Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|79
Gene name
LocationContig_1:196998..200526
Strand+
Gene length (bp)3528
Transcript length (bp)3207
Coding sequence length (bp)3207
Protein length (aa) 1069

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.2E-75 503 775
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.3E-43 51 199
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 5.1E-21 222 491
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 1.3E-20 959 1061

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 43 813 2.0E-109
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 394 1067 4.0E-96
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 399 888 7.0E-89
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 62 280 4.0E-40
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 443 828 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 43 813 2.0E-109
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 394 1067 4.0E-96
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 399 888 7.0E-89
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 62 280 4.0E-40
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 443 828 2.0E-33
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 69 298 1.0E-30
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 395 828 1.0E-28
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 408 828 1.0E-23
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 405 828 2.0E-23
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 361 776 3.0E-23
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 401 828 7.0E-23
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 401 810 9.0E-23
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 408 781 2.0E-22
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 400 836 1.0E-21
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 400 776 1.0E-20
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 408 828 2.0E-20
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 408 828 5.0E-20
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 408 842 3.0E-19
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 409 793 1.0E-14
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 400 839 3.0E-14
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 408 845 6.0E-13
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 40 275 4.0E-09
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 449 911 7.0E-09
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 46 233 4.0E-08
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 451 780 1.0E-07
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 102 233 1.0E-06
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 102 233 3.0E-06
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 102 233 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 51 73 22
2 138 160 22
3 180 202 22
4 507 529 22
5 549 571 22
6 592 614 22
7 646 668 22
8 708 730 22
9 755 777 22
10 779 801 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|79
MAETWAIEARGILDIFKGGNDPRVGSGRQDSSGGGTLSTASGSKSSSLGKLGATFIPVVIYLAICIVAFTVLRRR
FPRVYAPRSIPALRAPEKSSPALPSGWLNWIVPFFKIPDTFLLAHGTLDAFFFLRFLKVLRNVCLGGCVILWPVL
FPIHATGGGGLSELDLLTIGNVKDSSKLYAHAAMAWVFFGFVLYMIVRECIFYVNLRQTIMSSPSYARRLSSRTM
LLTSVPSEYLSERRLRKLYGPSVRRVFIPSTTKALAKLVKEREQTATRLERAEVELILRANAARKKHLKKAAKSG
SNDVTTTDSAASQQNLVTLSRDGTVGPLVLELPGSYIEIEPLREKAKTGGDSAALDIGTSPQEAEKANEDEDPDY
IHPYGLEFYLPDVRGSVAARWLPVEKRPYHRPLGNFGRRVDTIRWTRLRLRELNNHIHRMRRRIRRGDSGTTLPV
AFIEFESQEAAQAAHQVLPHHRPLRMAERIIGVVPGEVIWSSLRMSWWERIGRRFMILSLVTAAVVFWSVPSALI
GLVSQIDFLAKKVVFLSWIKRLPSIVVNFLQGFVPSIALSLLMSLVPVMLRVCGAQAGISSVIKVELFVQNVYFA
FQVVQVFLITTITSAASAALTDILQNPIKVKDVLATNLPMASNFYLSYILVQCVVSSGTNLLQVFSLIRHTVHAK
FTKLPRARLVAWRRLRSPRWGGVFPVFANMGVIALSYACIAPLILIFAAGGMAIIRIVWRYNVIFVMDSSSDSKG
LFYPRALLHLTIGLYLAEICLIGLFALHLAFGPLAMMVLFFLFTGLVHVSLRDAIQPLLQNLPQTLAMEEDVQRE
DKEAAELARRQAAARTSEEAAAATGAASSYYDANQVFGEEEEEGFGGHQDWNTDGETEDEEEGAEHGPVTGTRAL
EGASSVRSAVGEWFKMSTKSKIRDQALQLGLPKVFAKFRTWAGLDGRDSGRPPGLLARWLHPEEYEDFVALRRTL
LLEEEDVGDSEQVSKTSRGSKSKSKKLMGYLPPETWMPRPTLWIPRDEARVSRQEVAHTRKVTPISDKGAYLDGK
GRIVVHFDEAPFTDERDP*
Coding >OphauB2|79
ATGGCCGAGACGTGGGCTATCGAGGCCCGCGGCATTCTCGACATCTTTAAAGGCGGCAACGACCCGCGTGTTGGT
TCGGGCCGCCAAGACTCATCCGGCGGCGGCACTCTAAGCACAGCGTCTGGCAGCAAGTCGTCTTCCTTGGGCAAA
CTCGGTGCCACATTCATACCCGTCGTCATCTATCTTGCCATCTGCATTGTCGCCTTTACTGTATTGCGCCGTCGC
TTCCCTCGCGTCTACGCCCCGCGCTCTATACCAGCCTTGCGCGCTCCCGAAAAGTCTAGTCCGGCACTTCCCTCT
GGCTGGCTTAATTGGATTGTGCCATTCTTTAAGATACCCGACACCTTTCTCCTTGCCCATGGCACCCTTGACGCC
TTTTTTTTCCTGCGCTTTCTCAAGGTGCTCCGCAATGTCTGCCTCGGTGGTTGTGTCATCCTGTGGCCTGTTCTC
TTCCCCATCCACGCCACTGGGGGAGGCGGCCTCTCCGAACTCGATCTCTTGACCATTGGAAATGTCAAGGACTCA
TCAAAGCTGTACGCACATGCCGCCATGGCATGGGTTTTTTTTGGTTTCGTGCTTTACATGATTGTGCGAGAGTGC
ATCTTTTATGTCAACCTTCGCCAGACAATCATGTCGTCGCCCAGCTATGCGCGTCGTCTCTCATCTCGTACCATG
CTATTGACTTCGGTGCCGAGCGAATATCTCAGCGAGCGACGCCTCCGCAAACTCTACGGTCCTTCTGTTCGTCGC
GTCTTTATCCCGAGTACCACCAAGGCTCTCGCCAAGCTGGTCAAGGAGCGTGAGCAGACAGCCACAAGGCTGGAA
AGGGCCGAGGTGGAATTGATTTTGCGCGCCAACGCTGCGAGGAAAAAGCACCTCAAAAAGGCTGCCAAGTCTGGC
TCCAACGACGTGACAACGACAGACTCGGCCGCCTCGCAGCAGAATCTCGTGACCCTGTCAAGAGACGGCACTGTC
GGGCCCCTGGTCCTGGAGCTGCCTGGCTCTTACATTGAAATCGAGCCCCTGAGAGAAAAAGCCAAGACTGGCGGC
GACTCGGCTGCGCTCGACATTGGGACAAGTCCACAAGAAGCTGAGAAGGCCAATGAGGACGAGGACCCCGACTAC
ATACACCCCTATGGCCTGGAATTCTACCTTCCCGACGTTCGTGGCTCCGTCGCTGCGCGCTGGCTTCCGGTCGAG
AAACGACCCTATCATCGTCCCTTGGGTAACTTTGGCCGGCGCGTCGACACGATTCGCTGGACACGCTTGCGACTG
CGTGAACTCAACAACCACATTCATCGCATGCGCCGGCGGATTCGTCGTGGAGACTCTGGCACTACTTTGCCCGTC
GCCTTTATCGAGTTTGAGTCGCAAGAGGCGGCCCAGGCGGCACATCAAGTCCTGCCTCACCATCGGCCCTTGCGC
ATGGCAGAGCGAATAATCGGCGTTGTTCCAGGAGAAGTCATTTGGTCCTCGCTGCGCATGTCTTGGTGGGAGCGC
ATTGGCCGCCGATTCATGATTTTGTCGCTGGTTACTGCTGCCGTTGTCTTTTGGTCTGTCCCATCGGCCCTTATT
GGCCTTGTCTCCCAAATCGACTTTTTGGCGAAAAAGGTTGTTTTTCTCAGCTGGATCAAGCGTCTTCCATCCATT
GTCGTCAATTTCCTGCAGGGCTTTGTGCCTTCAATTGCCTTGTCGCTGCTCATGTCCTTGGTGCCCGTCATGCTT
CGAGTTTGCGGAGCACAAGCAGGCATCTCATCGGTAATCAAGGTTGAGCTCTTTGTACAAAACGTCTATTTTGCC
TTTCAGGTTGTTCAGGTGTTCCTCATCACCACGATTACGTCGGCCGCATCGGCCGCCCTCACAGACATTTTGCAG
AATCCAATCAAGGTCAAGGATGTGCTGGCGACCAATTTGCCCATGGCATCCAACTTTTACCTGTCGTATATTCTG
GTGCAGTGTGTGGTTAGCAGCGGCACCAACCTGCTTCAGGTCTTTTCCCTCATCCGACATACAGTACACGCCAAA
TTTACCAAGCTCCCTCGTGCACGTCTTGTTGCATGGCGGCGCCTGCGTTCTCCTCGCTGGGGCGGTGTGTTTCCC
GTGTTTGCAAACATGGGAGTCATTGCCCTTAGTTATGCGTGCATTGCGCCACTTATACTCATTTTTGCGGCTGGT
GGCATGGCCATTATTCGCATCGTCTGGCGATATAATGTCATTTTCGTCATGGACTCTTCGTCGGACAGCAAGGGA
CTATTTTACCCCCGGGCACTTCTTCATCTCACCATTGGCCTGTACCTGGCCGAGATTTGTCTAATTGGTCTCTTT
GCCCTACATCTAGCGTTTGGACCTCTTGCCATGATGGTCTTGTTCTTCCTCTTTACCGGCCTGGTGCATGTTTCG
CTGCGAGATGCTATTCAGCCCCTGCTTCAGAATCTGCCACAGACACTGGCAATGGAGGAGGACGTTCAGCGCGAA
GATAAAGAGGCAGCAGAGCTGGCAAGGAGGCAGGCTGCTGCGAGAACGTCTGAAGAAGCAGCAGCAGCAACAGGG
GCTGCGTCAAGCTACTATGATGCAAATCAAGTGTTTGGAGAGGAGGAGGAGGAGGGGTTTGGAGGACACCAAGAC
TGGAATACGGACGGCGAAACTGAAGATGAAGAGGAGGGTGCGGAACACGGCCCCGTGACGGGCACGCGTGCCCTC
GAAGGCGCCAGCAGCGTTCGATCGGCGGTTGGGGAATGGTTCAAGATGAGCACCAAGTCCAAGATTCGCGATCAG
GCGCTACAACTGGGCCTGCCCAAGGTGTTTGCAAAGTTTCGGACGTGGGCTGGCCTGGACGGCAGGGATAGCGGT
CGGCCTCCGGGACTGCTTGCGCGATGGCTGCACCCCGAGGAATACGAAGACTTTGTGGCGCTACGTCGGACGCTC
CTCCTGGAGGAAGAAGACGTGGGAGACAGTGAACAAGTCAGCAAGACGAGTAGAGGGAGCAAGAGCAAGAGCAAA
AAGCTTATGGGGTACCTGCCGCCAGAGACGTGGATGCCGCGGCCGACGCTGTGGATTCCGCGGGATGAGGCGCGT
GTAAGTCGACAAGAGGTTGCGCATACGCGCAAGGTGACACCCATTTCGGACAAGGGGGCTTACTTGGACGGCAAG
GGAAGGATTGTGGTGCATTTTGATGAGGCACCTTTTACAGATGAGCGGGATCCGTGA
Transcript >OphauB2|79
ATGGCCGAGACGTGGGCTATCGAGGCCCGCGGCATTCTCGACATCTTTAAAGGCGGCAACGACCCGCGTGTTGGT
TCGGGCCGCCAAGACTCATCCGGCGGCGGCACTCTAAGCACAGCGTCTGGCAGCAAGTCGTCTTCCTTGGGCAAA
CTCGGTGCCACATTCATACCCGTCGTCATCTATCTTGCCATCTGCATTGTCGCCTTTACTGTATTGCGCCGTCGC
TTCCCTCGCGTCTACGCCCCGCGCTCTATACCAGCCTTGCGCGCTCCCGAAAAGTCTAGTCCGGCACTTCCCTCT
GGCTGGCTTAATTGGATTGTGCCATTCTTTAAGATACCCGACACCTTTCTCCTTGCCCATGGCACCCTTGACGCC
TTTTTTTTCCTGCGCTTTCTCAAGGTGCTCCGCAATGTCTGCCTCGGTGGTTGTGTCATCCTGTGGCCTGTTCTC
TTCCCCATCCACGCCACTGGGGGAGGCGGCCTCTCCGAACTCGATCTCTTGACCATTGGAAATGTCAAGGACTCA
TCAAAGCTGTACGCACATGCCGCCATGGCATGGGTTTTTTTTGGTTTCGTGCTTTACATGATTGTGCGAGAGTGC
ATCTTTTATGTCAACCTTCGCCAGACAATCATGTCGTCGCCCAGCTATGCGCGTCGTCTCTCATCTCGTACCATG
CTATTGACTTCGGTGCCGAGCGAATATCTCAGCGAGCGACGCCTCCGCAAACTCTACGGTCCTTCTGTTCGTCGC
GTCTTTATCCCGAGTACCACCAAGGCTCTCGCCAAGCTGGTCAAGGAGCGTGAGCAGACAGCCACAAGGCTGGAA
AGGGCCGAGGTGGAATTGATTTTGCGCGCCAACGCTGCGAGGAAAAAGCACCTCAAAAAGGCTGCCAAGTCTGGC
TCCAACGACGTGACAACGACAGACTCGGCCGCCTCGCAGCAGAATCTCGTGACCCTGTCAAGAGACGGCACTGTC
GGGCCCCTGGTCCTGGAGCTGCCTGGCTCTTACATTGAAATCGAGCCCCTGAGAGAAAAAGCCAAGACTGGCGGC
GACTCGGCTGCGCTCGACATTGGGACAAGTCCACAAGAAGCTGAGAAGGCCAATGAGGACGAGGACCCCGACTAC
ATACACCCCTATGGCCTGGAATTCTACCTTCCCGACGTTCGTGGCTCCGTCGCTGCGCGCTGGCTTCCGGTCGAG
AAACGACCCTATCATCGTCCCTTGGGTAACTTTGGCCGGCGCGTCGACACGATTCGCTGGACACGCTTGCGACTG
CGTGAACTCAACAACCACATTCATCGCATGCGCCGGCGGATTCGTCGTGGAGACTCTGGCACTACTTTGCCCGTC
GCCTTTATCGAGTTTGAGTCGCAAGAGGCGGCCCAGGCGGCACATCAAGTCCTGCCTCACCATCGGCCCTTGCGC
ATGGCAGAGCGAATAATCGGCGTTGTTCCAGGAGAAGTCATTTGGTCCTCGCTGCGCATGTCTTGGTGGGAGCGC
ATTGGCCGCCGATTCATGATTTTGTCGCTGGTTACTGCTGCCGTTGTCTTTTGGTCTGTCCCATCGGCCCTTATT
GGCCTTGTCTCCCAAATCGACTTTTTGGCGAAAAAGGTTGTTTTTCTCAGCTGGATCAAGCGTCTTCCATCCATT
GTCGTCAATTTCCTGCAGGGCTTTGTGCCTTCAATTGCCTTGTCGCTGCTCATGTCCTTGGTGCCCGTCATGCTT
CGAGTTTGCGGAGCACAAGCAGGCATCTCATCGGTAATCAAGGTTGAGCTCTTTGTACAAAACGTCTATTTTGCC
TTTCAGGTTGTTCAGGTGTTCCTCATCACCACGATTACGTCGGCCGCATCGGCCGCCCTCACAGACATTTTGCAG
AATCCAATCAAGGTCAAGGATGTGCTGGCGACCAATTTGCCCATGGCATCCAACTTTTACCTGTCGTATATTCTG
GTGCAGTGTGTGGTTAGCAGCGGCACCAACCTGCTTCAGGTCTTTTCCCTCATCCGACATACAGTACACGCCAAA
TTTACCAAGCTCCCTCGTGCACGTCTTGTTGCATGGCGGCGCCTGCGTTCTCCTCGCTGGGGCGGTGTGTTTCCC
GTGTTTGCAAACATGGGAGTCATTGCCCTTAGTTATGCGTGCATTGCGCCACTTATACTCATTTTTGCGGCTGGT
GGCATGGCCATTATTCGCATCGTCTGGCGATATAATGTCATTTTCGTCATGGACTCTTCGTCGGACAGCAAGGGA
CTATTTTACCCCCGGGCACTTCTTCATCTCACCATTGGCCTGTACCTGGCCGAGATTTGTCTAATTGGTCTCTTT
GCCCTACATCTAGCGTTTGGACCTCTTGCCATGATGGTCTTGTTCTTCCTCTTTACCGGCCTGGTGCATGTTTCG
CTGCGAGATGCTATTCAGCCCCTGCTTCAGAATCTGCCACAGACACTGGCAATGGAGGAGGACGTTCAGCGCGAA
GATAAAGAGGCAGCAGAGCTGGCAAGGAGGCAGGCTGCTGCGAGAACGTCTGAAGAAGCAGCAGCAGCAACAGGG
GCTGCGTCAAGCTACTATGATGCAAATCAAGTGTTTGGAGAGGAGGAGGAGGAGGGGTTTGGAGGACACCAAGAC
TGGAATACGGACGGCGAAACTGAAGATGAAGAGGAGGGTGCGGAACACGGCCCCGTGACGGGCACGCGTGCCCTC
GAAGGCGCCAGCAGCGTTCGATCGGCGGTTGGGGAATGGTTCAAGATGAGCACCAAGTCCAAGATTCGCGATCAG
GCGCTACAACTGGGCCTGCCCAAGGTGTTTGCAAAGTTTCGGACGTGGGCTGGCCTGGACGGCAGGGATAGCGGT
CGGCCTCCGGGACTGCTTGCGCGATGGCTGCACCCCGAGGAATACGAAGACTTTGTGGCGCTACGTCGGACGCTC
CTCCTGGAGGAAGAAGACGTGGGAGACAGTGAACAAGTCAGCAAGACGAGTAGAGGGAGCAAGAGCAAGAGCAAA
AAGCTTATGGGGTACCTGCCGCCAGAGACGTGGATGCCGCGGCCGACGCTGTGGATTCCGCGGGATGAGGCGCGT
GTAAGTCGACAAGAGGTTGCGCATACGCGCAAGGTGACACCCATTTCGGACAAGGGGGCTTACTTGGACGGCAAG
GGAAGGATTGTGGTGCATTTTGATGAGGCACCTTTTACAGATGAGCGGGATCCGTGA
Gene >OphauB2|79
ATGGCCGAGACGTGGGCTATCGAGGCCCGCGGCATTCTCGACATCTTTGTGCGTGTGGCCCTTGGAACAAACATG
AACCAACATGTGCAAAAGGCCTTGTTGTTGGCACTAACCCACTGCAAATAGAAAGGCGGCAACGACCCGCGTGTT
GGTTCGGGCCGCCAAGACTCATCCGGCGGCGGCACTCTAAGCACAGCGTCTGGCAGCAAGTCGTCTTCCTTGGGC
AAACTCGGTGCCACATTCATACCCGTCGTCATCTATCTTGCCATCTGCATTGTCGCCTTTACTGTATTGCGCCGT
CGCTTCCCTCGCGTCTACGCCCCGCGCTCTATACCAGCCTTGCGCGCTCCCGAGTTTGTCTCTCTTGTGCCTGCT
GGTCCTTTTTCATGCTCACCTTTCATTGCAGAAAGTCTAGTCCGGCACTTCCCTCTGGCTGGCTTAATTGGATTG
TGCCATTCTTTAAGATACCCGACACCTTTCTCCTTGCCCATGGCACCCTTGACGCCTTTTTTTTCCTGCGCTTTC
TCAAGGTGCTCCGCAATGTCTGCCTCGGTGGTTGTGTCATCCTGTGGCCTGTTCTCTTCCCCATCCACGCCACTG
GGGGAGGCGGCCTCTCCGAACTCGATCTCTTGACCATTGGAAATGTCAAGGACTCATCAAAGCTGTACGCACATG
CCGCCATGGCATGGGTTTTTTTTGGTGTGTTGGCCCTTTGCCGCTGCGCTCGAGCGCAACAAGCTAATCATGACA
CAAGGTTTCGTGCTTTACATGATTGTGCGAGAGTGCATCTTTTATGTCAACCTTCGCCAGACAATCATGTCGTCG
CCCAGCTATGCGCGTCGTCTCTCATCTCGTACCATGCTATTGACTTCGGTGCCGAGCGAATATCTCAGCGAGCGA
CGCCTCCGCAAACTCTACGGTCCTTCTGTTCGTCGCGTCTTTATCCCGAGTACCACCAAGGCTCTCGCCAAGCTG
GTCAAGGAGCGTGAGCAGACAGCCACAAGGCTGGAAAGGGCCGAGGTGGAATTGATTTTGCGCGCCAACGCTGCG
AGGAAAAAGCACCTCAAAAAGGCTGCCAAGTCTGGCTCCAACGACGTGACAACGACAGACTCGGCCGCCTCGCAG
CAGAATCTCGTGACCCTGTCAAGAGACGGCACTGTCGGGCCCCTGGTCCTGGAGCTGCCTGGCTCTTACATTGAA
ATCGAGCCCCTGAGAGAAAAAGCCAAGACTGGCGGCGACTCGGCTGCGCTCGACATTGGGACAAGTCCACAAGAA
GCTGAGAAGGCCAATGAGGACGAGGACCCCGACTACATACACCCCTATGGCCTGGAATTCTACCTTCCCGACGTT
CGTGGCTCCGTCGCTGCGCGCTGGCTTCCGGTCGAGAAACGACCCTATCATCGTCCCTTGGGTAACTTTGGCCGG
CGCGTCGACACGATTCGCTGGACACGCTTGCGACTGCGTGAACTCAACAACCACATTCATCGCATGCGCCGGCGG
ATTCGTCGTGGAGACTCTGGCACTACTTTGCCCGTCGCCTTTATCGAGTTTGAGTCGCAAGAGGCGGCCCAGGCG
GCACATCAAGTCCTGCCTCACCATCGGCCCTTGCGCATGGCAGAGCGAATAATCGGCGTTGTTCCAGGAGAAGTC
ATTTGGTCCTCGCTGCGCATGTCTTGGTGGGAGCGCATTGGCCGCCGATTCATGATTTTGTCGCTGGTTACTGCT
GCCGTTGTCTTTTGGTCTGTCCCATCGGCCCTTATTGGCCTTGTCTCCCAAATCGACTTTTTGGCGAAAAAGGTT
GTTTTTCTCAGCTGGATCAAGCGTCTTCCATCCATTGTCGTCAATTTCCTGCAGGGCTTTGTGCCTTCAATTGCC
TTGTCGCTGCTCATGTCCTTGGTGCCCGTCATGCTTCGAGGTGCGTAGTCTCACTTTTCTACACGGGCTCACTTT
AACAGGCTAACGACTCGACATAGTTTGCGGAGCACAAGCAGGCATCTCATCGGTAATCAAGGTTGAGCTCTTTGT
ACAAAACGTCTATTTTGCCTTTCAGGTTGTTCAGGTGTTCCTCATCACCACGATTACGTCGGCCGCATCGGCCGC
CCTCACAGACATTTTGCAGAATCCAATCAAGGTCAAGGATGTGCTGGCGACCAATTTGCCCATGGCATCCAACTT
TTACCTGTCGTATATTCTGGTGCAGTGTGTGGTTAGCAGCGGCACCAACCTGCTTCAGGTCTTTTCCCTCATCCG
ACATACAGTACACGCCAAATTTACCAAGCTCCCTCGTGCACGTCTTGTTGCATGGCGGCGCCTGCGTTCTCCTCG
CTGGGGCGGTGTGTTTCCCGTGTTTGCAAACATGGGAGTCATTGGTATGCCATTTGACGTCTTTTTTCTCTCTTT
CTTCTTGTGGAAAATACGGGCATCTCAGTTAACCTTTTGTTGATAGCCCTTAGTTATGCGTGCATTGCGCCACTT
ATACTCATTTTTGCGGCTGGTGGCATGGCCATTATTCGCATCGTCTGGCGATATAATGTCATTTTCGTCATGGAC
TCTTCGTCGGACAGCAAGGGACTATTTTACCCCCGGGCACTTCTTCATCTCACCATTGGCCTGTACCTGGCCGAG
ATTTGTCTAATTGGTCTCTTTGCCCTACATCTAGCGTTTGGACCTCTTGCCATGATGGTCTTGTTCTTCCTCTTT
ACCGGCCTGGTGCATGTTTCGCTGCGAGATGCTATTCAGCCCCTGCTTCAGAATCTGCCACAGACACTGGCAATG
GAGGAGGACGTTCAGCGCGAAGATAAAGAGGCAGCAGAGCTGGCAAGGAGGCAGGCTGCTGCGAGAACGTCTGAA
GAAGCAGCAGCAGCAACAGGGGCTGCGTCAAGCTACTATGATGCAAATCAAGTGTTTGGAGAGGAGGAGGAGGAG
GGGTTTGGAGGACACCAAGACTGGAATACGGACGGCGAAACTGAAGATGAAGAGGAGGGTGCGGAACACGGCCCC
GTGACGGGCACGCGTGCCCTCGAAGGCGCCAGCAGCGTTCGATCGGCGGTTGGGGAATGGTTCAAGATGAGCACC
AAGTCCAAGATTCGCGATCAGGCGCTACAACTGGGCCTGCCCAAGGTGTTTGCAAAGTTTCGGACGTGGGCTGGC
CTGGACGGCAGGGATAGCGGTCGGCCTCCGGGACTGCTTGCGCGATGGCTGCACCCCGAGGAATACGAAGACTTT
GTGGCGCTACGTCGGACGCTCCTCCTGGAGGAAGAAGACGTGGGAGACAGTGAACAAGTCAGCAAGACGAGTAGA
GGGAGCAAGAGCAAGAGCAAAAAGCTTATGGGGTACCTGCCGCCAGAGACGTGGATGCCGCGGCCGACGCTGTGG
ATTCCGCGGGATGAGGCGCGTGTAAGTCGACAAGAGGTTGCGCATACGCGCAAGGTGACACCCATTTCGGACAAG
GGGGCTTACTTGGACGGCAAGGGAAGGATTGTGGTGCATTTTGATGAGGCACCTTTTACAGATGAGCGGGATCCG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail