Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7900
Gene name
LocationContig_9:253041..253402
Strand-
Gene length (bp)361
Transcript length (bp)240
Coding sequence length (bp)240
Protein length (aa) 80

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05251 Ost5 Oligosaccharyltransferase subunit 5 5.6E-17 15 79

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0034998 oligosaccharyltransferase I complex Yes
GO:0006487 protein N-linked glycosylation Yes
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0008250 oligosaccharyltransferase complex No
GO:1990234 transferase complex No
GO:1902494 catalytic complex No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0006486 protein glycosylation No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0070085 glycosylation No
GO:0098796 membrane protein complex No
GO:0043413 macromolecule glycosylation No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 53 75 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7900
MDSSLPEIWLAAAGSPFLPVVGKGTQFLVGFILLLSGIAATGAFALNRSLVNVAVIGVPASLALAFGVIYMFCAV
GVYI*
Coding >OphauB2|7900
ATGGATTCCTCTCTGCCCGAGATCTGGCTAGCTGCTGCGGGCAGTCCCTTTCTTCCAGTCGTTGGCAAAGGCACC
CAGTTCCTCGTTGGCTTCATCTTGCTCCTGTCAGGGATTGCAGCCACGGGTGCTTTCGCGCTGAACCGTTCTCTT
GTCAACGTGGCAGTCATTGGCGTACCGGCATCACTGGCACTTGCATTCGGTGTCATTTACATGTTTTGTGCTGTT
GGGGTCTATATCTGA
Transcript >OphauB2|7900
ATGGATTCCTCTCTGCCCGAGATCTGGCTAGCTGCTGCGGGCAGTCCCTTTCTTCCAGTCGTTGGCAAAGGCACC
CAGTTCCTCGTTGGCTTCATCTTGCTCCTGTCAGGGATTGCAGCCACGGGTGCTTTCGCGCTGAACCGTTCTCTT
GTCAACGTGGCAGTCATTGGCGTACCGGCATCACTGGCACTTGCATTCGGTGTCATTTACATGTTTTGTGCTGTT
GGGGTCTATATCTGA
Gene >OphauB2|7900
ATGGATTCCTCTCTGCCCGAGATCTGGCTAGCTGCTGCGGGCAGTCCCTTTCTTCCAGTCGTTGGCAAAGGCACC
CAGTTCCTCGTTGGCTTCATCTTGCTCCTGTCAGGGATTGCAGCCACGGGTGCTTTCGCGCTGAGTATGTCGCTG
CCTGCCTCTGGCACCCGTAAGGCCTTGTTCAGCTAATTTGCTCGCGCTTTGCAAGACCGTTCTCTTGTCAACGTG
GCAGTCATTGGCGTACCGGCATCACTGGCACTTGCGTGCGTGCCCCAGATGCAGCATTTATTTGACATGAGCTAA
ACTGACGAGGCACAGATTCGGTGTCATTTACATGTTTTGTGCTGTTGGGGTCTATATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail