Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7905
Gene name
LocationContig_9:263084..264100
Strand+
Gene length (bp)1016
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02330 MAM33 Mitochondrial glycoprotein 7.9E-69 72 307

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94675|MAM33_SCHPO Mitochondrial acidic protein mam33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.07 PE=3 SV=1 101 307 8.0E-22
sp|P40513|MAM33_YEAST Mitochondrial acidic protein MAM33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAM33 PE=1 SV=1 2 307 6.0E-20
sp|Q8W487|YB95_ARATH Uncharacterized protein At2g39795, mitochondrial OS=Arabidopsis thaliana GN=At2g39795 PE=2 SV=1 19 308 4.0E-09

GO

GO Term Description Terminal node
GO:0005759 mitochondrial matrix Yes
GO:0110165 cellular anatomical entity No
GO:0031974 membrane-enclosed lumen No
GO:0070013 intracellular organelle lumen No
GO:0005575 cellular_component No
GO:0043233 organelle lumen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7905
MLALRALVRSTPRALARTSAPSLRQSLARPSALSTALLAMRNASRPGHAAFSTTVFRAASSGETDEDLSSKLDSE
IQIEEELKNSEQQPASVKDFLENSPFELVDKPGQETVKLIRKFGDEEITVSFSIADVSDYESMSDDHALADEDLG
EGGMQDANRQDHVPAAGGPRSAPAQEQMDEDEDENMDEEPSPTPINLTIVVEKPGKTTGALTIDAMAADGNVSVE
NVFFYEDAKVARIDTPESAQKRARSYPGPPFGSLDEDLQVLVERYLEERGINQAMSIFVTDFVDVKEQKEYMRWL
SNVKKFIDA*
Coding >OphauB2|7905
ATGCTCGCCCTCCGAGCTCTTGTGCGCTCGACTCCGCGGGCTCTTGCTCGCACGAGTGCACCATCTCTCCGCCAG
TCACTTGCACGTCCCAGCGCACTTAGCACAGCTCTGTTGGCCATGAGGAATGCCTCAAGGCCCGGCCATGCTGCC
TTTTCAACAACAGTTTTTAGGGCAGCATCAAGTGGTGAAACTGATGAGGACCTCTCGTCCAAGCTTGACAGCGAG
ATTCAGATTGAGGAGGAGCTCAAGAACAGCGAGCAGCAGCCGGCTAGCGTCAAGGACTTTTTGGAGAATTCTCCC
TTTGAGCTAGTTGACAAGCCTGGGCAAGAGACTGTCAAGCTGATTCGCAAATTTGGCGATGAAGAAATCACCGTC
AGCTTCTCCATTGCAGATGTTTCTGATTACGAGTCCATGTCCGATGATCATGCCCTCGCTGATGAGGATCTCGGT
GAAGGCGGCATGCAAGACGCCAACCGCCAAGATCACGTCCCCGCTGCAGGTGGACCCCGCTCTGCTCCCGCCCAG
GAGCAGATGGATGAGGATGAGGATGAGAACATGGACGAGGAACCTTCTCCAACGCCCATCAATCTGACCATTGTG
GTCGAGAAGCCCGGTAAGACTACTGGTGCCCTCACCATCGATGCCATGGCAGCGGACGGCAATGTCTCGGTAGAA
AACGTCTTTTTCTACGAAGACGCCAAGGTCGCAAGGATCGATACCCCAGAGTCGGCTCAAAAGCGTGCCCGCTCT
TACCCTGGCCCGCCCTTTGGCAGTCTTGATGAGGACCTTCAAGTTCTCGTCGAGCGTTACCTTGAGGAGCGCGGC
ATCAACCAGGCCATGTCCATCTTTGTCACCGATTTCGTCGACGTCAAGGAACAGAAAGAGTACATGCGCTGGCTC
AGCAATGTCAAGAAGTTTATTGACGCTTAA
Transcript >OphauB2|7905
ATGCTCGCCCTCCGAGCTCTTGTGCGCTCGACTCCGCGGGCTCTTGCTCGCACGAGTGCACCATCTCTCCGCCAG
TCACTTGCACGTCCCAGCGCACTTAGCACAGCTCTGTTGGCCATGAGGAATGCCTCAAGGCCCGGCCATGCTGCC
TTTTCAACAACAGTTTTTAGGGCAGCATCAAGTGGTGAAACTGATGAGGACCTCTCGTCCAAGCTTGACAGCGAG
ATTCAGATTGAGGAGGAGCTCAAGAACAGCGAGCAGCAGCCGGCTAGCGTCAAGGACTTTTTGGAGAATTCTCCC
TTTGAGCTAGTTGACAAGCCTGGGCAAGAGACTGTCAAGCTGATTCGCAAATTTGGCGATGAAGAAATCACCGTC
AGCTTCTCCATTGCAGATGTTTCTGATTACGAGTCCATGTCCGATGATCATGCCCTCGCTGATGAGGATCTCGGT
GAAGGCGGCATGCAAGACGCCAACCGCCAAGATCACGTCCCCGCTGCAGGTGGACCCCGCTCTGCTCCCGCCCAG
GAGCAGATGGATGAGGATGAGGATGAGAACATGGACGAGGAACCTTCTCCAACGCCCATCAATCTGACCATTGTG
GTCGAGAAGCCCGGTAAGACTACTGGTGCCCTCACCATCGATGCCATGGCAGCGGACGGCAATGTCTCGGTAGAA
AACGTCTTTTTCTACGAAGACGCCAAGGTCGCAAGGATCGATACCCCAGAGTCGGCTCAAAAGCGTGCCCGCTCT
TACCCTGGCCCGCCCTTTGGCAGTCTTGATGAGGACCTTCAAGTTCTCGTCGAGCGTTACCTTGAGGAGCGCGGC
ATCAACCAGGCCATGTCCATCTTTGTCACCGATTTCGTCGACGTCAAGGAACAGAAAGAGTACATGCGCTGGCTC
AGCAATGTCAAGAAGTTTATTGACGCTTAA
Gene >OphauB2|7905
ATGCTCGCCCTCCGAGCTCTTGTGCGCTCGACTCCGCGGGCTCTTGCTCGCACGAGTGCACCATCTCTCCGCCAG
TCACTTGCACGTCCCAGCGCACTTAGCACAGCTCTGTTGGCCATGAGGAATGCCTCAAGGCCCGGCCATGCTGCC
TTTTCAACAACAGTTTTTAGGGCAGCATCAAGTGGTGAAACTGATGAGGACCTCTCGTCCAAGCTTGACAGCGAG
ATTCAGATTGAGGAGGAGCTCAAGAACAGCGAGCAGCAGCCGGCTAGCGTCAAGGACTTTTTGGAGAATTCTCCC
TTTGAGCTAGTTGACAAGCCTGGGCAAGAGACTGTCAAGCTGATTCGCAAATTTGGCGATGAAGAGTACGTCTTT
TTTTCCCCTTTATTCTTGTTGCAAAGAGAAACAAGTCACATGTGGGTATTTGAAAACTAACCCAGTATTCGTCCA
GAATCACCGTCAGCTTCTCCATTGCAGATGTTTCTGATTACGAGTCCATGTCCGATGATCATGCCCTCGCTGATG
AGGATCTCGGTGAAGGCGGCATGCAAGACGCCAACCGCCAAGATCACGTCCCCGCTGCAGGTGGACCCCGCTCTG
CTCCCGCCCAGGAGCAGATGGATGAGGATGAGGATGAGAACATGGACGAGGAACCTTCTCCAACGCCCATCAATC
TGACCATTGTGGTCGAGAAGCCCGGTAAGACTACTGGTGCCCTCACCATCGATGCCATGGCAGCGGACGGCAATG
TCTCGGTAGAAAACGTCTTTTTCTACGAAGACGCCAAGGTCGCAAGGATCGATACCCCAGAGTCGGCTCAAAAGC
GTGCCCGCTCTTACCCTGGCCCGCCCTTTGGCAGTCTTGATGAGGACCTTCAAGTTCTCGTCGAGCGTTACCTTG
AGGAGCGCGGCATCAACCAGGCCATGTCCATCTTTGTCACCGATTTCGTCGACGTCAAGGAACAGAAAGAGTACA
TGCGCTGGCTCAGCAATGTCAAGAAGTTTATTGACGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail