Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7910
Gene name
LocationContig_9:277267..278975
Strand-
Gene length (bp)1708
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain 1.5E-77 70 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4PRC2|DCE2_CANLF Glutamate decarboxylase 2 OS=Canis lupus familiaris GN=GAD2 PE=2 SV=1 64 507 8.0E-89
sp|P48321|DCE2_PIG Glutamate decarboxylase 2 OS=Sus scrofa GN=GAD2 PE=2 SV=1 64 507 3.0E-88
sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 64 507 1.0E-87
sp|Q05683|DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus GN=Gad2 PE=1 SV=1 64 507 2.0E-87
sp|P48320|DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus GN=Gad2 PE=1 SV=1 64 507 3.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4PRC2|DCE2_CANLF Glutamate decarboxylase 2 OS=Canis lupus familiaris GN=GAD2 PE=2 SV=1 64 507 8.0E-89
sp|P48321|DCE2_PIG Glutamate decarboxylase 2 OS=Sus scrofa GN=GAD2 PE=2 SV=1 64 507 3.0E-88
sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 64 507 1.0E-87
sp|Q05683|DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus GN=Gad2 PE=1 SV=1 64 507 2.0E-87
sp|P48320|DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus GN=Gad2 PE=1 SV=1 64 507 3.0E-87
sp|A0PA85|DCE1_CANLF Glutamate decarboxylase 1 OS=Canis lupus familiaris GN=GAD1 PE=2 SV=1 64 507 4.0E-86
sp|P14748|DCE1_FELCA Glutamate decarboxylase 1 OS=Felis catus GN=GAD1 PE=2 SV=3 64 507 5.0E-86
sp|Q0VCA1|DCE1_BOVIN Glutamate decarboxylase 1 OS=Bos taurus GN=GAD1 PE=2 SV=1 64 507 1.0E-85
sp|P48319|DCE1_PIG Glutamate decarboxylase 1 OS=Sus scrofa GN=GAD1 PE=2 SV=1 64 507 2.0E-85
sp|P48318|DCE1_MOUSE Glutamate decarboxylase 1 OS=Mus musculus GN=Gad1 PE=1 SV=2 64 507 3.0E-85
sp|P18088|DCE1_RAT Glutamate decarboxylase 1 OS=Rattus norvegicus GN=Gad1 PE=2 SV=1 64 507 4.0E-85
sp|Q5IS68|DCE1_PANTR Glutamate decarboxylase 1 OS=Pan troglodytes GN=GAD1 PE=2 SV=1 64 507 2.0E-84
sp|Q99259|DCE1_HUMAN Glutamate decarboxylase 1 OS=Homo sapiens GN=GAD1 PE=1 SV=1 64 507 3.0E-84
sp|Q5R7S7|DCE1_PONAB Glutamate decarboxylase 1 OS=Pongo abelii GN=GAD1 PE=2 SV=1 64 507 1.0E-83
sp|A6QM00|GADL1_BOVIN Acidic amino acid decarboxylase GADL1 OS=Bos taurus GN=GADL1 PE=2 SV=2 70 507 3.0E-81
sp|Q9Y600|CSAD_HUMAN Cysteine sulfinic acid decarboxylase OS=Homo sapiens GN=CSAD PE=1 SV=2 69 507 4.0E-81
sp|Q80WP8|GADL1_MOUSE Acidic amino acid decarboxylase GADL1 OS=Mus musculus GN=Gadl1 PE=1 SV=3 70 507 1.0E-78
sp|Q9DBE0|CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus GN=Csad PE=1 SV=1 69 490 2.0E-78
sp|Q6ZQY3|GADL1_HUMAN Acidic amino acid decarboxylase GADL1 OS=Homo sapiens GN=GADL1 PE=1 SV=4 70 507 2.0E-78
sp|Q64611|CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus GN=Csad PE=1 SV=1 69 507 1.0E-77
sp|Q28D99|GADL1_XENTR Acidic amino acid decarboxylase GADL1 (Fragment) OS=Xenopus tropicalis GN=gadl1 PE=2 SV=2 64 507 4.0E-76
sp|P20228|DCE_DROME Glutamate decarboxylase OS=Drosophila melanogaster GN=Gad1 PE=2 SV=2 1 507 5.0E-73
sp|Q9Z3R1|RHBB_RHIME L-2,4-diaminobutyrate decarboxylase OS=Rhizobium meliloti (strain 1021) GN=rhbB PE=3 SV=1 81 461 4.0E-38
sp|Q43908|DDC_ACIBA L-2,4-diaminobutyrate decarboxylase OS=Acinetobacter baumannii GN=ddc PE=1 SV=1 71 492 5.0E-35
sp|P23738|DCHS_MOUSE Histidine decarboxylase OS=Mus musculus GN=Hdc PE=1 SV=2 69 423 3.0E-31
sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 69 472 8.0E-31
sp|P16453|DCHS_RAT Histidine decarboxylase OS=Rattus norvegicus GN=Hdc PE=2 SV=2 69 423 2.0E-30
sp|P19113|DCHS_HUMAN Histidine decarboxylase OS=Homo sapiens GN=HDC PE=1 SV=2 69 423 2.0E-30
sp|P71362|DDC_HAEIN L-2,4-diaminobutyrate decarboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ddc PE=1 SV=1 84 466 1.0E-29
sp|Q5EA83|DCHS_BOVIN Histidine decarboxylase OS=Bos taurus GN=HDC PE=2 SV=1 69 423 2.0E-29
sp|P22781|DDC_CAVPO Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus GN=DDC PE=2 SV=1 82 471 2.0E-28
sp|P27718|DDC_BOVIN Aromatic-L-amino-acid decarboxylase OS=Bos taurus GN=DDC PE=2 SV=2 82 472 3.0E-28
sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=1 SV=1 116 472 2.0E-27
sp|Q95ZS2|TDC1_CAEEL Tyrosine decarboxylase OS=Caenorhabditis elegans GN=tdc-1 PE=2 SV=1 64 425 2.0E-27
sp|Q8RY79|TYDC1_ARATH Tyrosine decarboxylase 1 OS=Arabidopsis thaliana GN=ELI5 PE=2 SV=1 30 458 9.0E-27
sp|Q7XHL3|TYDC1_ORYSJ Tyrosine decarboxylase 1 OS=Oryza sativa subsp. japonica GN=Os07g0437500 PE=2 SV=1 30 474 1.0E-26
sp|P20711|DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens GN=DDC PE=1 SV=2 82 465 4.0E-26
sp|P18486|L2AM_DROME Alpha-methyldopa hypersensitive protein OS=Drosophila melanogaster GN=amd PE=2 SV=2 69 507 5.0E-26
sp|Q9M0G4|TYDC2_ARATH Probable tyrosine decarboxylase 2 OS=Arabidopsis thaliana GN=At4g28680 PE=2 SV=1 82 458 1.0E-25
sp|P48861|DDC_MANSE Aromatic-L-amino-acid decarboxylase OS=Manduca sexta GN=Ddc PE=2 SV=1 64 425 1.0E-25
sp|Q05733|DCHS_DROME Histidine decarboxylase OS=Drosophila melanogaster GN=Hdc PE=2 SV=2 82 423 3.0E-25
sp|P17770|DDC_CATRO Aromatic-L-amino-acid decarboxylase OS=Catharanthus roseus GN=TDC PE=2 SV=1 91 453 3.0E-24
sp|P80041|DDC_PIG Aromatic-L-amino-acid decarboxylase OS=Sus scrofa GN=DDC PE=1 SV=2 82 472 3.0E-24
sp|P54771|TYDC5_PAPSO Tyrosine/DOPA decarboxylase 5 OS=Papaver somniferum GN=TYDC5 PE=2 SV=1 82 442 1.0E-23
sp|P54769|TYDC2_PAPSO Tyrosine/DOPA decarboxylase 2 OS=Papaver somniferum GN=TYDC2 PE=2 SV=1 69 459 3.0E-22
sp|Q06085|TYDC1_PETCR Tyrosine decarboxylase 1 (Fragment) OS=Petroselinum crispum GN=TYRDC-1 PE=2 SV=1 82 458 1.0E-21
sp|Q06088|TYDC4_PETCR Tyrosine decarboxylase 4 OS=Petroselinum crispum GN=TYRDC-4 PE=2 SV=1 82 458 4.0E-21
sp|Q06087|TYDC3_PETCR Tyrosine decarboxylase 3 OS=Petroselinum crispum GN=TYRDC-3 PE=2 SV=1 82 458 5.0E-21
sp|Q06086|TYDC2_PETCR Tyrosine decarboxylase 2 OS=Petroselinum crispum GN=TYRDC-2 PE=2 SV=1 82 458 8.0E-21
sp|P54768|TYDC1_PAPSO Tyrosine/DOPA decarboxylase 1 OS=Papaver somniferum GN=TYDC1 PE=2 SV=1 77 456 2.0E-20
sp|P54770|TYDC3_PAPSO Tyrosine/DOPA decarboxylase 3 OS=Papaver somniferum GN=TYDC3 PE=2 SV=2 69 440 6.0E-20
sp|P81893|L2AM_DROSI Alpha-methyldopa hypersensitive protein (Fragment) OS=Drosophila simulans GN=amd PE=2 SV=1 123 428 9.0E-20
sp|P05031|DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster GN=Ddc PE=1 SV=4 1 423 7.0E-19
sp|O96571|DDC_DROLE Aromatic-L-amino-acid decarboxylase (Fragment) OS=Drosophila lebanonensis GN=Ddc PE=3 SV=1 117 423 1.0E-18
sp|O96567|DDC_DROSI Aromatic-L-amino-acid decarboxylase OS=Drosophila simulans GN=Ddc PE=3 SV=2 82 423 2.0E-18
sp|O96569|L2AM_DROLE Alpha-methyldopa hypersensitive protein (Fragment) OS=Drosophila lebanonensis GN=amd PE=3 SV=1 123 441 2.0E-15
sp|P34751|DDC_CAEEL Probable aromatic-L-amino-acid decarboxylase OS=Caenorhabditis elegans GN=hdl-1 PE=2 SV=3 67 423 1.0E-13
sp|O27188|MFNA_METTH Probable L-tyrosine/L-aspartate decarboxylase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=mfnA PE=3 SV=1 165 353 2.0E-12
sp|A2STQ3|MFNA_METLZ Probable L-tyrosine/L-aspartate decarboxylase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=mfnA PE=3 SV=1 134 342 3.0E-12
sp|Q0W498|MFNA_METAR Probable L-tyrosine/L-aspartate decarboxylase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=mfnA PE=3 SV=1 132 328 8.0E-12
sp|Q3IT46|MFNA_NATPD Probable L-aspartate decarboxylase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mfnA PE=3 SV=1 165 328 7.0E-11
sp|Q2FSD2|MFNA_METHJ Probable L-tyrosine/L-aspartate decarboxylase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=mfnA PE=3 SV=1 132 346 4.0E-10
sp|Q60358|MFNA_METJA L-tyrosine/L-aspartate decarboxylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=mfnA PE=1 SV=1 80 417 7.0E-10
sp|A3CWM4|MFNA_METMJ Probable L-tyrosine/L-aspartate decarboxylase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=mfnA PE=3 SV=1 132 401 8.0E-10
sp|A7IAB9|MFNA_METB6 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanoregula boonei (strain 6A8) GN=mfnA PE=3 SV=1 132 401 8.0E-10
sp|Q12VA2|MFNA_METBU Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mfnA PE=3 SV=1 163 328 1.0E-09
sp|A4G060|MFNA_METM5 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=mfnA PE=3 SV=1 166 343 2.0E-09
sp|A0B9M9|MFNA_METTP Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mfnA PE=3 SV=2 132 411 4.0E-09
sp|A6VIC0|MFNA_METM7 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=mfnA PE=3 SV=1 166 357 5.0E-09
sp|B8GDM7|MFNA_METPE Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=mfnA PE=3 SV=1 120 419 9.0E-09
sp|Q6M0Y7|MFNA_METMP Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus maripaludis (strain S2 / LL) GN=mfnA PE=3 SV=1 166 413 2.0E-08
sp|A6UVR4|MFNA_META3 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=mfnA PE=3 SV=1 88 361 3.0E-08
sp|Q9HSA3|MFNA_HALSA Probable L-aspartate decarboxylase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=mfnA PE=3 SV=1 111 348 3.0E-08
sp|B0R349|MFNA_HALS3 Probable L-aspartate decarboxylase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=mfnA PE=3 SV=1 111 348 3.0E-08
sp|Q5V1B4|MFNA_HALMA Probable L-aspartate decarboxylase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=mfnA PE=3 SV=1 148 419 3.0E-08
sp|A6URB4|MFNA_METVS Probable L-tyrosine/L-aspartate decarboxylase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=mfnA PE=3 SV=1 148 339 4.0E-08
sp|Q2NHY7|MFNA_METST Probable L-tyrosine/L-aspartate decarboxylase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=mfnA PE=3 SV=1 147 417 4.0E-08
sp|A5ULW4|MFNA_METS3 Probable L-tyrosine/L-aspartate decarboxylase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=mfnA PE=3 SV=1 148 328 7.0E-08
sp|A7MVI6|DCHS_VIBCB Histidine decarboxylase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=hdc PE=3 SV=1 148 339 8.0E-08
sp|Q5JJ82|MFNA_THEKO L-aspartate decarboxylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=mfnA PE=1 SV=1 148 411 4.0E-07
sp|Q6P474|PDXD2_HUMAN Putative pyridoxal-dependent decarboxylase domain-containing protein 2 OS=Homo sapiens GN=PDXDC2P PE=5 SV=3 224 454 5.0E-07
sp|Q8RV06|SDC2_ORYSJ Serine decarboxylase 2 OS=Oryza sativa subsp. japonica GN=Os10g0105700 PE=2 SV=1 129 419 7.0E-07
sp|B2HVG6|DCHS_ACIBC Histidine decarboxylase OS=Acinetobacter baumannii (strain ACICU) GN=hdc PE=3 SV=1 148 410 7.0E-07
sp|Q8U1P6|MFNA_PYRFU Probable L-aspartate decarboxylase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=mfnA PE=3 SV=1 79 483 8.0E-07
sp|C5A2X8|MFNA_THEGJ Probable L-aspartate decarboxylase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=mfnA PE=3 SV=1 148 502 1.0E-06
sp|Q56581|DCHS_VIBA7 Histidine decarboxylase OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=hdc PE=3 SV=1 148 339 1.0E-06
sp|Q9MA74|SDC1_ARATH Serine decarboxylase OS=Arabidopsis thaliana GN=SDC PE=1 SV=1 169 425 1.0E-06
sp|Q9UZD5|MFNA_PYRAB Probable L-aspartate decarboxylase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=mfnA PE=3 SV=1 263 503 2.0E-06
sp|Q6P996|PDXD1_HUMAN Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens GN=PDXDC1 PE=1 SV=2 224 454 4.0E-06
sp|A3M7A4|DCHS_ACIBT Histidine decarboxylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hdc PE=3 SV=2 148 410 8.0E-06
sp|B0VBU8|DCHS_ACIBY Histidine decarboxylase OS=Acinetobacter baumannii (strain AYE) GN=hdc PE=3 SV=1 148 410 9.0E-06
sp|B7I459|DCHS_ACIB5 Histidine decarboxylase OS=Acinetobacter baumannii (strain AB0057) GN=hdc PE=3 SV=1 148 410 9.0E-06
sp|B7GZJ8|DCHS_ACIB3 Histidine decarboxylase OS=Acinetobacter baumannii (strain AB307-0294) GN=hdc PE=3 SV=1 148 410 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019752 carboxylic acid metabolic process Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0016830 carbon-carbon lyase activity Yes
GO:0003824 catalytic activity No
GO:0019842 vitamin binding No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0043167 ion binding No
GO:0043436 oxoacid metabolic process No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0070279 vitamin B6 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7910
MPTASTNGHMGPSTEPRRAAELDDLIVAVGQLVVSFVQAADEAAAHRATGTLPRDASGHTHNVLVDAHKPRDLVA
KLKLQLPDQGQGKQGLLEGIEKVLKYSVNTWDQGFLDKLYASNTPVGVISDLVLSALNTNLHVYQVSPALTVIEK
ATARALANRFGFNGPHAGGITCQGGSSSNLTSLVVARNTLYPNTKTAGNSGYDFVIFTSAHGHYSVEKSAMICGL
GSASVCKVPVDHGGSMRPDKLRELVLQAKQEGKTPLYVNSTAGSTVRGSYDPFEEISAICTEFGLWMHIDASWGG
PVVFSAQQRWKLKGSHLAHSLTVNPHKMMNVPATCSYLLTPDTKVLRAANSTTAGYLFHQSADQEVWDLADLTLQ
CGRRGDSLKVALAWLYYGANGFEQQIDHAFAMASYLHKLLSSKGSFELLSADAPPCLQVCFYYAPGGSLPQDDAV
NTKNTQAIVEALLHRGFMVDYAPGDQGSFVRVVVNVQTLASTVEGLATAIEEAAEDMC*
Coding >OphauB2|7910
ATGCCTACAGCGTCCACCAACGGGCACATGGGCCCAAGCACCGAGCCGCGTAGGGCTGCTGAATTGGATGATCTC
ATTGTTGCTGTTGGCCAGCTTGTTGTCTCTTTTGTCCAGGCTGCAGATGAGGCCGCTGCACATCGCGCAACTGGG
ACTCTTCCCCGAGACGCTTCAGGTCATACCCACAATGTCCTGGTAGACGCCCACAAGCCCCGTGATCTCGTGGCC
AAGCTCAAGCTTCAACTGCCCGACCAAGGCCAGGGCAAGCAGGGGCTGCTCGAGGGCATCGAAAAGGTACTCAAG
TACAGCGTCAATACCTGGGACCAGGGCTTTCTCGACAAGCTCTACGCAAGCAATACTCCAGTTGGCGTCATTTCC
GATCTAGTTCTTTCCGCCCTCAATACCAATCTGCATGTCTATCAAGTTTCGCCGGCCTTGACGGTTATTGAAAAG
GCGACGGCCCGCGCCTTGGCGAACCGCTTTGGCTTCAATGGGCCACATGCTGGCGGCATTACTTGCCAGGGAGGC
AGCTCGTCCAACCTGACGTCTCTTGTTGTTGCTCGAAACACACTGTATCCAAACACAAAGACGGCAGGCAACTCG
GGCTATGACTTTGTCATCTTTACTAGCGCACACGGCCACTACTCGGTGGAAAAGAGCGCCATGATTTGTGGATTG
GGATCCGCAAGTGTGTGCAAGGTGCCAGTTGACCATGGCGGCAGCATGAGGCCGGACAAGCTGAGGGAACTGGTG
CTGCAGGCAAAGCAGGAGGGCAAGACGCCCCTCTATGTCAATTCGACGGCCGGCTCAACGGTGCGAGGCTCGTAC
GACCCCTTTGAAGAGATATCAGCCATTTGCACCGAGTTTGGCTTGTGGATGCACATTGATGCAAGCTGGGGTGGT
CCTGTCGTCTTTTCTGCCCAGCAGAGGTGGAAGCTCAAGGGCTCCCACCTGGCACACTCATTGACAGTCAACCCT
CACAAGATGATGAATGTGCCTGCGACGTGCTCCTATCTCCTGACACCCGACACCAAGGTGTTGCGGGCAGCCAAT
TCGACGACTGCGGGCTATCTGTTCCACCAGAGCGCCGACCAAGAGGTGTGGGATCTGGCAGACCTGACTCTACAG
TGCGGCCGGCGCGGCGACAGCCTCAAGGTGGCGCTAGCATGGCTCTACTATGGGGCCAACGGCTTTGAGCAGCAA
ATTGACCACGCCTTTGCCATGGCCTCGTATCTGCACAAGCTGCTGAGCAGCAAGGGAAGCTTTGAGCTCTTATCG
GCCGACGCGCCGCCTTGTTTGCAGGTCTGCTTTTACTATGCGCCTGGTGGCAGCCTGCCCCAAGACGATGCTGTG
AATACGAAGAACACCCAAGCCATTGTGGAAGCCCTGCTCCACCGAGGCTTCATGGTTGACTATGCGCCGGGCGAC
CAGGGCAGCTTTGTGCGGGTCGTGGTCAACGTCCAGACTCTTGCAAGCACTGTTGAGGGCTTGGCCACGGCAATT
GAAGAAGCAGCCGAGGATATGTGCTAG
Transcript >OphauB2|7910
ATGCCTACAGCGTCCACCAACGGGCACATGGGCCCAAGCACCGAGCCGCGTAGGGCTGCTGAATTGGATGATCTC
ATTGTTGCTGTTGGCCAGCTTGTTGTCTCTTTTGTCCAGGCTGCAGATGAGGCCGCTGCACATCGCGCAACTGGG
ACTCTTCCCCGAGACGCTTCAGGTCATACCCACAATGTCCTGGTAGACGCCCACAAGCCCCGTGATCTCGTGGCC
AAGCTCAAGCTTCAACTGCCCGACCAAGGCCAGGGCAAGCAGGGGCTGCTCGAGGGCATCGAAAAGGTACTCAAG
TACAGCGTCAATACCTGGGACCAGGGCTTTCTCGACAAGCTCTACGCAAGCAATACTCCAGTTGGCGTCATTTCC
GATCTAGTTCTTTCCGCCCTCAATACCAATCTGCATGTCTATCAAGTTTCGCCGGCCTTGACGGTTATTGAAAAG
GCGACGGCCCGCGCCTTGGCGAACCGCTTTGGCTTCAATGGGCCACATGCTGGCGGCATTACTTGCCAGGGAGGC
AGCTCGTCCAACCTGACGTCTCTTGTTGTTGCTCGAAACACACTGTATCCAAACACAAAGACGGCAGGCAACTCG
GGCTATGACTTTGTCATCTTTACTAGCGCACACGGCCACTACTCGGTGGAAAAGAGCGCCATGATTTGTGGATTG
GGATCCGCAAGTGTGTGCAAGGTGCCAGTTGACCATGGCGGCAGCATGAGGCCGGACAAGCTGAGGGAACTGGTG
CTGCAGGCAAAGCAGGAGGGCAAGACGCCCCTCTATGTCAATTCGACGGCCGGCTCAACGGTGCGAGGCTCGTAC
GACCCCTTTGAAGAGATATCAGCCATTTGCACCGAGTTTGGCTTGTGGATGCACATTGATGCAAGCTGGGGTGGT
CCTGTCGTCTTTTCTGCCCAGCAGAGGTGGAAGCTCAAGGGCTCCCACCTGGCACACTCATTGACAGTCAACCCT
CACAAGATGATGAATGTGCCTGCGACGTGCTCCTATCTCCTGACACCCGACACCAAGGTGTTGCGGGCAGCCAAT
TCGACGACTGCGGGCTATCTGTTCCACCAGAGCGCCGACCAAGAGGTGTGGGATCTGGCAGACCTGACTCTACAG
TGCGGCCGGCGCGGCGACAGCCTCAAGGTGGCGCTAGCATGGCTCTACTATGGGGCCAACGGCTTTGAGCAGCAA
ATTGACCACGCCTTTGCCATGGCCTCGTATCTGCACAAGCTGCTGAGCAGCAAGGGAAGCTTTGAGCTCTTATCG
GCCGACGCGCCGCCTTGTTTGCAGGTCTGCTTTTACTATGCGCCTGGTGGCAGCCTGCCCCAAGACGATGCTGTG
AATACGAAGAACACCCAAGCCATTGTGGAAGCCCTGCTCCACCGAGGCTTCATGGTTGACTATGCGCCGGGCGAC
CAGGGCAGCTTTGTGCGGGTCGTGGTCAACGTCCAGACTCTTGCAAGCACTGTTGAGGGCTTGGCCACGGCAATT
GAAGAAGCAGCCGAGGATATGTGCTAG
Gene >OphauB2|7910
ATGCCTACAGCGTCCACCAACGGGCACATGGGCCCAAGCACCGAGCCGCGTAGGGCTGCTGAATTGGATGATGTG
AAGCTCGCGGCTCTCTCCTCAAGGTTACATGCTGCAAAGTCGACTGACTCCTGTTTCAGCTCATTGTTGCTGTTG
GCCAGCTTGTTGTCTCTTTTGTCCAGGCTGCAGATGAGGCCGCTGCACATCGCGCAACTGGGACTCTTCCCCGAG
ACGCTTCAGGTCATACCCACAATGTCCTGGTAGACGCCCACAAGCCCCGTGATCTCGTGGCCAAGCTCAAGCTTC
AACTGCCCGACCAAGGCCAGGGCAAGCAGGGGCTGCTCGAGGGCATCGAAAAGGTACTCAAGTACAGCGTCAATA
CCTGGGACCAGGGCTTTCTCGACAAGCTCTACGCAAGCAATACTCCAGTCTGTACTCTGTTGGCTTGTGTGCAAT
GGACTGTCTTGTGCTCACATCAGGTCTCAGGTTGGCGTCATTTCCGATCTAGTTCTTTCCGCCCTCAATACCAAT
GTGTGTAGCTCACCCAAGCCGTGTGTTTGCTTATTCCGAGACTTGATGCTTAGTCTTGTAGCTGCATGTCTATCA
AGTTTCGCCGGCCTTGACGGTTATTGAAAAGGCGACGGCCCGCGCCTTGGCGAACCGCTTTGGCTTCAATGGGCC
ACATGCTGGCGGCATTACTTGCCAGGGAGGCAGCTCGTCCAACCTGACGTCTCTTGTTGTTGCTCGAAACACACT
GTATCCAAACACAAAGACGGCAGGCAACTCGGGCTATGACTTTGTCATCTTTACTAGCGCACACGGCCACTACTC
GGTGGAAAAGAGCGCCATGATTTGTGGATTGGGATCCGCAAGTGTGTGCAAGGTGCCAGTTGACCATGGCGGCAG
CATGAGGCCGGACAAGCTGAGGGAACTGGTGCTGCAGGCAAAGCAGGAGGGCAAGACGCCCCTCTATGTCAATTC
GACGGCCGGCTCAACGGTGCGAGGCTCGTACGACCCCTTTGAAGAGATATCAGCCATTTGCACCGAGTTTGGCTT
GTGGATGCACATTGATGCAAGCTGGGGTGGTCCTGTCGTCTTTTCTGCCCAGCAGAGGTGGAAGCTCAAGGGCTC
CCACCTGGCACACTCATTGACAGTCAACCCTCACAAGATGATGAATGTGCCTGCGACGTGCTCCTATCTCCTGAC
ACCCGACACCAAGGTGTTGCGGGCAGCCAATTCGACGACTGCGGGCTATCTGTTCCACCAGAGCGCCGACCAAGA
GGTGTGGGATCTGGCAGACCTGACTCTACAGTGCGGCCGGCGCGGCGACAGCCTCAAGGTGGCGCTAGCATGGCT
CTACTATGGGGCCAACGGCTTTGAGCAGCAAATTGACCACGCCTTTGCCATGGCCTCGTATCTGCACAAGCTGCT
GAGCAGCAAGGGAAGCTTTGAGCTCTTATCGGCCGACGCGCCGCCTTGTTTGCAGGTCTGCTTTTACTATGCGCC
TGGTGGCAGCCTGCCCCAAGACGATGCTGTGAATACGAAGAACACCCAAGCCATTGTGGAAGCCCTGCTCCACCG
AGGCTTCATGGTTGACTATGCGCCGGGCGACCAGGGCAGCTTTGTGCGGGTCGTGGTCAACGTCCAGACTCTTGC
AAGCACTGTTGAGGGCTTGGCCACGGCAATTGAAGAAGCAGCCGAGGATATGTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail