAGGGCCTGCGTCT
CCAAGCTTTTCCGAGGATCTCTCCCGATTCCCCTCGGAGTCTCTACACTCCTTCTCCTTTGCCCACCAATCGGAA
GAGTTTATCCACAATCGCCAGAGCGTCCTCAAACGCTCCATGGACTTTATTAAAGATCGTCTGGGCTGGTCCATG
AGTTCGACACAGGCCGGGCTCGTCAGCGCTCAGGCCAGAGTCACGGGAGATGCTGATACTCAGAACATGCTCGAG
TTGCTTGCTCGAGCCAACATCATAGGAGCAGGCAACTTGCCCAACGCTGATGCATTCAAGGCTACTGGGCCTCTG
ACTGGGCCTGCCCAAGTGACGGGCGAAAACGTGTTTGACGTACAATTTACCACTCAGCCGTTTGGGGTCGACGCA
GCTGCGCCAGATGGCACGTCGCCCGCGGCGTTGAATACAGTCAAAGCTCGGGTTGATGATGATCAAGTCGAGTCA
CCGACAGCGCCGGCCAAGCAATGGCCACCTGGCCACGACTCTGAGCAGTCGAGTAGGACGCCGACAAACGAGAGC
AGCACGACTGCTCAGACGTCGCCTCCCGTTTCCAGACCAATCAGTCTCAAGCGCACCATGACGGACACGCTGAGC
ATCACAGTACAGGACAAGCTCATTGACACCATGACGCGGCCCTTTTTGGCGTCGCAGCAGATTGTCGAGGAGCCA
GCAAACACGTCACCCATGATGGCGCATAGCGTGCCTGCATCCAAGGCGCTTCCCAGTGCTCTCGGCCCCGCTGTG
CACGGGCATACGAATAGGTGGGTTCCTGCTGCCCAGGCAATCTTCACCACGGAGGCCAAGCCGCCCTGGACCATT
ATTGCAGCCAACGATCTGGCCTGTCTTGTCTTTGGCGTGACCAAGGCCGAGGTGCGCAAGATGGGAATTCTAGAA
GTGGTGCAGGAAGAGAGGCGGGCATGGCTCGAGCGCAAGCTCTTGCGGGGCGACGAGGAGGACGAAAGGCAACAT
GGCGCACCGGGCGGCAAGTCGACGACTCCGGCTGCCTCGGCTGCGTCGACGCTGCTCGGAGGGCGAACGGGAATC
ACGGCTCAGTTGCTCAGCAAGCCCAACTCGAGGTGCCAAGCGCAACGGGGGGCCATGACGAGGAGAGCGCAGACA
ATACACAGCGGGGATCCCAATCCGCCCAAGACGCGAGGCTCTGGGCAGCATCGCAGCAATCTTTCTCGGGGCGTC
TTGCTCTGTGGCGACGTGGTGCCCATTCAGAAGCGTAATGGTGCTACTGGATCGGCCAGCCTCTGGGTCAAGGAG
AAGCGCGTGGGCCTAATATGGGTGCTGGAGGAAATCCACGAGGACGTGGCATATGTGCAGCTGGACGACGACGGC
ATCATCAAGGGCATATCAGGGGCGGCAGAGCCTATATGGGGATCGTCAATCTGGACTCGCCAGGGCCTGGACGTG
GCAAGGCTGATTCCTCGGATCCCGAGGCAGGGAATCGACCCGACTGTTGGCGAGATTGACTTTGCACAGGTGACG
CGGCAAAGATACTTTGCTTGTCCCAACTCAGGCAGAGTCAATATTCCATGCCTGGTGGAGCAAACACGCGGCAAG
GTCGAGCTGCGTGTTTCCACGTTTCCGCACATGGCTGGCATCATTGTTGTCGACCCCGACTCTCTCAAGATTCGA
AGCTCCAACTCTGTCTTTTGCGGAGCGCTCTTTGGCTATGACAAGGCCGACGGCCTGTCGATTGAGTCGCTAATA
CCCGACTTTGGCAAGATTATCCACGTCATGACGGAGGAAGACGGCCTTCAGATCATGGACGGCATGGTGGTTCCC
GAGCAGCGCTTCCGCCGAGCATGGGCCTTTTTTGCGCTCAAGGAGCACCGGTCCAACGCGGCCGCTGCGTTTCTG
CAGCCAGACGGGCTGCCGGCCAAGCACCGCGACGGCTCGGAGCTCAAGATTGACGTGCAGATGCGAGTGGTGGAG
AGCGAGAAGCAGCCGAGCATTGTGGAGGAGACGGTGGTGGAGGGCAGCGACGAGGACGAGGCCAGCAGCCCCCCC
GACACCTTTACCATTCACCGCAAGGAAATGGTGTTTGCCCTGTGGATCACGTACTCGCGCCACCTGCATGCCCAC
GCCCCCCTTGATGTCGACTCGCCCGCCGGCTCTGGCACCTTGACGCCGCTGCACCAGCCCTCTCCGGGCCAGACG
CCCGCCGTGCACTCGCCCATGGACATGACGTCGGACGACGACGAGACCCGAAAAGACTTGGCCGCGTCGCCCTCG
CCCCTCTCGGAGCTGGCCCAGGGAGCGCCTCTGGCTGCGCCTGCCAAGCCCTCCAACAATCCCTTGTCCAAGGCG
GCCGACAAGGCTCCGGCGGCCAAATCGCTGGAGCCGGCTCCAAAGACTAGCATACAAGATTATACCATTGTCGAA
GACATGGGCCAAGGCGCCTATGGCCAAGTCAAGCTGGCCCGCCACAAGCAGTCGGGCAACAGGATTGTTCTCAAG
TATGTCACCAAGCGCCGCATTCTCGTTGACACGTGGACCCGAGACCGCAAACTCGGCACCGTTCCCCTCGAGATT
CACGTGCTCGACTACCTGCGCCGCCCCGAGTTTCGCCATCCCAACATTGTCGAAATGCAGGGCTTCTTTGAGGAC
GACATCAATTACTACATTGAGATGGCGCCGCACGGGCTTCCCGGCATGGACCTCTTTGACTACATTGAGCTGCGG
GCCAACATGGACGAGGCAGAGTGCCGCAGCATCTTTGTTCAAGTGGCCAATGCCATTCACTTTTTGCATGCCAAG
GCGCTCGTGGTGCACCGCGACATCAAGGACGAAAACGTGATTCTTGATGGCGAGGGAAACATTAAGCTTATTGAT
TTTGGAAGCGCTGCCTACATCAAGAGCGGCCCCTTTGACGTGTTTGTCGGCACCATAGATTATGCTGCTCCAGAA
GTCCTGGCCGGCAAGCCCTATGGCGGCAAGGAGCAAGACGTGTGGGCGCTCGGCATCCTGCTCTACACCATCATC
TACAAGGAGAACCCTTTTTACAGCATCGACGAAATCATGGACCGAGACTTGCGCGTGCCCTTTACCATTAGCGAC
GAGAGCATCGATCTGGTGCGGTGCATGCTCAACCGTGATGTCGAGGCGCGCTACAATACCCACCAGGTGCTCAGC
CACGCCTGGTGCAAGGCAGTTGAATAG
Transcript >OphauB2|7926
ATGCTGCCCTTGCATCACGGGCCATTAGACAAAACCGCCGACAACAGCTCCAGCCAAGATGAAGCAGAGGAAAGC
AGAGGCCGCGAATCCCTCGTGCCGCCACTGTCACTGCCCAAGAACCGTAGCACGGGCAATTTGGCTCTCACCACG
ACGCACGACGCCGTGACGGATCGGCCTCGCTATCGCATGTCATTTGACGCGCCCTCCATGTCTGCCCTGGATCAT
GACGTTTTGACCAGGTCTCCTCACATGGTTGACCACGAGCATGGCCCCGGTTTGTCGGGCTTGCGCCGCATCCGT
CAGCAGCATCCTCCCTCGCGCCATCCTACTCTGCCCAGCTCAGCCGTTTCCTCGCGTAGTCACTCTGTCGCAGCG
CTCTCTCGCTCCACCTCGATGAGCGGCGTCGCCACCACCTCGGGCTCCCAAGGTCAGTCTGGAGGGCCTGCGTCT
CCAAGCTTTTCCGAGGATCTCTCCCGATTCCCCTCGGAGTCTCTACACTCCTTCTCCTTTGCCCACCAATCGGAA
GAGTTTATCCACAATCGCCAGAGCGTCCTCAAACGCTCCATGGACTTTATTAAAGATCGTCTGGGCTGGTCCATG
AGTTCGACACAGGCCGGGCTCGTCAGCGCTCAGGCCAGAGTCACGGGAGATGCTGATACTCAGAACATGCTCGAG
TTGCTTGCTCGAGCCAACATCATAGGAGCAGGCAACTTGCCCAACGCTGATGCATTCAAGGCTACTGGGCCTCTG
ACTGGGCCTGCCCAAGTGACGGGCGAAAACGTGTTTGACGTACAATTTACCACTCAGCCGTTTGGGGTCGACGCA
GCTGCGCCAGATGGCACGTCGCCCGCGGCGTTGAATACAGTCAAAGCTCGGGTTGATGATGATCAAGTCGAGTCA
CCGACAGCGCCGGCCAAGCAATGGCCACCTGGCCACGACTCTGAGCAGTCGAGTAGGACGCCGACAAACGAGAGC
AGCACGACTGCTCAGACGTCGCCTCCCGTTTCCAGACCAATCAGTCTCAAGCGCACCATGACGGACACGCTGAGC
ATCACAGTACAGGACAAGCTCATTGACACCATGACGCGGCCCTTTTTGGCGTCGCAGCAGATTGTCGAGGAGCCA
GCAAACACGTCACCCATGATGGCGCATAGCGTGCCTGCATCCAAGGCGCTTCCCAGTGCTCTCGGCCCCGCTGTG
CACGGGCATACGAATAGGTGGGTTCCTGCTGCCCAGGCAATCTTCACCACGGAGGCCAAGCCGCCCTGGACCATT
ATTGCAGCCAACGATCTGGCCTGTCTTGTCTTTGGCGTGACCAAGGCCGAGGTGCGCAAGATGGGAATTCTAGAA
GTGGTGCAGGAAGAGAGGCGGGCATGGCTCGAGCGCAAGCTCTTGCGGGGCGACGAGGAGGACGAAAGGCAACAT
GGCGCACCGGGCGGCAAGTCGACGACTCCGGCTGCCTCGGCTGCGTCGACGCTGCTCGGAGGGCGAACGGGAATC
ACGGCTCAGTTGCTCAGCAAGCCCAACTCGAGGTGCCAAGCGCAACGGGGGGCCATGACGAGGAGAGCGCAGACA
ATACACAGCGGGGATCCCAATCCGCCCAAGACGCGAGGCTCTGGGCAGCATCGCAGCAATCTTTCTCGGGGCGTC
TTGCTCTGTGGCGACGTGGTGCCCATTCAGAAGCGTAATGGTGCTACTGGATCGGCCAGCCTCTGGGTCAAGGAG
AAGCGCGTGGGCCTAATATGGGTGCTGGAGGAAATCCACGAGGACGTGGCATATGTGCAGCTGGACGACGACGGC
ATCATCAAGGGCATATCAGGGGCGGCAGAGCCTATATGGGGATCGTCAATCTGGACTCGCCAGGGCCTGGACGTG
GCAAGGCTGATTCCTCGGATCCCGAGGCAGGGAATCGACCCGACTGTTGGCGAGATTGACTTTGCACAGGTGACG
CGGCAAAGATACTTTGCTTGTCCCAACTCAGGCAGAGTCAATATTCCATGCCTGGTGGAGCAAACACGCGGCAAG
GTCGAGCTGCGTGTTTCCACGTTTCCGCACATGGCTGGCATCATTGTTGTCGACCCCGACTCTCTCAAGATTCGA
AGCTCCAACTCTGTCTTTTGCGGAGCGCTCTTTGGCTATGACAAGGCCGACGGCCTGTCGATTGAGTCGCTAATA
CCCGACTTTGGCAAGATTATCCACGTCATGACGGAGGAAGACGGCCTTCAGATCATGGACGGCATGGTGGTTCCC
GAGCAGCGCTTCCGCCGAGCATGGGCCTTTTTTGCGCTCAAGGAGCACCGGTCCAACGCGGCCGCTGCGTTTCTG
CAGCCAGACGGGCTGCCGGCCAAGCACCGCGACGGCTCGGAGCTCAAGATTGACGTGCAGATGCGAGTGGTGGAG
AGCGAGAAGCAGCCGAGCATTGTGGAGGAGACGGTGGTGGAGGGCAGCGACGAGGACGAGGCCAGCAGCCCCCCC
GACACCTTTACCATTCACCGCAAGGAAATGGTGTTTGCCCTGTGGATCACGTACTCGCGCCACCTGCATGCCCAC
GCCCCCCTTGATGTCGACTCGCCCGCCGGCTCTGGCACCTTGACGCCGCTGCACCAGCCCTCTCCGGGCCAGACG
CCCGCCGTGCACTCGCCCATGGACATGACGTCGGACGACGACGAGACCCGAAAAGACTTGGCCGCGTCGCCCTCG
CCCCTCTCGGAGCTGGCCCAGGGAGCGCCTCTGGCTGCGCCTGCCAAGCCCTCCAACAATCCCTTGTCCAAGGCG
GCCGACAAGGCTCCGGCGGCCAAATCGCTGGAGCCGGCTCCAAAGACTAGCATACAAGATTATACCATTGTCGAA
GACATGGGCCAAGGCGCCTATGGCCAAGTCAAGCTGGCCCGCCACAAGCAGTCGGGCAACAGGATTGTTCTCAAG
TATGTCACCAAGCGCCGCATTCTCGTTGACACGTGGACCCGAGACCGCAAACTCGGCACCGTTCCCCTCGAGATT
CACGTGCTCGACTACCTGCGCCGCCCCGAGTTTCGCCATCCCAACATTGTCGAAATGCAGGGCTTCTTTGAGGAC
GACATCAATTACTACATTGAGATGGCGCCGCACGGGCTTCCCGGCATGGACCTCTTTGACTACATTGAGCTGCGG
GCCAACATGGACGAGGCAGAGTGCCGCAGCATCTTTGTTCAAGTGGCCAATGCCATTCACTTTTTGCATGCCAAG
GCGCTCGTGGTGCACCGCGACATCAAGGACGAAAACGTGATTCTTGATGGCGAGGGAAACATTAAGCTTATTGAT
TTTGGAAGCGCTGCCTACATCAAGAGCGGCCCCTTTGACGTGTTTGTCGGCACCATAGATTATGCTGCTCCAGAA
GTCCTGGCCGGCAAGCCCTATGGCGGCAAGGAGCAAGACGTGTGGGCGCTCGGCATCCTGCTCTACACCATCATC
TACAAGGAGAACCCTTTTTACAGCATCGACGAAATCATGGACCGAGACTTGCGCGTGCCCTTTACCATTAGCGAC
GAGAGCATCGATCTGGTGCGGTGCATGCTCAACCGTGATGTCGAGGCGCGCTACAATACCCACCAGGTGCTCAGC
CACGCCTGGTGCAAGGCAGTTGAATAG
Gene >OphauB2|7926
ATGCTGCCCTTGCATCACGGGCCATTAGACAAAAGTCAGTAACGCACGCCAGCATGACGCTGTCTATCTCCATGT
CGTCGTCGTCGTCGTGGCCGTGTCCCTGGCGCTGACTGGCCTGCAGCCGCCGACAACAGCTCCAGCCAAGATGAA
GCAGAGGAAAGCAGAGGCCGCGAATCCCTCGTGCCGCCACTGTCACTGCCCAAGAACCGTAGCACGGGCAATTTG
GCTCTCACCACGACGCACGACGCCGTGACGGATCGGCCTCGCTATCGCATGTCATTTGACGCGCCCTCCATGTCT
GCCCTGGATCATGACGTTTTGACCAGGTAATATGTCTCGACCTGCCATCAAGTTCCTTGCCACCAAGTGCTCACC
CATTCTCTGTCCCTGCAGGTCTCCTCACATGGTTGACCACGAGCATGGCCCCGGTTTGTCGGGCTTGCGCCGCAT
CCGTCAGCAGCATCCTCCCTCGCGCCATCCTACTCTGCCCAGCTCAGCCGTTTCCTCGCGTAGTCACTCTGTCGC
AGCGCTCTCTCGCTCCACCTCGATGAGCGGCGTCGCCACCACCTCGGGCTCCCAAGGTCAGTCTGGAGGGCCTGC
GTCTCCAAGCTTTTCCGAGGATCTCTCCCGATTCCCCTCGGAGTCTCTACACTCCTTCTCCTTTGCCCACCAATC
GGAAGAGTTTATCCACAATCGCCAGAGCGTCCTCAAACGCTCCATGGACTTTATTAAAGATCGTCTGGGCTGGTC
CATGAGTTCGACACAGGCCGGGCTCGTCAGCGCTCAGGCCAGAGTCACGGGAGATGCTGATACTCAGAACATGCT
CGAGTTGCTTGCTCGAGCCAACATCATAGGAGCAGGCAACTTGCCCAACGCTGATGCATTCAAGGCTACTGGGCC
TCTGACTGGGCCTGCCCAAGTGACGGGCGAAAACGTGTTTGACGTACAATTTACCACTCAGCCGTTTGGGGTCGA
CGCAGCTGCGCCAGATGGCACGTCGCCCGCGGCGTTGAATACAGTCAAAGCTCGGGTTGATGATGATCAAGTCGA
GTCACCGACAGCGCCGGCCAAGCAATGGCCACCTGGCCACGACTCTGAGCAGTCGAGTAGGACGCCGACAAACGA
GAGCAGCACGACTGCTCAGACGTCGCCTCCCGTTTCCAGACCAATCAGTCTCAAGCGCACCATGACGGACACGCT
GAGCATCACAGTACAGGACAAGCTCATTGACACCATGACGCGGCCCTTTTTGGCGTCGCAGCAGATTGTCGAGGA
GCCAGCAAACACGTCACCCATGATGGCGCATAGCGTGCCTGCATCCAAGGCGCTTCCCAGTGCTCTCGGCCCCGC
TGTGCACGGGCATACGAATAGGTGGGTTCCTGCTGCCCAGGCAATCTTCACCACGGAGGCCAAGCCGCCCTGGAC
CATTATTGCAGCCAACGATCTGGCCTGTCTTGTCTTTGGCGTGACCAAGGCCGAGGTGCGCAAGATGGGAATTCT
AGAAGTGGTGCAGGAAGAGAGGCGGGCATGGCTCGAGCGCAAGCTCTTGCGGGGCGACGAGGAGGACGAAAGGCA
ACATGGCGCACCGGGCGGCAAGTCGACGACTCCGGCTGCCTCGGCTGCGTCGACGCTGCTCGGAGGGCGAACGGG
AATCACGGCTCAGTTGCTCAGCAAGCCCAACTCGAGGTGCCAAGCGCAACGGGGGGCCATGACGAGGAGAGCGCA
GACAATACACAGCGGGGATCCCAATCCGCCCAAGACGCGAGGCTCTGGGCAGCATCGCAGCAATCTTTCTCGGGG
CGTCTTGCTCTGTGGCGACGTGGTGCCCATTCAGAAGCGTAATGGTGCTACTGGATCGGCCAGCCTCTGGGTCAA
GGAGAAGCGCGTGGGCCTAATATGGGTGCTGGAGGAAATCCACGAGGACGTGGCATATGTGCAGCTGGACGACGA
CGGCATCATCAAGGGCATATCAGGGGCGGCAGAGCCTATATGGGGATCGTCAATCTGGACTCGCCAGGGCCTGGA
CGTGGCAAGGCTGATTCCTCGGATCCCGAGGCAGGGAATCGACCCGACTGTTGGCGAGATTGACTTTGCACAGGT
GACGCGGCAAAGATACTTTGCTTGTCCCAACTCAGGCAGAGTCAATATTCCATGCCTGGTGGAGCAAACACGCGG
CAAGGTCGAGCTGCGTGTTTCCACGTTTCCGCACATGGCTGGCATCATTGTTGTCGACCCCGACTCTCTCAAGAT
TCGAAGCTCCAACTCTGTCTTTTGCGGAGCGCTCTTTGGCTATGACAAGGCCGACGGCCTGTCGATTGAGTCGCT
AATACCCGACTTTGGCAAGATTATCCACGTCATGACGGAGGAAGACGGCCTTCAGATCATGGACGGCATGGTGGT
TCCCGAGCAGCGCTTCCGCCGAGCATGGGCCTTTTTTGCGCTCAAGGAGCACCGGTCCAACGCGGCCGCTGCGTT
TCTGCAGCCAGACGGGCTGCCGGCCAAGCACCGCGACGGCTCGGAGCTCAAGATTGACGTGCAGATGCGAGTGGT
GGAGAGCGAGAAGCAGCCGAGCATTGTGGAGGAGACGGTGGTGGAGGGCAGCGACGAGGACGAGGCCAGCAGCCC
CCCCGACACCTTTACCATTCACCGCAAGGAAATGGTGTTTGCCCTGTGGATCACGTACTCGCGCCACCTGCATGC
CCACGCCCCCCTTGATGTCGACTCGCCCGCCGGCTCTGGCACCTTGACGCCGCTGCACCAGCCCTCTCCGGGCCA
GACGCCCGCCGTGCACTCGCCCATGGACATGACGTCGGACGACGACGAGACCCGAAAAGACTTGGCCGCGTCGCC
CTCGCCCCTCTCGGAGCTGGCCCAGGGAGCGCCTCTGGCTGCGCCTGCCAAGCCCTCCAACAATCCCTTGTCCAA
GGCGGCCGACAAGGCTCCGGCGGCCAAATCGCTGGAGCCGGCTCCAAAGACTAGCATACAAGATTATACCATTGT
CGAAGACATGGGCCAAGGCGCCTATGGCCAAGTCAAGCTGGCCCGCCACAAGCAGTCGGGCAACAGGATTGTTCT
CAAGTATGTCACCAAGCGCCGCATTCTCGTTGACACGTGGACCCGAGACCGCAAACTCGGCACCGTTCCCCTCGA
GATTCACGTGCTCGACTACCTGCGCCGCCCCGAGTTTCGCCATCCCAACATTGTCGAAATGCAGGGCTTCTTTGA
GGACGACATCAATTACTACATTGAGATGGCGCCGCACGGGCTTCCCGGCATGGACCTCTTTGACTACATTGAGCT
GCGGGCCAACATGGACGAGGCAGAGTGCCGCAGCATCTTTGTTCAAGTGGCCAATGCCATTCACTTTTTGCATGC
CAAGGCGCTCGTGGTGCACCGCGACATCAAGGACGAAAACGTGATTCTTGATGGCGAGGGAAACATTAAGCTTAT
TGATTTTGGAAGCGCTGCCTACATCAAGAGCGGCCCCTTTGACGTGTTTGTCGGCACCATAGGTGGGTGACTGTT
AACACGGCGGCCTAAGATTTGCTCCCCTGGCTGACTCCATCATGGCTCGTATACAGATTATGCTGCTCCAGAAGT
CCTGGCCGGCAAGCCCTATGGCGGCAAGGAGCAAGACGTGTGGGCGCTCGGCATCCTGCTCTACACCATCATCTA
CAAGGAGAACCCTTTTTACAGCATCGACGAAATCATGGACCGAGACTTGCGCGTGCCCTTTACCATTAGCGACGA
GAGCATCGATCTGGTGCGGTGCATGCTCAACCGTGATGTCGAGGCGCGCTACAATACCCACCAGGTGCTCAGCCA
CGCCTGGTGCAAGGCAGTTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail