Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7882
Gene name
LocationContig_9:203734..211476
Strand-
Gene length (bp)7742
Transcript length (bp)7605
Coding sequence length (bp)7605
Protein length (aa) 2535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase 2.6E-24 2275 2446
PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase 1.4E-06 2445 2500
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 2.2E-26 858 1062
PF01363 FYVE FYVE zinc finger 1.6E-14 434 496

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 1926 2503 1.0E-131
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 2113 2510 1.0E-130
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 811 1643 1.0E-121
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 2123 2509 1.0E-77
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 2157 2509 3.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 1926 2503 1.0E-131
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 2113 2510 1.0E-130
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 811 1643 1.0E-121
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 2123 2509 1.0E-77
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 2157 2509 3.0E-75
sp|Q9SSJ8|FAB1C_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C OS=Arabidopsis thaliana GN=FAB1C PE=2 SV=1 2153 2509 7.0E-75
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 2216 2509 6.0E-69
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 817 1587 6.0E-69
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 2221 2509 2.0E-68
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 1200 1650 5.0E-67
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 2187 2514 7.0E-63
sp|Q9XID0|FAB1D_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D OS=Arabidopsis thaliana GN=FAB1D PE=3 SV=1 2152 2509 7.0E-62
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 812 1083 1.0E-57
sp|Q9SSJ8|FAB1C_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C OS=Arabidopsis thaliana GN=FAB1C PE=2 SV=1 818 1694 1.0E-53
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 2267 2509 4.0E-53
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 799 1086 5.0E-47
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 801 1081 5.0E-42
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 810 1085 9.0E-40
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 803 1085 6.0E-38
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 816 1082 2.0E-35
sp|Q9LKI7|TCPG_THAWE T-complex protein 1 subunit gamma OS=Thalassiosira weissflogii PE=2 SV=1 858 1078 1.0E-23
sp|P50143|TCPG_XENLA T-complex protein 1 subunit gamma OS=Xenopus laevis GN=cct3 PE=2 SV=2 835 1112 1.0E-22
sp|Q4R963|TCPG_MACFA T-complex protein 1 subunit gamma OS=Macaca fascicularis GN=CCT3 PE=2 SV=1 835 1112 2.0E-21
sp|P54408|TCPG_TETPY T-complex protein 1 subunit gamma OS=Tetrahymena pyriformis PE=3 SV=1 862 1112 2.0E-21
sp|Q3T0K2|TCPG_BOVIN T-complex protein 1 subunit gamma OS=Bos taurus GN=CCT3 PE=1 SV=1 835 1112 3.0E-21
sp|P49368|TCPG_HUMAN T-complex protein 1 subunit gamma OS=Homo sapiens GN=CCT3 PE=1 SV=4 835 1112 5.0E-21
sp|Q5NVF9|TCPG_PONAB T-complex protein 1 subunit gamma OS=Pongo abelii GN=CCT3 PE=2 SV=1 835 1112 5.0E-21
sp|Q6P502|TCPG_RAT T-complex protein 1 subunit gamma OS=Rattus norvegicus GN=Cct3 PE=1 SV=1 835 1112 6.0E-21
sp|P39077|TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT3 PE=1 SV=2 838 1077 6.0E-21
sp|P80318|TCPG_MOUSE T-complex protein 1 subunit gamma OS=Mus musculus GN=Cct3 PE=1 SV=1 835 1112 8.0E-21
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 428 512 9.0E-21
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 1320 1569 1.0E-20
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 1307 1587 2.0E-20
sp|Q54TH8|TCPG_DICDI T-complex protein 1 subunit gamma OS=Dictyostelium discoideum GN=cct3 PE=1 SV=1 862 1074 4.0E-20
sp|Q9XID0|FAB1D_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D OS=Arabidopsis thaliana GN=FAB1D PE=3 SV=1 807 1080 5.0E-20
sp|Q84WV1|TCPG_ARATH T-complex protein 1 subunit gamma OS=Arabidopsis thaliana GN=CCT3 PE=1 SV=1 850 1109 7.0E-20
sp|P48605|TCPG_DROME T-complex protein 1 subunit gamma OS=Drosophila melanogaster GN=Cctgamma PE=2 SV=2 831 1078 2.0E-19
sp|O74341|TCPG_SCHPO T-complex protein 1 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct3 PE=1 SV=1 831 1064 4.0E-19
sp|O00782|TCPG_OXYGR T-complex protein 1 subunit gamma OS=Oxytricha granulifera PE=3 SV=1 836 1085 9.0E-17
sp|O26320|THSA_METTH Thermosome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsA PE=3 SV=2 846 1068 8.0E-15
sp|O24730|THSB_THEK1 Thermosome subunit beta OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsB PE=3 SV=2 839 1071 1.0E-14
sp|Q52500|THSB_THEKO Thermosome subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsB PE=3 SV=1 839 1071 1.0E-14
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 350 561 2.0E-14
sp|Q9YDK6|THSA_AERPE Thermosome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsA PE=3 SV=2 855 1056 2.0E-14
sp|P50016|THS_METKA Thermosome subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ths PE=3 SV=1 846 1068 6.0E-14
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 429 495 8.0E-14
sp|O57762|THS_PYRHO Thermosome subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ths PE=3 SV=1 869 1071 9.0E-14
sp|Q9V2Q7|THS_PYRAB Thermosome subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ths PE=3 SV=1 869 1071 2.0E-13
sp|O26885|THSB_METTH Thermosome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=thsB PE=3 SV=1 839 1068 3.0E-13
sp|O24732|THSB_THEK8 Thermosome subunit beta OS=Thermococcus sp. (strain KS-8) GN=thsB PE=3 SV=1 839 1071 3.0E-13
sp|Q53546|THS_DESSY Thermosome subunit OS=Desulfurococcus sp. (strain SY) GN=ths PE=3 SV=1 839 1071 7.0E-13
sp|Q8SR76|TCPG_ENCCU T-complex protein 1 subunit gamma OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT3 PE=1 SV=1 864 1062 8.0E-13
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 1287 1617 2.0E-12
sp|O28045|THSA_ARCFU Thermosome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsA PE=3 SV=1 869 1068 2.0E-12
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 431 514 3.0E-12
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 431 514 3.0E-12
sp|P48424|THSA_THEAC Thermosome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsA PE=1 SV=1 869 1068 3.0E-12
sp|O24731|THSA_THEK8 Thermosome subunit alpha OS=Thermococcus sp. (strain KS-8) GN=thsA PE=3 SV=1 845 1078 3.0E-12
sp|Q58405|THS_METJA Thermosome subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ths PE=3 SV=1 839 1068 7.0E-12
sp|B3P851|LST2_DROER Lateral signaling target protein 2 homolog OS=Drosophila erecta GN=GG12136 PE=3 SV=1 428 491 7.0E-12
sp|B4PRU6|LST2_DROYA Lateral signaling target protein 2 homolog OS=Drosophila yakuba GN=GE10583 PE=3 SV=1 428 491 7.0E-12
sp|Q9VB70|LST2_DROME Lateral signaling target protein 2 homolog OS=Drosophila melanogaster GN=CG6051 PE=1 SV=3 428 491 7.0E-12
sp|P46219|THSA_SULSH Thermosome subunit alpha OS=Sulfolobus shibatae GN=thsA PE=1 SV=1 869 1078 8.0E-12
sp|B4IC49|LST2_DROSE Lateral signaling target protein 2 homolog OS=Drosophila sechellia GN=GM10129 PE=3 SV=1 428 491 9.0E-12
sp|O28821|THSB_ARCFU Thermosome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thsB PE=3 SV=1 868 1057 9.0E-12
sp|Q9V2S9|THSA_SULSO Thermosome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsA PE=3 SV=2 869 1078 1.0E-11
sp|P61111|THSA_THEKO Thermosome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thsA PE=1 SV=1 845 1078 1.0E-11
sp|P61112|THSA_THEK1 Thermosome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=thsA PE=1 SV=1 845 1078 1.0E-11
sp|B4G2G5|LST2_DROPE Lateral signaling target protein 2 homolog OS=Drosophila persimilis GN=GL23610 PE=3 SV=1 434 491 3.0E-11
sp|B4K982|LST2_DROMO Lateral signaling target protein 2 homolog OS=Drosophila mojavensis GN=GI24295 PE=3 SV=1 434 491 3.0E-11
sp|B4NFJ7|LST2_DROWI Lateral signaling target protein 2 homolog OS=Drosophila willistoni GN=GK22512 PE=3 SV=1 434 491 3.0E-11
sp|B3MT31|LST2_DROAN Lateral signaling target protein 2 homolog OS=Drosophila ananassae GN=GF22946 PE=3 SV=1 434 491 3.0E-11
sp|B4M140|LST2_DROVI Lateral signaling target protein 2 homolog OS=Drosophila virilis GN=GJ23073 PE=3 SV=1 434 491 4.0E-11
sp|P48425|THSB_THEAC Thermosome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thsB PE=1 SV=1 860 1068 4.0E-11
sp|Q9V2T3|THSB_DESMO Thermosome subunit beta (Fragment) OS=Desulfurococcus mobilis GN=thsB PE=3 SV=1 866 1048 5.0E-11
sp|Q9HH21|THSG_SULSH Thermosome subunit gamma OS=Sulfolobus shibatae GN=thsC PE=3 SV=1 862 1074 6.0E-11
sp|Q9V2T7|THSG_SULSO Thermosome subunit gamma OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsC PE=3 SV=1 862 1074 1.0E-10
sp|Q9V2T5|THSA_SULAC Thermosome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsA PE=3 SV=2 869 1074 1.0E-10
sp|O24734|THSA_SULTO Thermosome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thsA PE=1 SV=1 869 1074 1.0E-10
sp|Q9YA66|THSB_AERPE Thermosome subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=thsB PE=3 SV=2 866 1048 1.0E-10
sp|O93624|THS_METTL Thermosome subunit OS=Methanothermococcus thermolithotrophicus GN=ths PE=1 SV=1 849 1068 8.0E-10
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 406 491 9.0E-10
sp|B4JHI7|LST2_DROGR Lateral signaling target protein 2 homolog OS=Drosophila grimshawi GN=GH18624 PE=3 SV=1 434 492 1.0E-09
sp|O14964|HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens GN=HGS PE=1 SV=1 440 504 3.0E-09
sp|Q0V8S0|HGS_BOVIN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Bos taurus GN=HGS PE=2 SV=1 440 504 5.0E-09
sp|Q99LI8|HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus GN=Hgs PE=1 SV=2 440 504 5.0E-09
sp|Q9JJ50|HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus GN=Hgs PE=1 SV=1 440 504 1.0E-08
sp|Q17AN2|LST2_AEDAE Lateral signaling target protein 2 homolog OS=Aedes aegypti GN=AAEL005241 PE=3 SV=1 434 491 2.0E-08
sp|B0WAQ0|LST2_CULQU Lateral signaling target protein 2 homolog OS=Culex quinquefasciatus GN=CPIJ004116 PE=3 SV=1 434 492 2.0E-08
sp|Q4P7Q1|VPS27_USTMA Vacuolar protein sorting-associated protein 27 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=VPS27 PE=3 SV=1 427 491 2.0E-08
sp|Q7QAJ2|LST2_ANOGA Lateral signaling target protein 2 homolog OS=Anopheles gambiae GN=AGAP003678 PE=3 SV=6 434 491 2.0E-08
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein kinase slob1 OS=Dictyostelium discoideum GN=slob1 PE=3 SV=1 429 491 2.0E-08
sp|A0JMD2|LST2_DANRE Lateral signaling target protein 2 homolog OS=Danio rerio GN=zfyve28 PE=2 SV=1 434 491 2.0E-08
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 1319 1614 3.0E-08
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 1315 1533 3.0E-08
sp|Q9ASS2|FREE1_ARATH Protein FREE1 OS=Arabidopsis thaliana GN=FREE1 PE=1 SV=1 431 499 3.0E-08
sp|Q0P4S0|LST2_XENTR Lateral signaling target protein 2 homolog OS=Xenopus tropicalis GN=zfyve28 PE=2 SV=1 434 491 3.0E-08
sp|Q9SUI2|PI5K7_ARATH Phosphatidylinositol 4-phosphate 5-kinase 7 OS=Arabidopsis thaliana GN=PIP5K7 PE=1 SV=1 2282 2442 4.0E-08
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 434 508 5.0E-08
sp|Q9HCC9|LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3 434 491 5.0E-08
sp|Q5ABD9|VPS27_CANAL Vacuolar protein sorting-associated protein 27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS27 PE=3 SV=1 434 549 5.0E-08
sp|Q6ZPK7|LST2_MOUSE Lateral signaling target protein 2 homolog OS=Mus musculus GN=Zfyve28 PE=1 SV=2 434 491 5.0E-08
sp|Q9V2T8|THSB_SULSO Thermosome subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=thsB PE=3 SV=2 869 1061 1.0E-07
sp|P28488|THSB_SULSH Thermosome subunit beta OS=Sulfolobus shibatae GN=thsB PE=1 SV=1 869 1061 1.0E-07
sp|Q96T51|RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens GN=RUFY1 PE=1 SV=2 427 504 2.0E-07
sp|Q8L850|PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9 OS=Arabidopsis thaliana GN=PIP5K9 PE=1 SV=2 2282 2442 3.0E-07
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 429 470 4.0E-07
sp|Q9V2T4|THSB_SULAC Thermosome subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=thsB PE=3 SV=2 869 1061 4.0E-07
sp|Q8SR53|TCPH_ENCCU T-complex protein 1 subunit eta OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCT7 PE=1 SV=1 856 1057 5.0E-07
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 429 471 6.0E-07
sp|Q9TZD0|LST2_CAEEL Lateral signaling target protein 2 OS=Caenorhabditis elegans GN=lst-2 PE=2 SV=2 434 491 6.0E-07
sp|A8XJZ8|LST2_CAEBR Lateral signaling target protein 2 OS=Caenorhabditis briggsae GN=lst-2 PE=3 SV=1 434 491 8.0E-07
sp|Q8BIJ7|RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus GN=Rufy1 PE=1 SV=1 434 504 9.0E-07
sp|Q54LD5|ADCD_DICDI Arrestin domain-containing protein D OS=Dictyostelium discoideum GN=adcD PE=3 SV=1 434 495 1.0E-06
sp|P42943|TCPH_YEAST T-complex protein 1 subunit eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCT7 PE=1 SV=1 862 1068 3.0E-06
sp|P87153|TCPH_SCHPO Probable T-complex protein 1 subunit eta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cct7 PE=1 SV=1 861 1072 7.0E-06
sp|Q5ZJK8|TCPH_CHICK T-complex protein 1 subunit eta OS=Gallus gallus GN=CCT7 PE=1 SV=1 861 1048 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046488 phosphatidylinositol metabolic process Yes
GO:0046872 metal ion binding Yes
GO:0016307 phosphatidylinositol phosphate kinase activity Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding No
GO:0043169 cation binding No
GO:0097367 carbohydrate derivative binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0044255 cellular lipid metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0006629 lipid metabolic process No
GO:0043168 anion binding No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0046486 glycerolipid metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0036094 small molecule binding No
GO:0019637 organophosphate metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0006650 glycerophospholipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7882
MGDKTAPKPLTGSPGSASRSSLTSFRPRRGSINSMSTSSMVDKEQLAHALDKIHTSASQCDSLTTFNDFAPPPEG
LPPPESRGSAGELVQHGLSGLYTRFREAVGGSSPTKTIVRESALHVDHTDAVPKRTSATDGHSSRPSVSSLSRGD
THVSASSAGLASPSVPTSDLSPASLTPATSDSRSQMSQSAKATSISLMTGQKLHGTGRQSLPTKATSAVIAADPT
IAPPPIINRDVGRGTARNDEGGASTPVRKSISRADMHVHMPAVDASSPRVYDGQDGKLPPRCSRDESSSSQTSVE
TPLSPVKGIAITPTPANQSLHTHSSSTVSSLLPSDDKTRRKPAVIDRISRSRSPMRRGTRLSSPDRGTAKASPVN
TSAHNSVQHNSFTPETHSRHRPSSSDRIPGTTAGQDRASEQMNAQLDRMRRQVLSKEFWMKDDTVKECFLCQTPF
TAFRRKHHCRTCGCIFDSKCTTLVSGEKFGVAGSLRVCKNCLDVISRRLDASASDDSGDERSFLPRIFGPTHSHS
KGSSGASHSKSRDHQDVVLGSEGSEDARPGSTPMMTIPATRRVRESNRSSAVLEIDAFHQLSRPGSSRSLKSLST
ARPQSSGHKRHHSKHGFLGRFKGVPQLPPPEDRAPFRKGIDDESAKKSKFPAFHDDNIIDPELADYMSEDTSGDE
QVSIFATMGTSDLPSASFDSERPGFSPFVNATRKHRHRAGDKSISGMSYVSRGAFDDTNGASGLASHRRSTRRRN
LSNVSGSVHHLASPRPKSGIYKGPSASSEMLFALDSPSQAGTSLMPMNDVLHTRKGNKQELNQSSLSHVNKLLHQ
LLEDGGISPLSAWKKALVPILLQLTDDVTPDVAKGEDMDIRHYVKLKRIPGGRPGDTTYVSGVVFTKNLALKSMP
RRIASPRIVLVTFPIEYQRHQQQLMSLQPVIEQEKEYLRVVVQRITNLRPHVLLAQKGVSGVALQYLSEANIAVA
YNVKDTVIEAVARCAEAEIIETVDMLALPVRVGKCSTFEVRTFVNNDYPGRKKSYIFLSGCRADLGCTIALRGSN
NSVLSKMKHIMDFMVYVVYNLKLEMSLLRDESVDPPDATGDTSSVSSSLHAMNDSFRSWSSASGTECGNRGLGLT
TAASKLPGDGEATSQTPEEVPCSSINEDGETLIDHDNKKQPISQVAIERSKLISLHEHHASHDSQVPDDVPMPTF
YSEMVAKYETKILSASPYVKFKQPYLLMRAREQERRLLYLRRLRDQDAVEEDSDKSGPQRFQLIKPEMVEKIGQK
APRQIMEILHAVHDAEYDKALFNYQTQTRQWEAYIQGNLDLFDPYSHQNMVVLYSVTCTETKIPCLEPSLVAINF
YDEQHVDTGMDPDCTLGQYIEDLALSKDDICNSNGCEKTMAEHHRTYVHDQYRVTAFVENILPSFGPRHPELGEG
VTMWTYCKICKKDSRETAMSEATFKYSFGKYLELLFWGRGLRMKNSMECPHQGHGDLVRYFNMGDSRIRIHCDPI
DLLEIVVPRARITWKVVNDLRLKNEVYTRMEERWSKFMASVRARLKSIRIDSVLPEKAESCKAEVERLMKKTQEE
QPAMVRQLQGIYVNSKYYEVMPFNSLVREMLEKAGEWDQAFAKLEADFLGDKDMRQLTIMQLRKMFTDNESKESE
VASVSTIDHEERSSQEALEPDEKAAAQVAGRADSVLSGEKADMERSMEEKQTGAQKGHEEVAKVPGDVVAATDAQ
GESTMPTMVKTESALTIPRVSDSMKEELAGCSSSNDEQPPSPSQVVDAAAAVASAAVSASPRPPASPTGLGRSPT
GSSLSGQSFSDKVDLVRREQASCPGADGQDSQSDVARPRSERSNGRNSISGASMPMVRTASHPTRPLPTRTQSSL
VKPLAVREARALSGMSSTDLPGQQQVAEGSVKADKKLSDRLGLGALKHRSKGTTSSIPRLVHKKRESRVSTLARH
FEQLSREFEKERIRDRKQRAANLRQPRARLPRTSTKAIVQVYDDVNQAFEEPPVSTEQPVEPIKEEQRQTSVTPN
SGMTEVPACEAPSRPRSPTTGNIVPPAENLRPTDDNDDTSVANTSQMASDEEAGASDGEALVCDDFLPDIKEIAD
ALEPSTEIPLELPKHQKTSLMKYLTNFWAERSASGWPPLEYPVNATDHIFVDSDIIVREDEPSSVIALALNSEDY
KEKLANIRHDAQGMMQRDSEGTGDSAEPKSMPASDSADWTVDETEQEKSLLRATGTHLKYQFKEGSAIMTCKIFY
AEQFDALRRKCGVAERIIESLSRCLKWDSKGGKTKSVFLKTLDDRLVLKSLSPVETSAFLRFAPGYFSIMAEALF
HDLPSVIAKMLGFFQVIIKNSMTGTDIKLDLLVTENLFYDRTPSRIFDLKGSMRNRKIQSTGEQNEVLLDENMVE
YIYESPLFAREHSKKLLRASVWNDTLFLAKQNVMDYSLMIAVDEEKKELVVGIIDCIRTYTWDKKLESWIKDRGF
AGGRNRPTVTSPKEYKSRFREAMARYILQAPNCWHLFNHPQYPAYSGRARFEEPETHGQ*
Coding >OphauB2|7882
ATGGGGGACAAGACAGCTCCCAAGCCCTTGACCGGCTCTCCAGGCTCGGCGTCGCGGAGCTCGCTGACGAGCTTT
CGCCCGCGCCGCGGCTCCATCAATTCCATGTCGACCAGCTCCATGGTGGACAAGGAACAGCTTGCCCATGCGCTG
GACAAGATACACACGTCGGCCAGCCAATGTGACTCGCTGACCACGTTCAATGATTTTGCCCCGCCTCCCGAAGGT
CTTCCGCCTCCCGAAAGCCGTGGTTCTGCAGGCGAGCTTGTCCAGCACGGCCTGAGCGGCCTTTATACGCGCTTT
CGAGAGGCCGTTGGAGGCTCCAGTCCCACCAAGACGATTGTGCGCGAGAGCGCCCTTCATGTCGACCATACAGAT
GCCGTGCCCAAGCGCACGTCGGCCACGGATGGCCATTCCTCTCGGCCCTCTGTTTCCTCGCTCAGCCGAGGCGAC
ACCCATGTCTCGGCTTCGAGCGCTGGCTTGGCCTCTCCTTCCGTGCCCACGTCTGACTTGTCTCCAGCCAGCCTT
ACGCCCGCCACGTCGGACAGTCGATCGCAAATGTCGCAATCGGCCAAGGCGACCAGCATCAGCCTCATGACGGGC
CAAAAGTTGCACGGAACTGGCCGCCAGAGCCTCCCGACAAAAGCCACGAGTGCCGTCATTGCCGCCGATCCCACC
ATTGCGCCGCCTCCCATCATCAACCGAGATGTTGGTCGTGGTACCGCCAGAAACGACGAGGGTGGTGCCTCGACG
CCGGTGCGCAAGAGCATCAGCAGGGCCGACATGCACGTGCATATGCCAGCAGTCGACGCCTCCTCGCCCAGGGTC
TATGACGGCCAAGATGGCAAGCTTCCTCCCAGATGCTCTCGAGACGAGAGTTCGAGCAGCCAAACCAGCGTCGAG
ACACCTCTTAGCCCAGTCAAGGGAATCGCCATTACCCCAACTCCCGCAAACCAATCTCTGCATACTCATAGCTCG
TCTACCGTCTCTTCGCTGCTGCCTTCTGACGACAAGACACGGCGCAAGCCTGCCGTCATTGACAGAATCAGCCGC
TCTCGCTCTCCCATGCGCCGTGGGACCAGGCTGTCCTCGCCTGACCGCGGCACCGCAAAGGCATCTCCTGTCAAT
ACATCGGCGCACAACTCGGTTCAACACAACTCTTTTACCCCGGAAACGCATTCTCGACACCGGCCGTCGAGCAGC
GATCGAATACCTGGCACAACGGCAGGCCAAGACAGAGCATCGGAACAGATGAATGCGCAGCTGGACAGAATGCGC
AGACAGGTTTTGAGCAAGGAGTTTTGGATGAAGGACGATACAGTCAAGGAGTGCTTTCTCTGCCAGACGCCCTTT
ACGGCTTTTCGAAGGAAGCACCACTGCCGCACGTGTGGGTGCATCTTTGATTCAAAATGCACAACACTTGTTTCT
GGCGAGAAGTTTGGTGTTGCAGGCTCCCTGAGGGTCTGCAAGAACTGTCTAGACGTTATTAGTCGACGCCTTGAT
GCCAGCGCATCTGATGACTCTGGAGACGAACGCTCCTTCTTGCCCAGAATATTCGGGCCAACTCATAGTCATTCA
AAGGGATCTAGTGGTGCCAGTCACTCCAAGTCGAGAGATCATCAGGATGTAGTACTGGGCTCTGAGGGATCTGAA
GATGCGCGGCCGGGTTCGACGCCCATGATGACTATCCCAGCCACTCGCCGCGTTCGCGAATCAAACCGCTCATCT
GCTGTGTTGGAGATTGATGCCTTTCACCAGCTCAGCCGTCCTGGGTCTTCACGTTCTCTCAAGTCTCTGAGCACA
GCGCGCCCACAGTCTTCTGGTCATAAGCGCCATCATTCCAAACATGGCTTTCTCGGCCGCTTCAAGGGCGTCCCC
CAGTTGCCTCCACCAGAAGATCGTGCCCCATTTAGAAAGGGCATTGACGATGAAAGCGCCAAGAAGTCAAAGTTT
CCAGCGTTTCATGATGACAACATCATTGACCCTGAACTGGCCGACTACATGTCCGAGGACACGAGCGGAGACGAA
CAAGTGAGCATCTTTGCCACCATGGGCACGTCTGATTTACCGTCGGCCAGCTTTGACAGCGAAAGGCCTGGCTTT
TCGCCATTTGTAAACGCCACGCGCAAGCATCGCCATAGGGCTGGCGACAAGAGCATAAGTGGCATGAGTTACGTC
AGCAGGGGGGCGTTTGATGATACCAATGGCGCTTCGGGACTTGCGAGTCATCGGCGATCGACACGACGACGAAAC
CTAAGCAACGTGAGTGGTAGTGTTCATCACTTGGCATCTCCGCGGCCAAAGTCGGGCATCTATAAGGGCCCTTCG
GCTTCATCAGAGATGCTGTTTGCTCTTGACTCTCCAAGTCAGGCCGGGACAAGCCTGATGCCGATGAATGATGTC
CTGCACACACGCAAGGGCAACAAACAAGAGCTGAACCAGTCGAGTCTCTCCCATGTCAACAAATTGCTCCATCAG
CTTCTGGAAGATGGTGGCATATCGCCCTTATCGGCATGGAAGAAGGCGCTGGTTCCCATCTTACTGCAGCTTACT
GATGACGTGACGCCTGATGTAGCCAAGGGCGAGGACATGGACATTCGACATTATGTCAAGCTCAAGCGCATCCCA
GGAGGCCGCCCCGGCGATACGACGTACGTGTCAGGCGTCGTCTTCACCAAGAACCTGGCACTCAAGAGTATGCCG
CGGCGAATCGCCAGCCCGCGCATCGTTCTCGTTACCTTTCCCATTGAGTATCAGCGTCACCAGCAGCAACTTATG
AGCTTGCAGCCAGTGATAGAACAGGAAAAGGAATACCTCCGAGTCGTGGTGCAACGAATTACGAATTTGCGGCCA
CACGTCTTGCTGGCGCAAAAGGGCGTGTCTGGAGTGGCCTTGCAGTATCTCTCCGAAGCCAACATTGCCGTGGCC
TATAATGTCAAGGATACTGTGATTGAAGCCGTGGCTCGCTGTGCCGAAGCCGAAATCATTGAGACTGTCGACATG
CTGGCATTGCCCGTCCGCGTCGGTAAGTGCTCGACGTTTGAAGTTAGAACCTTTGTCAACAACGACTATCCTGGC
CGCAAGAAGTCATATATTTTTCTTTCGGGATGCAGAGCAGACTTGGGCTGTACCATTGCACTACGGGGCTCCAAC
AACTCGGTTCTCAGCAAGATGAAGCATATCATGGACTTTATGGTCTATGTCGTCTACAACCTCAAACTTGAAATG
AGTCTTTTGAGAGACGAGTCTGTCGATCCGCCAGATGCTACCGGGGATACTTCCTCAGTGTCAAGCTCCTTGCAT
GCTATGAATGATAGCTTCAGGTCATGGAGCTCAGCGAGCGGGACAGAATGCGGCAACAGAGGCCTCGGCCTAACA
ACAGCAGCAAGCAAGCTTCCTGGAGACGGAGAGGCAACTTCGCAGACCCCCGAAGAGGTGCCATGCTCTAGCATC
AATGAGGATGGCGAGACATTGATAGACCACGACAATAAGAAGCAGCCAATATCACAAGTTGCCATTGAAAGATCA
AAGCTCATCTCGCTGCACGAGCATCATGCATCTCACGACAGTCAGGTACCCGATGACGTGCCCATGCCTACGTTT
TACAGCGAAATGGTGGCCAAGTACGAAACAAAGATTCTCTCGGCATCGCCATATGTCAAGTTTAAGCAGCCCTAC
TTGCTCATGAGGGCGCGCGAACAAGAGCGGCGTTTGCTGTATCTGCGCCGGCTCAGAGACCAAGATGCCGTCGAA
GAAGACTCGGACAAGTCTGGGCCGCAGAGGTTTCAGCTCATCAAGCCAGAGATGGTGGAAAAGATTGGCCAGAAG
GCGCCAAGGCAAATTATGGAGATTCTTCATGCTGTCCATGATGCCGAGTACGACAAGGCTCTCTTCAACTACCAG
ACCCAGACACGACAGTGGGAGGCATACATACAAGGAAACCTGGACCTTTTTGACCCCTATTCACACCAAAACATG
GTCGTCCTCTATTCCGTTACTTGCACTGAGACCAAGATTCCCTGCTTGGAGCCCAGCTTAGTCGCCATTAATTTT
TACGATGAACAGCACGTGGATACAGGCATGGATCCTGACTGCACTCTTGGACAGTATATCGAAGACTTGGCGCTC
AGCAAGGATGACATTTGTAACTCGAATGGATGCGAAAAGACCATGGCGGAGCACCATCGTACCTATGTCCATGAC
CAGTACCGCGTCACGGCCTTTGTGGAAAATATTCTCCCCAGTTTTGGTCCAAGACATCCCGAGCTTGGAGAGGGC
GTCACCATGTGGACGTATTGCAAGATTTGTAAGAAGGACTCGAGGGAGACGGCCATGTCGGAGGCGACGTTCAAG
TACTCTTTTGGCAAGTACCTTGAGCTCCTCTTTTGGGGCCGCGGCCTAAGGATGAAGAATTCGATGGAATGTCCG
CATCAAGGTCACGGAGATCTCGTCCGGTATTTCAACATGGGCGATTCCCGCATTCGCATCCACTGTGACCCCATT
GACTTGCTCGAGATTGTCGTACCTCGGGCCAGAATAACGTGGAAGGTTGTCAATGATCTCAGGCTCAAGAATGAA
GTGTACACAAGGATGGAGGAGCGGTGGAGCAAGTTCATGGCGTCAGTGCGAGCCAGGCTCAAGAGCATTCGCATT
GACAGCGTGTTGCCAGAAAAGGCCGAGTCTTGCAAGGCAGAGGTTGAGCGACTGATGAAGAAGACACAGGAAGAG
CAGCCAGCCATGGTTCGCCAGCTGCAAGGCATCTACGTCAACTCCAAGTACTACGAGGTTATGCCTTTCAACAGC
CTGGTTCGAGAAATGCTTGAAAAGGCGGGCGAGTGGGATCAAGCCTTTGCCAAGCTCGAGGCCGACTTTTTGGGC
GACAAGGACATGCGGCAGCTGACCATTATGCAACTCAGAAAGATGTTTACTGACAACGAATCCAAGGAGAGCGAG
GTTGCTAGTGTCTCGACCATTGATCACGAGGAACGCTCATCACAAGAGGCCTTGGAGCCAGATGAAAAGGCTGCC
GCTCAGGTTGCAGGACGCGCCGATAGCGTCTTGTCTGGTGAAAAAGCCGACATGGAAAGGTCAATGGAGGAGAAG
CAGACTGGAGCGCAAAAAGGCCATGAAGAGGTGGCCAAAGTGCCTGGTGACGTTGTTGCAGCAACGGATGCTCAA
GGAGAATCTACCATGCCTACCATGGTCAAGACTGAGTCTGCTCTGACAATCCCGCGGGTCTCGGACTCTATGAAA
GAGGAACTCGCCGGCTGCAGCAGTAGCAACGACGAGCAGCCGCCAAGCCCTTCCCAAGTTGTCGACGCTGCCGCA
GCCGTCGCATCGGCTGCCGTGTCAGCATCGCCGCGTCCACCGGCATCTCCAACCGGACTGGGCCGCAGCCCTACA
GGCTCATCTCTGTCTGGTCAGTCGTTTAGCGACAAGGTTGATTTGGTACGCCGCGAACAAGCATCATGCCCAGGT
GCAGATGGGCAAGACTCTCAAAGTGATGTGGCCAGGCCAAGGTCGGAACGAAGCAACGGCCGAAACTCTATTTCT
GGTGCATCGATGCCCATGGTGCGAACAGCTTCGCATCCAACACGGCCGCTGCCCACACGAACACAGTCGTCGCTG
GTGAAGCCTTTGGCTGTCAGAGAGGCGAGAGCCTTGAGCGGCATGAGTAGCACAGATTTGCCCGGGCAGCAGCAA
GTTGCCGAGGGATCGGTCAAGGCGGATAAGAAGCTCTCTGATCGGCTGGGGCTTGGTGCGCTGAAGCATCGCTCC
AAGGGAACCACGTCGAGCATCCCAAGATTGGTCCACAAGAAACGGGAATCGCGAGTCTCAACACTGGCTCGACAT
TTTGAGCAGCTTAGCCGCGAGTTTGAAAAGGAGCGCATCCGCGACCGCAAACAGCGAGCCGCAAATCTGCGGCAG
CCAAGGGCAAGGCTCCCGAGAACATCGACAAAGGCCATTGTACAGGTATACGACGATGTCAACCAGGCCTTTGAG
GAGCCTCCCGTGTCCACGGAACAACCGGTTGAGCCCATCAAGGAGGAACAGAGACAGACGAGCGTGACGCCAAAC
TCTGGAATGACTGAAGTTCCCGCTTGCGAGGCGCCGAGTAGACCTCGAAGCCCAACGACGGGCAATATAGTGCCG
CCAGCAGAGAACCTTCGACCGACCGACGACAATGACGACACGAGCGTGGCAAATACTAGCCAAATGGCATCGGAT
GAAGAGGCAGGTGCTAGCGATGGCGAAGCTCTTGTTTGTGACGACTTTTTGCCCGACATCAAGGAGATTGCCGAC
GCCTTGGAGCCGAGCACAGAGATTCCGCTAGAATTGCCAAAACACCAAAAGACGAGTCTGATGAAGTACTTGACT
AATTTCTGGGCTGAGCGATCAGCCAGTGGATGGCCACCGCTCGAGTACCCGGTAAATGCGACGGACCATATTTTT
GTTGACTCGGATATCATTGTGCGCGAAGATGAGCCGAGCTCCGTGATTGCTCTGGCTCTCAATAGCGAGGACTAC
AAGGAGAAGCTTGCAAATATTCGGCACGATGCCCAGGGAATGATGCAGCGCGACAGCGAGGGCACAGGCGACTCT
GCAGAGCCAAAGTCCATGCCAGCATCAGACAGTGCCGACTGGACGGTGGATGAGACGGAGCAGGAAAAGAGTCTT
TTGCGAGCGACGGGGACGCATCTCAAGTATCAGTTTAAAGAGGGATCAGCCATCATGACTTGCAAGATTTTTTAT
GCCGAACAGTTTGATGCGCTTCGACGAAAGTGCGGCGTTGCGGAGCGAATTATTGAGTCTCTCTCTCGCTGCTTG
AAGTGGGACTCCAAGGGTGGCAAGACCAAGTCGGTTTTCCTCAAGACGCTGGATGATCGTCTGGTTCTAAAGTCT
CTCTCCCCCGTGGAGACTTCAGCCTTTTTGCGTTTTGCCCCTGGATACTTTAGCATCATGGCCGAAGCCCTGTTT
CATGATTTGCCTTCAGTCATTGCCAAGATGCTAGGTTTCTTCCAGGTCATCATCAAGAATTCCATGACTGGCACC
GACATCAAGCTCGACTTGCTAGTGACGGAAAATCTCTTTTACGATCGAACCCCTTCTCGAATCTTTGATCTCAAG
GGGTCTATGCGCAATCGCAAGATTCAGTCGACTGGAGAGCAAAACGAGGTACTCTTGGACGAAAACATGGTTGAG
TACATTTACGAATCGCCGCTATTTGCGCGTGAGCATTCCAAGAAGCTTCTTAGGGCGTCTGTCTGGAACGATACG
CTGTTTTTGGCGAAGCAGAATGTCATGGACTACTCGCTCATGATTGCCGTTGACGAGGAAAAGAAGGAGCTGGTT
GTGGGCATCATTGACTGCATCCGGACCTACACATGGGACAAGAAACTGGAAAGCTGGATCAAGGACCGAGGCTTT
GCGGGCGGACGAAATAGGCCGACAGTGACGAGTCCCAAAGAGTACAAGTCGCGATTCCGCGAAGCAATGGCGAGG
TATATTTTGCAGGCGCCCAATTGCTGGCATCTATTCAACCATCCACAGTATCCAGCATATTCTGGACGAGCGCGG
TTTGAGGAGCCAGAGACGCATGGCCAGTAG
Transcript >OphauB2|7882
ATGGGGGACAAGACAGCTCCCAAGCCCTTGACCGGCTCTCCAGGCTCGGCGTCGCGGAGCTCGCTGACGAGCTTT
CGCCCGCGCCGCGGCTCCATCAATTCCATGTCGACCAGCTCCATGGTGGACAAGGAACAGCTTGCCCATGCGCTG
GACAAGATACACACGTCGGCCAGCCAATGTGACTCGCTGACCACGTTCAATGATTTTGCCCCGCCTCCCGAAGGT
CTTCCGCCTCCCGAAAGCCGTGGTTCTGCAGGCGAGCTTGTCCAGCACGGCCTGAGCGGCCTTTATACGCGCTTT
CGAGAGGCCGTTGGAGGCTCCAGTCCCACCAAGACGATTGTGCGCGAGAGCGCCCTTCATGTCGACCATACAGAT
GCCGTGCCCAAGCGCACGTCGGCCACGGATGGCCATTCCTCTCGGCCCTCTGTTTCCTCGCTCAGCCGAGGCGAC
ACCCATGTCTCGGCTTCGAGCGCTGGCTTGGCCTCTCCTTCCGTGCCCACGTCTGACTTGTCTCCAGCCAGCCTT
ACGCCCGCCACGTCGGACAGTCGATCGCAAATGTCGCAATCGGCCAAGGCGACCAGCATCAGCCTCATGACGGGC
CAAAAGTTGCACGGAACTGGCCGCCAGAGCCTCCCGACAAAAGCCACGAGTGCCGTCATTGCCGCCGATCCCACC
ATTGCGCCGCCTCCCATCATCAACCGAGATGTTGGTCGTGGTACCGCCAGAAACGACGAGGGTGGTGCCTCGACG
CCGGTGCGCAAGAGCATCAGCAGGGCCGACATGCACGTGCATATGCCAGCAGTCGACGCCTCCTCGCCCAGGGTC
TATGACGGCCAAGATGGCAAGCTTCCTCCCAGATGCTCTCGAGACGAGAGTTCGAGCAGCCAAACCAGCGTCGAG
ACACCTCTTAGCCCAGTCAAGGGAATCGCCATTACCCCAACTCCCGCAAACCAATCTCTGCATACTCATAGCTCG
TCTACCGTCTCTTCGCTGCTGCCTTCTGACGACAAGACACGGCGCAAGCCTGCCGTCATTGACAGAATCAGCCGC
TCTCGCTCTCCCATGCGCCGTGGGACCAGGCTGTCCTCGCCTGACCGCGGCACCGCAAAGGCATCTCCTGTCAAT
ACATCGGCGCACAACTCGGTTCAACACAACTCTTTTACCCCGGAAACGCATTCTCGACACCGGCCGTCGAGCAGC
GATCGAATACCTGGCACAACGGCAGGCCAAGACAGAGCATCGGAACAGATGAATGCGCAGCTGGACAGAATGCGC
AGACAGGTTTTGAGCAAGGAGTTTTGGATGAAGGACGATACAGTCAAGGAGTGCTTTCTCTGCCAGACGCCCTTT
ACGGCTTTTCGAAGGAAGCACCACTGCCGCACGTGTGGGTGCATCTTTGATTCAAAATGCACAACACTTGTTTCT
GGCGAGAAGTTTGGTGTTGCAGGCTCCCTGAGGGTCTGCAAGAACTGTCTAGACGTTATTAGTCGACGCCTTGAT
GCCAGCGCATCTGATGACTCTGGAGACGAACGCTCCTTCTTGCCCAGAATATTCGGGCCAACTCATAGTCATTCA
AAGGGATCTAGTGGTGCCAGTCACTCCAAGTCGAGAGATCATCAGGATGTAGTACTGGGCTCTGAGGGATCTGAA
GATGCGCGGCCGGGTTCGACGCCCATGATGACTATCCCAGCCACTCGCCGCGTTCGCGAATCAAACCGCTCATCT
GCTGTGTTGGAGATTGATGCCTTTCACCAGCTCAGCCGTCCTGGGTCTTCACGTTCTCTCAAGTCTCTGAGCACA
GCGCGCCCACAGTCTTCTGGTCATAAGCGCCATCATTCCAAACATGGCTTTCTCGGCCGCTTCAAGGGCGTCCCC
CAGTTGCCTCCACCAGAAGATCGTGCCCCATTTAGAAAGGGCATTGACGATGAAAGCGCCAAGAAGTCAAAGTTT
CCAGCGTTTCATGATGACAACATCATTGACCCTGAACTGGCCGACTACATGTCCGAGGACACGAGCGGAGACGAA
CAAGTGAGCATCTTTGCCACCATGGGCACGTCTGATTTACCGTCGGCCAGCTTTGACAGCGAAAGGCCTGGCTTT
TCGCCATTTGTAAACGCCACGCGCAAGCATCGCCATAGGGCTGGCGACAAGAGCATAAGTGGCATGAGTTACGTC
AGCAGGGGGGCGTTTGATGATACCAATGGCGCTTCGGGACTTGCGAGTCATCGGCGATCGACACGACGACGAAAC
CTAAGCAACGTGAGTGGTAGTGTTCATCACTTGGCATCTCCGCGGCCAAAGTCGGGCATCTATAAGGGCCCTTCG
GCTTCATCAGAGATGCTGTTTGCTCTTGACTCTCCAAGTCAGGCCGGGACAAGCCTGATGCCGATGAATGATGTC
CTGCACACACGCAAGGGCAACAAACAAGAGCTGAACCAGTCGAGTCTCTCCCATGTCAACAAATTGCTCCATCAG
CTTCTGGAAGATGGTGGCATATCGCCCTTATCGGCATGGAAGAAGGCGCTGGTTCCCATCTTACTGCAGCTTACT
GATGACGTGACGCCTGATGTAGCCAAGGGCGAGGACATGGACATTCGACATTATGTCAAGCTCAAGCGCATCCCA
GGAGGCCGCCCCGGCGATACGACGTACGTGTCAGGCGTCGTCTTCACCAAGAACCTGGCACTCAAGAGTATGCCG
CGGCGAATCGCCAGCCCGCGCATCGTTCTCGTTACCTTTCCCATTGAGTATCAGCGTCACCAGCAGCAACTTATG
AGCTTGCAGCCAGTGATAGAACAGGAAAAGGAATACCTCCGAGTCGTGGTGCAACGAATTACGAATTTGCGGCCA
CACGTCTTGCTGGCGCAAAAGGGCGTGTCTGGAGTGGCCTTGCAGTATCTCTCCGAAGCCAACATTGCCGTGGCC
TATAATGTCAAGGATACTGTGATTGAAGCCGTGGCTCGCTGTGCCGAAGCCGAAATCATTGAGACTGTCGACATG
CTGGCATTGCCCGTCCGCGTCGGTAAGTGCTCGACGTTTGAAGTTAGAACCTTTGTCAACAACGACTATCCTGGC
CGCAAGAAGTCATATATTTTTCTTTCGGGATGCAGAGCAGACTTGGGCTGTACCATTGCACTACGGGGCTCCAAC
AACTCGGTTCTCAGCAAGATGAAGCATATCATGGACTTTATGGTCTATGTCGTCTACAACCTCAAACTTGAAATG
AGTCTTTTGAGAGACGAGTCTGTCGATCCGCCAGATGCTACCGGGGATACTTCCTCAGTGTCAAGCTCCTTGCAT
GCTATGAATGATAGCTTCAGGTCATGGAGCTCAGCGAGCGGGACAGAATGCGGCAACAGAGGCCTCGGCCTAACA
ACAGCAGCAAGCAAGCTTCCTGGAGACGGAGAGGCAACTTCGCAGACCCCCGAAGAGGTGCCATGCTCTAGCATC
AATGAGGATGGCGAGACATTGATAGACCACGACAATAAGAAGCAGCCAATATCACAAGTTGCCATTGAAAGATCA
AAGCTCATCTCGCTGCACGAGCATCATGCATCTCACGACAGTCAGGTACCCGATGACGTGCCCATGCCTACGTTT
TACAGCGAAATGGTGGCCAAGTACGAAACAAAGATTCTCTCGGCATCGCCATATGTCAAGTTTAAGCAGCCCTAC
TTGCTCATGAGGGCGCGCGAACAAGAGCGGCGTTTGCTGTATCTGCGCCGGCTCAGAGACCAAGATGCCGTCGAA
GAAGACTCGGACAAGTCTGGGCCGCAGAGGTTTCAGCTCATCAAGCCAGAGATGGTGGAAAAGATTGGCCAGAAG
GCGCCAAGGCAAATTATGGAGATTCTTCATGCTGTCCATGATGCCGAGTACGACAAGGCTCTCTTCAACTACCAG
ACCCAGACACGACAGTGGGAGGCATACATACAAGGAAACCTGGACCTTTTTGACCCCTATTCACACCAAAACATG
GTCGTCCTCTATTCCGTTACTTGCACTGAGACCAAGATTCCCTGCTTGGAGCCCAGCTTAGTCGCCATTAATTTT
TACGATGAACAGCACGTGGATACAGGCATGGATCCTGACTGCACTCTTGGACAGTATATCGAAGACTTGGCGCTC
AGCAAGGATGACATTTGTAACTCGAATGGATGCGAAAAGACCATGGCGGAGCACCATCGTACCTATGTCCATGAC
CAGTACCGCGTCACGGCCTTTGTGGAAAATATTCTCCCCAGTTTTGGTCCAAGACATCCCGAGCTTGGAGAGGGC
GTCACCATGTGGACGTATTGCAAGATTTGTAAGAAGGACTCGAGGGAGACGGCCATGTCGGAGGCGACGTTCAAG
TACTCTTTTGGCAAGTACCTTGAGCTCCTCTTTTGGGGCCGCGGCCTAAGGATGAAGAATTCGATGGAATGTCCG
CATCAAGGTCACGGAGATCTCGTCCGGTATTTCAACATGGGCGATTCCCGCATTCGCATCCACTGTGACCCCATT
GACTTGCTCGAGATTGTCGTACCTCGGGCCAGAATAACGTGGAAGGTTGTCAATGATCTCAGGCTCAAGAATGAA
GTGTACACAAGGATGGAGGAGCGGTGGAGCAAGTTCATGGCGTCAGTGCGAGCCAGGCTCAAGAGCATTCGCATT
GACAGCGTGTTGCCAGAAAAGGCCGAGTCTTGCAAGGCAGAGGTTGAGCGACTGATGAAGAAGACACAGGAAGAG
CAGCCAGCCATGGTTCGCCAGCTGCAAGGCATCTACGTCAACTCCAAGTACTACGAGGTTATGCCTTTCAACAGC
CTGGTTCGAGAAATGCTTGAAAAGGCGGGCGAGTGGGATCAAGCCTTTGCCAAGCTCGAGGCCGACTTTTTGGGC
GACAAGGACATGCGGCAGCTGACCATTATGCAACTCAGAAAGATGTTTACTGACAACGAATCCAAGGAGAGCGAG
GTTGCTAGTGTCTCGACCATTGATCACGAGGAACGCTCATCACAAGAGGCCTTGGAGCCAGATGAAAAGGCTGCC
GCTCAGGTTGCAGGACGCGCCGATAGCGTCTTGTCTGGTGAAAAAGCCGACATGGAAAGGTCAATGGAGGAGAAG
CAGACTGGAGCGCAAAAAGGCCATGAAGAGGTGGCCAAAGTGCCTGGTGACGTTGTTGCAGCAACGGATGCTCAA
GGAGAATCTACCATGCCTACCATGGTCAAGACTGAGTCTGCTCTGACAATCCCGCGGGTCTCGGACTCTATGAAA
GAGGAACTCGCCGGCTGCAGCAGTAGCAACGACGAGCAGCCGCCAAGCCCTTCCCAAGTTGTCGACGCTGCCGCA
GCCGTCGCATCGGCTGCCGTGTCAGCATCGCCGCGTCCACCGGCATCTCCAACCGGACTGGGCCGCAGCCCTACA
GGCTCATCTCTGTCTGGTCAGTCGTTTAGCGACAAGGTTGATTTGGTACGCCGCGAACAAGCATCATGCCCAGGT
GCAGATGGGCAAGACTCTCAAAGTGATGTGGCCAGGCCAAGGTCGGAACGAAGCAACGGCCGAAACTCTATTTCT
GGTGCATCGATGCCCATGGTGCGAACAGCTTCGCATCCAACACGGCCGCTGCCCACACGAACACAGTCGTCGCTG
GTGAAGCCTTTGGCTGTCAGAGAGGCGAGAGCCTTGAGCGGCATGAGTAGCACAGATTTGCCCGGGCAGCAGCAA
GTTGCCGAGGGATCGGTCAAGGCGGATAAGAAGCTCTCTGATCGGCTGGGGCTTGGTGCGCTGAAGCATCGCTCC
AAGGGAACCACGTCGAGCATCCCAAGATTGGTCCACAAGAAACGGGAATCGCGAGTCTCAACACTGGCTCGACAT
TTTGAGCAGCTTAGCCGCGAGTTTGAAAAGGAGCGCATCCGCGACCGCAAACAGCGAGCCGCAAATCTGCGGCAG
CCAAGGGCAAGGCTCCCGAGAACATCGACAAAGGCCATTGTACAGGTATACGACGATGTCAACCAGGCCTTTGAG
GAGCCTCCCGTGTCCACGGAACAACCGGTTGAGCCCATCAAGGAGGAACAGAGACAGACGAGCGTGACGCCAAAC
TCTGGAATGACTGAAGTTCCCGCTTGCGAGGCGCCGAGTAGACCTCGAAGCCCAACGACGGGCAATATAGTGCCG
CCAGCAGAGAACCTTCGACCGACCGACGACAATGACGACACGAGCGTGGCAAATACTAGCCAAATGGCATCGGAT
GAAGAGGCAGGTGCTAGCGATGGCGAAGCTCTTGTTTGTGACGACTTTTTGCCCGACATCAAGGAGATTGCCGAC
GCCTTGGAGCCGAGCACAGAGATTCCGCTAGAATTGCCAAAACACCAAAAGACGAGTCTGATGAAGTACTTGACT
AATTTCTGGGCTGAGCGATCAGCCAGTGGATGGCCACCGCTCGAGTACCCGGTAAATGCGACGGACCATATTTTT
GTTGACTCGGATATCATTGTGCGCGAAGATGAGCCGAGCTCCGTGATTGCTCTGGCTCTCAATAGCGAGGACTAC
AAGGAGAAGCTTGCAAATATTCGGCACGATGCCCAGGGAATGATGCAGCGCGACAGCGAGGGCACAGGCGACTCT
GCAGAGCCAAAGTCCATGCCAGCATCAGACAGTGCCGACTGGACGGTGGATGAGACGGAGCAGGAAAAGAGTCTT
TTGCGAGCGACGGGGACGCATCTCAAGTATCAGTTTAAAGAGGGATCAGCCATCATGACTTGCAAGATTTTTTAT
GCCGAACAGTTTGATGCGCTTCGACGAAAGTGCGGCGTTGCGGAGCGAATTATTGAGTCTCTCTCTCGCTGCTTG
AAGTGGGACTCCAAGGGTGGCAAGACCAAGTCGGTTTTCCTCAAGACGCTGGATGATCGTCTGGTTCTAAAGTCT
CTCTCCCCCGTGGAGACTTCAGCCTTTTTGCGTTTTGCCCCTGGATACTTTAGCATCATGGCCGAAGCCCTGTTT
CATGATTTGCCTTCAGTCATTGCCAAGATGCTAGGTTTCTTCCAGGTCATCATCAAGAATTCCATGACTGGCACC
GACATCAAGCTCGACTTGCTAGTGACGGAAAATCTCTTTTACGATCGAACCCCTTCTCGAATCTTTGATCTCAAG
GGGTCTATGCGCAATCGCAAGATTCAGTCGACTGGAGAGCAAAACGAGGTACTCTTGGACGAAAACATGGTTGAG
TACATTTACGAATCGCCGCTATTTGCGCGTGAGCATTCCAAGAAGCTTCTTAGGGCGTCTGTCTGGAACGATACG
CTGTTTTTGGCGAAGCAGAATGTCATGGACTACTCGCTCATGATTGCCGTTGACGAGGAAAAGAAGGAGCTGGTT
GTGGGCATCATTGACTGCATCCGGACCTACACATGGGACAAGAAACTGGAAAGCTGGATCAAGGACCGAGGCTTT
GCGGGCGGACGAAATAGGCCGACAGTGACGAGTCCCAAAGAGTACAAGTCGCGATTCCGCGAAGCAATGGCGAGG
TATATTTTGCAGGCGCCCAATTGCTGGCATCTATTCAACCATCCACAGTATCCAGCATATTCTGGACGAGCGCGG
TTTGAGGAGCCAGAGACGCATGGCCAGTAG
Gene >OphauB2|7882
ATGGGGGACAAGACAGCTCCCAAGCCCTTGACCGGCTCTCCAGGCTCGGCGTCGCGGAGCTCGCTGACGAGCTTT
CGCCCGCGCCGCGGCTCCATCAATTCCATGTCGACCAGCTCCATGGTGGACAAGGAACAGCTTGCCCATGCGCTG
GACAAGATACACACGTCGGCCAGCCAATGTGACTCGCTGACCACGTTCAATGATTTTGCCCCGCCTCCCGAAGGT
CTTCCGCCTCCCGAAAGCCGTGGTTCTGCAGGCGAGCTTGTCCAGCACGGCCTGAGCGGCCTTTATACGCGCTTT
CGAGAGGCCGTTGGAGGCTCCAGTCCCACCAAGACGATTGTGCGCGAGAGCGCCCTTCATGTCGACCATACAGAT
GCCGTGCCCAAGCGCACGTCGGCCACGGATGGCCATTCCTCTCGGCCCTCTGTTTCCTCGCTCAGCCGAGGCGAC
ACCCATGTCTCGGCTTCGAGCGCTGGCTTGGCCTCTCCTTCCGTGCCCACGTCTGACTTGTCTCCAGCCAGCCTT
ACGCCCGCCACGTCGGACAGTCGATCGCAAATGTCGCAATCGGCCAAGGCGACCAGCATCAGCCTCATGACGGGC
CAAAAGTTGCACGGAACTGGCCGCCAGAGCCTCCCGACAAAAGCCACGAGTGCCGTCATTGCCGCCGATCCCACC
ATTGCGCCGCCTCCCATCATCAACCGAGATGTTGGTCGTGGTACCGCCAGAAACGACGAGGGTGGTGCCTCGACG
CCGGTGCGCAAGAGCATCAGCAGGGCCGACATGCACGTGCATATGCCAGCAGTCGACGCCTCCTCGCCCAGGGTC
TATGACGGCCAAGATGGCAAGCTTCCTCCCAGATGCTCTCGAGACGAGAGTTCGAGCAGCCAAACCAGCGTCGAG
ACACCTCTTAGCCCAGTCAAGGGAATCGCCATTACCCCAACTCCCGCAAACCAATCTCTGCATACTCATAGCTCG
TCTACCGTCTCTTCGCTGCTGCCTTCTGACGACAAGACACGGCGCAAGCCTGCCGTCATTGACAGAATCAGCCGC
TCTCGCTCTCCCATGCGCCGTGGGACCAGGCTGTCCTCGCCTGACCGCGGCACCGCAAAGGCATCTCCTGTCAAT
ACATCGGCGCACAACTCGGTTCAACACAACTCTTTTACCCCGGAAACGCATTCTCGACACCGGCCGTCGAGCAGC
GATCGAATACCTGGCACAACGGCAGGCCAAGACAGAGCATCGGAACAGATGAATGCGCAGCTGGACAGAATGCGC
AGACAGGTTTTGAGCAAGGAGTTTTGGATGAAGGACGATACAGTCAAGGAGTGCTTTCTCTGCCAGACGCCCTTT
ACGGCTTTTCGAAGGAAGCACCACTGCCGCACGTGTGGGTGCATCTTTGATTCAAAATGCACAACACTTGTTTCT
GGCGAGAAGTTTGGTGTTGCAGGCTCCCTGAGGGTCTGCAAGAACTGTCTAGACGTTATTAGTCGACGCCTTGAT
GCCAGCGCATCTGATGACTCTGGAGACGAACGCTCCTTCTTGCCCAGAATATTCGGGCCAACTCATAGTCATTCA
AAGGGATCTAGTGGTGCCAGTCACTCCAAGTCGAGAGATCATCAGGATGTAGTACTGGGCTCTGAGGGATCTGAA
GATGCGCGGCCGGGTTCGACGCCCATGATGACTATCCCAGCCACTCGCCGCGTTCGCGAATCAAACCGCTCATCT
GCTGTGTTGGAGATTGATGCCTTTCACCAGCTCAGCCGTCCTGGGTCTTCACGTTCTCTCAAGTCTCTGAGCACA
GCGCGCCCACAGTCTTCTGGTCATAAGCGCCATCATTCCAAACATGGCTTTCTCGGCCGCTTCAAGGGCGTCCCC
CAGTTGCCTCCACCAGAAGATCGTGCCCCATTTAGAAAGGGCATTGACGATGAAAGCGCCAAGAAGTCAAAGTTT
CCAGCGTTTCATGATGACAACATCATTGACCCTGAACTGGCCGACTACATGTCCGAGGACACGAGCGGAGACGAA
CAAGTGAGCATCTTTGCCACCATGGGCACGTCTGATTTACCGTCGGCCAGCTTTGACAGCGAAAGGCCTGGCTTT
TCGCCATTTGTAAACGCCACGCGCAAGCATCGCCATAGGGCTGGCGACAAGAGCATAAGTGGCATGAGTTACGTC
AGCAGGGGGGCGTTTGATGATACCAATGGCGCTTCGGGACTTGCGAGTCATCGGCGATCGACACGACGACGAAAC
CTAAGCAACGTGAGTGGTAGTGTTCATCACTTGGCATCTCCGCGGCCAAAGTCGGGCATCTATAAGGGCCCTTCG
GCTTCATCAGAGATGCTGTTTGCTCTTGACTCTCCAAGTCAGGCCGGGACAAGCCTGATGCCGATGAATGATGTC
CTGCACACACGCAAGGGCAACAAACAAGAGCTGAACCAGTCGAGTCTCTCCCATGTCAACAAATTGCTCCATCAG
CTTCTGGAAGATGGTGGCATATCGCCCTTATCGGCATGGAAGAAGGCGCTGGTTCCCATCTTACTGCAGCTTACT
GATGACGTGACGCCTGATGTAGCCAAGGGCGAGGACATGGACATTCGACATTATGTCAAGCTCAAGCGCATCCCA
GGAGGCCGCCCCGGCGATACGACGTACGTGTCAGGCGTCGTCTTCACCAAGAACCTGGCACTCAAGAGTATGCCG
CGGCGAATCGCCAGCCCGCGCATCGTTCTCGTTACCTTTCCCATTGAGTATCAGCGTCACCAGCAGCAACTTATG
AGCTTGCAGCCAGTGATAGAACAGGAAAAGGAATACCTCCGAGTCGTGGTGCAACGAATTACGAATTTGCGGCCA
CACGTCTTGCTGGCGCAAAAGGGCGTGTCTGGAGTGGCCTTGCAGTATCTCTCCGAAGCCAACATTGCCGTGGCC
TATAATGTCAAGGATACTGTGATTGAAGCCGTGGCTCGCTGTGCCGAAGCCGAAATCATTGAGACTGTCGACATG
CTGGCATTGCCCGTCCGCGTCGGTAAGTGCTCGACGTTTGAAGTTAGAACCTTTGTCAACAACGACTATCCTGGC
CGCAAGAAGTCATATATTTTTCTTTCGGGATGCAGAGCAGACTTGGGCTGTACCATTGCACTACGGGGCTCCAAC
AACTCGGTTCTCAGCAAGATGAAGCATATCATGGACTTTATGGTCTATGTCGTCTACAACCTCAAACTTGAAATG
AGTCTTTTGAGAGACGAGTCTGTCGATCCGCCAGATGCTACCGGGGATACTTCCTCAGTGTCAAGCTCCTTGCAT
GCTATGAATGATAGCTTCAGGTCATGGAGCTCAGCGAGCGGGACAGAATGCGGCAACAGAGGCCTCGGCCTAACA
ACAGCAGCAAGCAAGCTTCCTGGAGACGGAGAGGCAACTTCGCAGACCCCCGAAGAGGTGCCATGCTCTAGCATC
AATGAGGATGGCGAGACATTGATAGACCACGACAATAAGAAGCAGCCAATATCACAAGTTGCCATTGAAAGATCA
AAGCTCATCTCGCTGCACGAGCATCATGCATCTCACGACAGTCAGGTACCCGATGACGTGCCCATGCCTACGTTT
TACAGCGAAATGGTGGCCAAGTACGAAACAAAGATTCTCTCGGCATCGCCATATGTCAAGTTTAAGCAGCCCTAC
TTGCTCATGAGGGCGCGCGAACAAGAGCGGCGTTTGCTGTATCTGCGCCGGCTCAGAGACCAAGATGCCGTCGAA
GAAGACTCGGACAAGTCTGGGCCGCAGAGGTTTCAGCTCATCAAGCCAGAGATGGTGGAAAAGATTGGCCAGAAG
GCGCCAAGGCAAATTATGGAGATTCTTCATGCTGTCCATGATGCCGAGTACGACAAGGCTCTCTTCAACTACCAG
ACCCAGACACGACAGTGGGAGGCATACATACAAGGAAACCTGGACCTTTTTGACCCCTATTCACACCAAAACATG
GTCGTCCTCTATTCCGTTACTTGCACTGAGACCAAGATTCCCTGCTTGGAGCCCAGCTTAGTCGCCATTAATTTT
TACGATGAACAGCACGTGGATACAGGCATGGATCCTGACTGCACTCTTGGACAGTATATCGAAGACTTGGCGCTC
AGCAAGGATGACATTTGTAACTCGAATGGATGCGAAAAGACCATGGCGGAGCACCATCGTACCTATGTCCATGAC
CAGTACCGCGTCACGGCCTTTGTGGAAAATATTCTCCCCAGTTTTGGTCCAAGACATCCCGAGCTTGGAGAGGGC
GTCACCATGTGGACGTATTGCAAGATTTGTAAGAAGGACTCGAGGGAGACGGCCATGTCGGAGGCGACGTTCAAG
TACTCTTTTGGCAAGTACCTTGAGCTCCTCTTTTGGGGCCGCGGCCTAAGGATGAAGAATTCGATGGAATGTCCG
CATCAAGGTCACGGAGATCTCGTCCGGTATTTCAACATGGGCGATTCCCGCATTCGCATCCACTGTGACCCCATT
GACTTGCTCGAGATTGTCGTACCTCGGGCCAGAATAACGTGGAAGGTTGTCAATGATCTCAGGCTCAAGAATGAA
GTGTACACAAGGATGGAGGAGCGGTGGAGCAAGTTCATGGCGTCAGTGCGAGCCAGGCTCAAGAGCATTCGCATT
GACAGCGTGTTGCCAGAAAAGGCCGAGTCTTGCAAGGCAGAGGTTGAGCGACTGATGAAGAAGACACAGGAAGAG
CAGCCAGCCATGGTTCGCCAGCTGCAAGGCATCTACGTCAACTCCAAGTACTACGAGGTTATGCCTTTCAACAGC
CTGGTTCGAGAAATGCTTGAAAAGGCGGGCGAGTGGGATCAAGCCTTTGCCAAGCTCGAGGCCGACTTTTTGGGC
GACAAGGACATGCGGCAGCTGACCATTATGCAACTCAGAAAGATGTTTACTGACAACGAATCCAAGGAGAGCGAG
GTTGCTAGTGTCTCGACCATTGATCACGAGGAACGCTCATCACAAGAGGCCTTGGAGCCAGATGAAAAGGCTGCC
GCTCAGGTTGCAGGACGCGCCGATAGCGTCTTGTCTGGTGAAAAAGCCGACATGGAAAGGTCAATGGAGGAGAAG
CAGACTGGAGCGCAAAAAGGCCATGAAGAGGTGGCCAAAGTGCCTGGTGACGTTGTTGCAGCAACGGATGCTCAA
GGAGAATCTACCATGCCTACCATGGTCAAGACTGAGTCTGCTCTGACAATCCCGCGGGTCTCGGACTCTATGAAA
GAGGAACTCGCCGGCTGCAGCAGTAGCAACGACGAGCAGCCGCCAAGCCCTTCCCAAGTTGTCGACGCTGCCGCA
GCCGTCGCATCGGCTGCCGTGTCAGCATCGCCGCGTCCACCGGCATCTCCAACCGGACTGGGCCGCAGCCCTACA
GGCTCATCTCTGTCTGGTCAGTCGTTTAGCGACAAGGTTGATTTGGTACGCCGCGAACAAGCATCATGCCCAGGT
GCAGATGGGCAAGACTCTCAAAGTGATGTGGCCAGGCCAAGGTCGGAACGAAGCAACGGCCGAAACTCTATTTCT
GGTGCATCGATGCCCATGGTGCGAACAGCTTCGCATCCAACACGGCCGCTGCCCACACGAACACAGTCGTCGCTG
GTGAAGCCTTTGGCTGTCAGAGAGGCGAGAGCCTTGAGCGGCATGAGTAGCACAGATTTGCCCGGGCAGCAGCAA
GTTGCCGAGGGATCGGTCAAGGCGGATAAGAAGCTCTCTGATCGGCTGGGGCTTGGTGCGCTGAAGCATCGCTCC
AAGGGAACCACGTCGAGCATCCCAAGATTGGTCCACAAGAAACGGGAATCGCGAGTCTCAACACTGGCTCGACAT
TTTGAGCAGCTTAGCCGCGAGTTTGAAAAGGAGCGCATCCGCGACCGCAAACAGCGAGCCGCAAATCTGCGGCAG
CCAAGGGCAAGGCTCCCGAGAACATCGACAAAGGCCATTGTACAGGTATACGACGATGTCAACCAGGCCTTTGAG
GAGCCTCCCGTGTCCACGGAACAACCGGTTGAGCCCATCAAGGAGGAACAGAGACAGACGAGCGTGACGCCAAAC
TCTGGAATGACTGAAGTTCCCGCTTGCGAGGCGCCGAGTAGACCTCGAAGCCCAACGACGGGCAATATAGTGCCG
CCAGCAGAGAACCTTCGACCGACCGACGACAATGACGACACGAGCGTGGCAAATACTAGCCAAATGGCATCGGAT
GAAGAGGCAGGTGCTAGCGATGGCGAAGCTCTTGTTTGTGACGACTTTTTGCCCGACATCAAGGAGATTGCCGAC
GCCTTGGAGCCGAGCACAGAGATTCCGCTAGAATTGCCAAAACACCAAAAGACGAGTCTGATGAAGTACTTGACT
AATTTCTGGGCTGAGCGATCAGCCAGTGGATGGCCACCGCTCGAGTACCCGGTAAATGCGACGGACCATATTTTT
GTTGACTCGGATATCATTGTGCGCGAAGATGAGCCGAGCTCCGTGATTGCTCTGGCTCTCAATAGCGAGGACTAC
AAGGAGAAGCTTGCAAATATTCGGCACGATGCCCAGGGAATGATGCAGCGCGACAGCGAGGGCACAGGCGACTCT
GCAGAGCCAAAGTCCATGCCAGCATCAGACAGTGCCGACTGGACGGTGGATGAGACGGAGCAGGAAAAGAGTCTT
TTGCGAGCGACGGGGACGCATCTCAAGTATCAGTTTAAAGAGGGATCAGCCATCATGACTTGCAAGATTTTTTAT
GCCGAACAGTTTGATGCGCTTCGACGAAAGTGCGGCGTTGCGGAGCGAATTATTGAGTCTCTCTCTCGCTGCTTG
AAGTGGGACTCCAAGGGTGGCAAGACCAAGTCGGTTTTCCTCAAGACGCTGGATGATCGTCTGGTTCTAAAGGTA
ACATGCCAAGCCCGTCTTGTTTGCTTTGAATTTTTTTTTTTTTAGCTGACGACTTTGTGCAGTCTCTCTCCCCCG
TGGAGACTTCAGCCTTTTTGCGTTTTGCCCCTGGATACTTTAGCATCATGGCCGAAGCCCTGTTTCATGATTTGC
CTTCAGTCATTGCCAAGATGCTAGGTTTCTTCCAGGTCATCATCAAGAATTCCATGACTGGCACCGACATCAAGC
TCGACTTGCTAGTGACGGAAAATCTCTTTTACGATCGAACCCCTTCTCGAATCTTTGATCTCAAGGGGTCTATGC
GCAATCGCAAGATTCAGTCGACTGGAGAGCAAAACGAGGTACTCTTGGACGAAAACATGGTTGAGTACATTTACG
AATCGCCGCTATTTGCGCGTGAGCATTCCAAGAAGCTTCTTAGGGCGTCTGTCTGGAACGATACGCTGTTTTTGG
CGAAGCAGAATGTCATGGACTACTCGCTCATGATTGCCGTTGACGAGGAAAAGAAGGAGCTGGTTGTGGGCATCA
TTGACTGCATCCGGACCTACACATGGGACAAGAAACTGGAAAGCTGGATCAAGGACCGAGGCTTTGCGGGCGGAC
GAAATAGGCCGACAGTGACGAGTCCCAAAGAGTACAAGTCGCGATTCCGCGAAGCAATGGCGAGGTAAGCCAAGT
TGTCGGACAGGTTATTTGGGGCGAGAATTGCAACGAGTATGAGTTGACCAAGATTTGCCAGGTATATTTTGCAGG
CGCCCAATTGCTGGCATCTATTCAACCATCCACAGTATCCAGCATATTCTGGACGAGCGCGGTTTGAGGAGCCAG
AGACGCATGGCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail