Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7920
Gene name
LocationContig_90:8547..10782
Strand-
Gene length (bp)2235
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00782 DSPc Dual specificity phosphatase, catalytic domain 4.8E-22 331 496

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13453|PMP1_SCHPO Tyrosine-protein phosphatase pmp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp1 PE=3 SV=1 318 500 4.0E-27
sp|P38590|MSG5_YEAST Tyrosine-protein phosphatase MSG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSG5 PE=1 SV=2 311 500 7.0E-26
sp|Q5APU2|CPP1_CANAL Dual specificity protein tyrosine phosphatase CCP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPP1 PE=1 SV=1 317 503 2.0E-20
sp|P43078|PTPX_CANAW Probable tyrosine-protein phosphatase OS=Candida albicans (strain WO-1) GN=CPP1 PE=3 SV=2 317 503 2.0E-20
sp|P40479|SDP1_YEAST Dual-specificity protein phosphatase SDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDP1 PE=1 SV=1 318 510 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13453|PMP1_SCHPO Tyrosine-protein phosphatase pmp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmp1 PE=3 SV=1 318 500 4.0E-27
sp|P38590|MSG5_YEAST Tyrosine-protein phosphatase MSG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSG5 PE=1 SV=2 311 500 7.0E-26
sp|Q5APU2|CPP1_CANAL Dual specificity protein tyrosine phosphatase CCP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPP1 PE=1 SV=1 317 503 2.0E-20
sp|P43078|PTPX_CANAW Probable tyrosine-protein phosphatase OS=Candida albicans (strain WO-1) GN=CPP1 PE=3 SV=2 317 503 2.0E-20
sp|P40479|SDP1_YEAST Dual-specificity protein phosphatase SDP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDP1 PE=1 SV=1 318 510 2.0E-19
sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 436 504 7.0E-09
sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 436 504 8.0E-09
sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 436 504 9.0E-09
sp|Q99956|DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens GN=DUSP9 PE=1 SV=1 427 498 2.0E-08
sp|O55737|123R_IIV6 Putative tyrosine phosphatase 123R OS=Invertebrate iridescent virus 6 GN=IIV6-123R PE=3 SV=1 407 499 5.0E-08
sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 439 509 2.0E-07
sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 439 499 2.0E-07
sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 439 509 2.0E-07
sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 439 509 2.0E-07
sp|Q63340|DUS7_RAT Dual specificity protein phosphatase 7 (Fragment) OS=Rattus norvegicus GN=Dusp7 PE=2 SV=1 428 498 3.0E-07
sp|O54838|DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus GN=Dusp5 PE=2 SV=1 407 553 3.0E-07
sp|Q16690|DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens GN=DUSP5 PE=1 SV=2 407 557 3.0E-07
sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 428 499 5.0E-07
sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 428 499 5.0E-07
sp|Q9BY84|DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens GN=DUSP16 PE=1 SV=1 418 524 8.0E-07
sp|Q556Y8|DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum GN=DDB_G0273199 PE=3 SV=1 425 499 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0016311 dephosphorylation Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0006793 phosphorus metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2320
Ophiocordyceps australis map64 (Brazil) OphauB2|7920 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06500
Ophiocordyceps camponoti-rufipedis Ophun1|5056
Ophiocordyceps kimflemingae Ophio5|5150
Ophiocordyceps subramaniannii Hirsu2|10600

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7920
MPSAAARRMCEDQIPSFMSVFHLDADTMADRETVTLVQPDLVQVEAKAPPQQSVLTAACSDAARKHNDSDLAQVS
ESSDSSPTTTLSTTDSSPLSDPSPSSSPDSPTKLIPLNKYPTTTFASRTSHGNMLSIPEAGTLERPMTSPSPRRP
RNTKGLSIQPPGTLVDSSRTPSTTEPSSPSFIKPRIPAMRRKPSQPSLKTGTSDLIAKSSLEVPQSPAMAPILQR
RALKHSMSSPHMMSGLKSCSFGPANGMTFPKVLERNESGLSEMLRPMKSGVKTEFDTTSKQEASPIKTQLASRGD
YEPSNESAQNEDHKTPGYPYGPVAIYGNNVFLYLEPTAEEASRYDVVINVAREVPNPFEAAEQKTHASGGDQVSA
MSLASAPEYLLCDSKPKDGPRGSMTCLHVPEYIHMPWDHNTDIAPDLMRLCEIIENRTTEGKKVLIHCQQGASRS
ASLIIAYGLYQRPELSVNDAYYAAQAKSRWISPNMKLMYSLQDFQKELSKKRLPPTTAYRPRTGRSPTKHRLTLS
ADAADIATTEPHTAPLPGNAHEASVNRTMRSPSRLRGSSTPAAQPISPGPASAPLSCPWRDFVSKEDDMPNAESS
SDESLQHFNTGTEAVDPLKASAKRIAKQAPEAPVSLLPMVTSPMERKRTLAPSCTDEALMSPRAETMINNPLHTM
SQVAGMRFAEAPPTPTGGLFSPREPTFPRDPFSFFGRVSAFGRPPQVADPRSPPTKGEAPIYRSIDDIL*
Coding >OphauB2|7920
ATGCCCTCTGCCGCAGCTCGCCGCATGTGCGAAGACCAGATACCTTCCTTCATGTCCGTCTTTCATCTCGACGCA
GACACCATGGCCGACCGAGAAACCGTCACTCTGGTCCAGCCCGACTTGGTCCAAGTCGAAGCAAAAGCACCACCC
CAACAGTCTGTACTGACCGCGGCCTGCTCGGATGCCGCTCGCAAACACAACGACAGTGATTTGGCCCAAGTGTCT
GAATCAAGCGACTCTTCACCAACCACGACTCTCTCCACCACCGACTCTTCTCCGCTTTCTGACCCTTCTCCTTCA
TCATCGCCCGACTCTCCGACAAAGTTAATACCACTCAACAAGTATCCCACGACGACGTTTGCCTCGCGCACTAGT
CACGGCAACATGCTCAGCATTCCAGAGGCAGGCACACTGGAGCGTCCCATGACGTCTCCCTCGCCTCGCCGACCT
CGCAACACCAAAGGCTTGTCCATTCAGCCTCCAGGGACATTGGTTGACTCATCTCGGACTCCTAGCACCACGGAG
CCGTCTTCTCCCTCCTTTATCAAGCCTCGAATTCCCGCCATGAGACGCAAGCCAAGCCAACCGAGTCTCAAAACG
GGTACCTCGGACTTGATCGCCAAGTCGTCTCTCGAGGTTCCACAGTCTCCGGCCATGGCCCCAATATTGCAACGC
CGCGCTTTGAAGCATTCCATGTCGTCGCCACACATGATGTCGGGCCTCAAGTCGTGCTCATTTGGTCCTGCAAAC
GGAATGACGTTTCCCAAAGTCTTGGAACGCAATGAGTCGGGTTTATCGGAAATGCTTCGTCCCATGAAGTCGGGC
GTCAAGACCGAGTTTGACACGACAAGCAAACAAGAAGCCTCGCCCATCAAGACCCAGCTTGCAAGTCGAGGTGAC
TACGAGCCCTCCAACGAGAGTGCACAAAACGAAGACCACAAAACCCCAGGCTATCCTTATGGACCAGTCGCCATC
TACGGCAACAATGTCTTCTTGTATCTTGAGCCAACAGCTGAGGAGGCATCTCGGTATGACGTTGTTATTAATGTG
GCGCGTGAAGTGCCGAACCCGTTTGAAGCCGCTGAGCAAAAGACCCATGCTTCCGGCGGCGACCAAGTATCCGCA
ATGAGCTTGGCCTCTGCGCCCGAGTACCTACTCTGCGACAGTAAGCCCAAGGATGGGCCAAGAGGAAGCATGACT
TGTCTCCATGTGCCCGAATATATCCACATGCCTTGGGACCACAACACCGACATAGCTCCCGACTTGATGCGCCTT
TGCGAGATTATTGAAAACAGGACCACTGAGGGCAAAAAGGTGCTCATTCACTGCCAGCAAGGGGCCAGTCGGTCG
GCCAGCCTCATTATTGCCTATGGCTTGTATCAACGGCCGGAACTGAGTGTCAACGATGCCTACTATGCGGCCCAG
GCCAAGAGTCGCTGGATCAGCCCAAACATGAAGCTCATGTACTCGCTGCAGGACTTTCAAAAGGAACTGTCCAAG
AAGCGTCTTCCGCCTACAACGGCCTACCGCCCCAGGACTGGCCGCAGCCCAACCAAGCACAGACTCACCCTGTCT
GCTGACGCAGCCGATATAGCGACAACCGAGCCTCACACTGCGCCCTTGCCTGGCAATGCCCACGAAGCAAGTGTC
AACAGGACAATGCGCAGTCCTTCGCGATTACGCGGTAGCTCGACGCCAGCAGCTCAGCCAATCTCACCTGGCCCT
GCCTCGGCACCGCTGTCGTGCCCGTGGAGGGATTTTGTGAGCAAGGAAGACGACATGCCAAACGCCGAATCATCT
TCAGATGAATCACTGCAGCACTTCAATACTGGGACTGAGGCTGTCGACCCGCTCAAGGCCTCAGCCAAGAGAATA
GCCAAGCAGGCACCCGAGGCCCCAGTGTCTTTGTTACCCATGGTAACCTCTCCGATGGAGCGCAAGAGAACTTTG
GCTCCCAGCTGCACTGACGAGGCGCTCATGTCACCGCGTGCCGAAACCATGATAAACAACCCTCTTCACACCATG
TCCCAGGTTGCAGGCATGAGATTTGCTGAAGCCCCTCCCACACCAACTGGAGGGCTATTTTCGCCCCGCGAGCCG
ACGTTTCCGCGGGATCCCTTTTCCTTTTTTGGTCGAGTCTCGGCTTTTGGGCGGCCGCCTCAGGTGGCAGACCCA
AGAAGTCCGCCGACCAAGGGCGAGGCGCCCATATACCGCTCCATCGACGACATTTTATGA
Transcript >OphauB2|7920
ATGCCCTCTGCCGCAGCTCGCCGCATGTGCGAAGACCAGATACCTTCCTTCATGTCCGTCTTTCATCTCGACGCA
GACACCATGGCCGACCGAGAAACCGTCACTCTGGTCCAGCCCGACTTGGTCCAAGTCGAAGCAAAAGCACCACCC
CAACAGTCTGTACTGACCGCGGCCTGCTCGGATGCCGCTCGCAAACACAACGACAGTGATTTGGCCCAAGTGTCT
GAATCAAGCGACTCTTCACCAACCACGACTCTCTCCACCACCGACTCTTCTCCGCTTTCTGACCCTTCTCCTTCA
TCATCGCCCGACTCTCCGACAAAGTTAATACCACTCAACAAGTATCCCACGACGACGTTTGCCTCGCGCACTAGT
CACGGCAACATGCTCAGCATTCCAGAGGCAGGCACACTGGAGCGTCCCATGACGTCTCCCTCGCCTCGCCGACCT
CGCAACACCAAAGGCTTGTCCATTCAGCCTCCAGGGACATTGGTTGACTCATCTCGGACTCCTAGCACCACGGAG
CCGTCTTCTCCCTCCTTTATCAAGCCTCGAATTCCCGCCATGAGACGCAAGCCAAGCCAACCGAGTCTCAAAACG
GGTACCTCGGACTTGATCGCCAAGTCGTCTCTCGAGGTTCCACAGTCTCCGGCCATGGCCCCAATATTGCAACGC
CGCGCTTTGAAGCATTCCATGTCGTCGCCACACATGATGTCGGGCCTCAAGTCGTGCTCATTTGGTCCTGCAAAC
GGAATGACGTTTCCCAAAGTCTTGGAACGCAATGAGTCGGGTTTATCGGAAATGCTTCGTCCCATGAAGTCGGGC
GTCAAGACCGAGTTTGACACGACAAGCAAACAAGAAGCCTCGCCCATCAAGACCCAGCTTGCAAGTCGAGGTGAC
TACGAGCCCTCCAACGAGAGTGCACAAAACGAAGACCACAAAACCCCAGGCTATCCTTATGGACCAGTCGCCATC
TACGGCAACAATGTCTTCTTGTATCTTGAGCCAACAGCTGAGGAGGCATCTCGGTATGACGTTGTTATTAATGTG
GCGCGTGAAGTGCCGAACCCGTTTGAAGCCGCTGAGCAAAAGACCCATGCTTCCGGCGGCGACCAAGTATCCGCA
ATGAGCTTGGCCTCTGCGCCCGAGTACCTACTCTGCGACAGTAAGCCCAAGGATGGGCCAAGAGGAAGCATGACT
TGTCTCCATGTGCCCGAATATATCCACATGCCTTGGGACCACAACACCGACATAGCTCCCGACTTGATGCGCCTT
TGCGAGATTATTGAAAACAGGACCACTGAGGGCAAAAAGGTGCTCATTCACTGCCAGCAAGGGGCCAGTCGGTCG
GCCAGCCTCATTATTGCCTATGGCTTGTATCAACGGCCGGAACTGAGTGTCAACGATGCCTACTATGCGGCCCAG
GCCAAGAGTCGCTGGATCAGCCCAAACATGAAGCTCATGTACTCGCTGCAGGACTTTCAAAAGGAACTGTCCAAG
AAGCGTCTTCCGCCTACAACGGCCTACCGCCCCAGGACTGGCCGCAGCCCAACCAAGCACAGACTCACCCTGTCT
GCTGACGCAGCCGATATAGCGACAACCGAGCCTCACACTGCGCCCTTGCCTGGCAATGCCCACGAAGCAAGTGTC
AACAGGACAATGCGCAGTCCTTCGCGATTACGCGGTAGCTCGACGCCAGCAGCTCAGCCAATCTCACCTGGCCCT
GCCTCGGCACCGCTGTCGTGCCCGTGGAGGGATTTTGTGAGCAAGGAAGACGACATGCCAAACGCCGAATCATCT
TCAGATGAATCACTGCAGCACTTCAATACTGGGACTGAGGCTGTCGACCCGCTCAAGGCCTCAGCCAAGAGAATA
GCCAAGCAGGCACCCGAGGCCCCAGTGTCTTTGTTACCCATGGTAACCTCTCCGATGGAGCGCAAGAGAACTTTG
GCTCCCAGCTGCACTGACGAGGCGCTCATGTCACCGCGTGCCGAAACCATGATAAACAACCCTCTTCACACCATG
TCCCAGGTTGCAGGCATGAGATTTGCTGAAGCCCCTCCCACACCAACTGGAGGGCTATTTTCGCCCCGCGAGCCG
ACGTTTCCGCGGGATCCCTTTTCCTTTTTTGGTCGAGTCTCGGCTTTTGGGCGGCCGCCTCAGGTGGCAGACCCA
AGAAGTCCGCCGACCAAGGGCGAGGCGCCCATATACCGCTCCATCGACGACATTTTATGA
Gene >OphauB2|7920
ATGCCCTCTGCCGCAGCTCGCCGCATGTGCGAAGACCAGATACCTTCCTTCATGTCCGTCTTTCATCTCGACGCA
GACACCATGGCCGACCGAGAAACCGTCACTCTGGTCCAGCCCGACTTGGTCCAAGTCGAAGCAAAAGCACCACCC
CAACAGTCTGTACTGACCGCGGCCTGCTCGGATGCCGCTCGCAAACACAACGACAGTGATTTGGCCCAAGTGTCT
GAATCAAGCGACTCTTCACCAACCACGACTCTCTCCACCACCGACTCTTCTCCGCTTTCTGACCCTTCTCCTTCA
TCATCGCCCGACTCTCCGACAAAGTTAATACCACTCAACAAGTATCCCACGACGACGTTTGCCTCGCGCACTAGT
CACGGCAACATGCTCAGCATTCCAGAGGCAGGCACACTGGAGCGTCCCATGACGTCTCCCTCGCCTCGCCGACCT
CGCAACACCAAAGGCTTGTCCATTCAGCCTCCAGGGACATTGGTTGACTCATCTCGGACTCCTAGCACCACGGAG
CCGTCTTCTCCCTCCTTTATCAAGCCTCGAATTCCCGCCATGAGACGCAAGCCAAGCCAACCGAGTCTCAAAACG
GGTACCTCGGACTTGATCGCCAAGTCGTCTCTCGAGGTTCCACAGTCTCCGGCCATGGCCCCAATATTGCAACGC
CGCGCTTTGAAGCATTCCATGTCGTCGCCACACATGATGTCGGGCCTCAAGTCGTGCTCATTTGGTCCTGCAAAC
GGAATGACGTTTCCCAAAGTCTTGGAACGCAATGAGTCGGGTTTATCGGAAATGCTTCGTCCCATGAAGTCGGGC
GTCAAGACCGAGTTTGACACGACAAGCAAACAAGAAGCCTCGCCCATCAAGACCCAGCTTGCAAGTCGAGGTGAC
TACGAGCCCTCCAACGAGAGTGCACAAAACGAAGACCACAAAACCCCAGGCTATCCTTATGGACCAGTCGCCATC
TACGGCAACAATGTCTTCTTGTATCTTGAGCCAACAGCTGAGGAGGCATCTCGGTATGACGTTGTTATTAATGTG
GCGCGTGAAGTGCCGAACCCGTTTGAAGCCGCTGAGCAAAAGACCCATGCTTCCGGCGGCGACCAAGTATCCGCA
ATGAGCTTGGCCTCTGCGCCCGAGTACCTACTCTGCGACAGTAAGCCCAAGGATGGGCCAAGAGGAAGCATGACT
TGTCTCCATGTGCCCGAATATATCCACATGCCTTGGGACCACAACACCGACATAGCTCCCGACTTGATGCGCCTT
TGCGAGATTATTGAAAACAGGACCACTGAGGGCAAAAAGGTGCTCATTCACTGCCAGCAAGGGGCCAGTCGGTCG
GCCAGCCTCATTATTGCCTATGGCTTGTATCAACGGCCGGAACTGAGTGTCAACGATGCCTACTATGCGGCCCAG
GCCAAGAGTCGCTGGATCAGCCCAAACATGAAGCTCATGTACTCGCTGCAGGACTTTCAAAAGGAACTGTCCAAG
AAGCGTCTTCCGCCTACAACGGCCTACCGCCCCAGGACTGGCCGCAGCCCAACCAAGCACAGACTCACCCTGTCT
GCTGACGCAGCCGATATAGCGACAACCGAGCCTCACACTGCGCCCTTGCCTGGCAATGCCCACGAAGCAAGTGTC
AACAGGACAATGCGCAGTCCTTCGCGATTACGCGGTAGCTCGACGCCAGCAGCTCAGCCAATCTCACCTGGCCCT
GCCTCGGCACCGCTGTCGTGCCCGTGGAGGGATTTTGTGAGCAAGGAAGACGACATGCCAAACGCCGAATCATCT
TCAGATGAATCACTGCAGCACTTCAATACTGGGACTGAGGCTGTCGACCCGCTCAAGGCCTCAGCCAAGAGAATA
GCCAAGCAGGCACCCGAGGCCCCAGTGTCTTTGTTACCCATGGTAACCTCTCCGATGGAGCGCAAGAGAACTTTG
GCTCCCAGCTGCACTGACGAGGCGCTCATGTCACCGCGTGCCGAAACCATGATAAACAACCCTCTTCACACCATG
TCCCAGGTTGCAGGCATGAGATTTGCTGAAGCCCCTCCCACACCAACTGGAGGGCTATTTTCGCCCCGCGAGCCG
ACGTTTCCGCGGGATCCCTTTTCCTTTTTTGGTCGAGTCTCGGCTTTTGGGCGGCCGCCTCAGGTGGCAGACCCA
AGAAGTCCGCCGACCAAGGGCGAGGCGCCCATATACCGCTCCATCGACGACATTTTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail