Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7881
Gene name
LocationContig_9:202047..203385
Strand-
Gene length (bp)1338
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10296 MMM1 Maintenance of mitochondrial morphology protein 1 8.0E-05 280 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM00|MDM12_MAGO7 Mitochondrial distribution and morphology protein 12 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDM12 PE=3 SV=1 1 445 6.0E-138
sp|A6RLP9|MDM12_BOTFB Mitochondrial distribution and morphology protein 12 OS=Botryotinia fuckeliana (strain B05.10) GN=mdm12 PE=3 SV=1 1 445 3.0E-133
sp|A7ELE2|MDM12_SCLS1 Mitochondrial distribution and morphology protein 12 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdm12 PE=3 SV=1 1 445 2.0E-127
sp|Q2HDE7|MDM12_CHAGB Mitochondrial distribution and morphology protein 12 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDM12 PE=3 SV=2 1 445 2.0E-119
sp|B2W543|MDM12_PYRTR Mitochondrial distribution and morphology protein 12 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mdm12 PE=3 SV=1 1 445 1.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RM00|MDM12_MAGO7 Mitochondrial distribution and morphology protein 12 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDM12 PE=3 SV=1 1 445 6.0E-138
sp|A6RLP9|MDM12_BOTFB Mitochondrial distribution and morphology protein 12 OS=Botryotinia fuckeliana (strain B05.10) GN=mdm12 PE=3 SV=1 1 445 3.0E-133
sp|A7ELE2|MDM12_SCLS1 Mitochondrial distribution and morphology protein 12 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdm12 PE=3 SV=1 1 445 2.0E-127
sp|Q2HDE7|MDM12_CHAGB Mitochondrial distribution and morphology protein 12 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDM12 PE=3 SV=2 1 445 2.0E-119
sp|B2W543|MDM12_PYRTR Mitochondrial distribution and morphology protein 12 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=mdm12 PE=3 SV=1 1 445 1.0E-108
sp|Q4WRX2|MDM12_ASPFU Mitochondrial distribution and morphology protein 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdm12 PE=3 SV=1 1 445 1.0E-108
sp|B0XN24|MDM12_ASPFC Mitochondrial distribution and morphology protein 12 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mdm12 PE=3 SV=1 1 445 1.0E-108
sp|A1CNY1|MDM12_ASPCL Mitochondrial distribution and morphology protein 12 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdm12 PE=3 SV=1 1 445 2.0E-107
sp|C0NF00|MDM12_AJECG Mitochondrial distribution and morphology protein 12 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=MDM12 PE=3 SV=1 1 445 2.0E-105
sp|B6QAV0|MDM12_TALMQ Mitochondrial distribution and morphology protein 12 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=mdm12 PE=3 SV=1 1 445 7.0E-105
sp|C5K0S2|MDM12_AJEDS Mitochondrial distribution and morphology protein 12 OS=Ajellomyces dermatitidis (strain SLH14081) GN=MDM12 PE=3 SV=1 1 445 8.0E-105
sp|C5GK63|MDM12_AJEDR Mitochondrial distribution and morphology protein 12 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=MDM12 PE=3 SV=1 1 445 9.0E-105
sp|Q5BF59|MDM12_EMENI Mitochondrial distribution and morphology protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdm12 PE=3 SV=2 1 445 1.0E-104
sp|A6QYC8|MDM12_AJECN Mitochondrial distribution and morphology protein 12 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MDM12 PE=3 SV=2 1 445 1.0E-104
sp|Q1E2F1|MDM12_COCIM Mitochondrial distribution and morphology protein 12 OS=Coccidioides immitis (strain RS) GN=MDM12 PE=3 SV=1 1 445 3.0E-103
sp|C4JY59|MDM12_UNCRE Mitochondrial distribution and morphology protein 12 OS=Uncinocarpus reesii (strain UAMH 1704) GN=MDM12 PE=3 SV=1 1 445 3.0E-102
sp|A1D1T8|MDM12_NEOFI Mitochondrial distribution and morphology protein 12 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdm12 PE=3 SV=1 1 445 6.0E-102
sp|C5FUT6|MDM12_ARTOC Mitochondrial distribution and morphology protein 12 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MDM12 PE=3 SV=2 1 445 4.0E-101
sp|C1GHQ8|MDM12_PARBD Mitochondrial distribution and morphology protein 12 OS=Paracoccidioides brasiliensis (strain Pb18) GN=MDM12 PE=3 SV=2 1 445 5.0E-101
sp|C0SE33|MDM12_PARBP Mitochondrial distribution and morphology protein 12 OS=Paracoccidioides brasiliensis (strain Pb03) GN=MDM12 PE=3 SV=2 1 445 7.0E-101
sp|B6HAR6|MDM12_PENRW Mitochondrial distribution and morphology protein 12 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=mdm12 PE=3 SV=1 1 445 9.0E-101
sp|B8M2V6|MDM12_TALSN Mitochondrial distribution and morphology protein 12 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=mdm12 PE=3 SV=2 1 445 1.0E-100
sp|C1H3V1|MDM12_PARBA Mitochondrial distribution and morphology protein 12 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=MDM12 PE=3 SV=2 1 445 1.0E-99
sp|B8MZJ8|MDM12_ASPFN Mitochondrial distribution and morphology protein 12 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mdm12 PE=3 SV=1 1 445 2.0E-99
sp|Q2UQG9|MDM12_ASPOR Mitochondrial distribution and morphology protein 12 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdm12 PE=3 SV=2 1 445 8.0E-99
sp|A2QAU8|MDM12_ASPNC Mitochondrial distribution and morphology protein 12 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdm12 PE=3 SV=1 1 445 8.0E-99
sp|Q0CZL5|MDM12_ASPTN Mitochondrial distribution and morphology protein 12 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdm12 PE=3 SV=2 1 445 4.0E-98
sp|Q0U1X7|MDM12_PHANO Mitochondrial distribution and morphology protein 12 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDM12 PE=3 SV=2 1 445 8.0E-96
sp|B2AA87|MDM12_PODAN Mitochondrial distribution and morphology protein 12 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDM12 PE=3 SV=1 229 445 4.0E-71
sp|Q7SEZ6|MDM12_NEUCR Mitochondrial distribution and morphology protein 12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdm12 PE=3 SV=1 226 445 4.0E-68
sp|B2AA87|MDM12_PODAN Mitochondrial distribution and morphology protein 12 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=MDM12 PE=3 SV=1 1 249 6.0E-38
sp|B5RUL6|MDM12_DEBHA Mitochondrial distribution and morphology protein 12 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MDM12 PE=3 SV=2 1 443 4.0E-34
sp|Q7SEZ6|MDM12_NEUCR Mitochondrial distribution and morphology protein 12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdm12 PE=3 SV=1 1 73 1.0E-29
sp|A3LWH1|MDM12_PICST Mitochondrial distribution and morphology protein 12 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MDM12 PE=3 SV=3 244 440 9.0E-24
sp|B9WK07|MDM12_CANDC Mitochondrial distribution and morphology protein 12 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MDM12 PE=3 SV=1 236 440 2.0E-23
sp|A5DAR4|MDM12_PICGU Mitochondrial distribution and morphology protein 12 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MDM12 PE=3 SV=3 238 443 4.0E-22
sp|Q59S52|MDM12_CANAL Mitochondrial distribution and morphology protein 12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM12 PE=3 SV=1 236 440 8.0E-22
sp|C4YTH8|MDM12_CANAW Mitochondrial distribution and morphology protein 12 OS=Candida albicans (strain WO-1) GN=MDM12 PE=3 SV=1 236 440 1.0E-21
sp|A8NEF5|MDM12_COPC7 Mitochondrial distribution and morphology protein 12 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=MDM12 PE=3 SV=2 280 445 1.0E-20
sp|Q6CI13|MDM12_YARLI Mitochondrial distribution and morphology protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM12 PE=3 SV=1 280 440 4.0E-20
sp|C5DEN8|MDM12_LACTC Mitochondrial distribution and morphology protein 12 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MDM12 PE=3 SV=1 204 440 5.0E-20
sp|Q92377|MDM12_SCHPO Mitochondrial distribution and morphology protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm12 PE=3 SV=1 269 443 6.0E-20
sp|B0DQ09|MDM12_LACBS Mitochondrial distribution and morphology protein 12 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MDM12 PE=3 SV=1 285 445 2.0E-18
sp|C5MFK7|MDM12_CANTT Mitochondrial distribution and morphology protein 12 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MDM12 PE=3 SV=1 256 444 7.0E-18
sp|B6K4Z5|MDM12_SCHJY Mitochondrial distribution and morphology protein 12 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mdm12 PE=3 SV=1 285 443 8.0E-18
sp|C4YBT3|MDM12_CLAL4 Mitochondrial distribution and morphology protein 12 OS=Clavispora lusitaniae (strain ATCC 42720) GN=MDM12 PE=3 SV=1 267 444 2.0E-17
sp|C5DTC4|MDM12_ZYGRC Mitochondrial distribution and morphology protein 12 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=MDM12 PE=3 SV=1 194 440 1.0E-15
sp|Q6CUC3|MDM12_KLULA Mitochondrial distribution and morphology protein 12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDM12 PE=3 SV=1 233 440 1.0E-15
sp|Q75CC2|MDM12_ASHGO Mitochondrial distribution and morphology protein 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM12 PE=3 SV=2 227 440 4.0E-15
sp|A5E771|MDM12_LODEL Mitochondrial distribution and morphology protein 12 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MDM12 PE=3 SV=1 231 440 1.0E-14
sp|P0CO69|MDM12_CRYNB Mitochondrial distribution and morphology protein 12 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDM12 PE=3 SV=1 286 442 2.0E-13
sp|P0CO68|MDM12_CRYNJ Mitochondrial distribution and morphology protein 12 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDM12 PE=3 SV=1 286 442 2.0E-13
sp|B8P9E4|MDM12_POSPM Mitochondrial distribution and morphology protein 12 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=MDM12 PE=3 SV=1 285 445 7.0E-13
sp|Q4PEB4|MDM12_USTMA Mitochondrial distribution and morphology protein 12 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDM12 PE=3 SV=1 306 443 2.0E-12
sp|C4R415|MDM12_PICPG Mitochondrial distribution and morphology protein 12 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MDM12 PE=3 SV=1 284 443 2.0E-12
sp|Q92328|MDM12_YEAST Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM12 PE=1 SV=2 284 440 3.0E-12
sp|A7TFP8|MDM12_VANPO Mitochondrial distribution and morphology protein 12 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM12 PE=3 SV=1 283 443 3.0E-12
sp|A6ZNJ7|MDM12_YEAS7 Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDM12 PE=3 SV=1 284 440 3.0E-12
sp|B3LJ47|MDM12_YEAS1 Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MDM12 PE=3 SV=1 284 440 3.0E-12
sp|B5VRP4|MDM12_YEAS6 Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MDM12 PE=3 SV=1 284 440 3.0E-12
sp|Q6FVF2|MDM12_CANGA Mitochondrial distribution and morphology protein 12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDM12 PE=3 SV=1 1 107 2.0E-11
sp|A5DAR4|MDM12_PICGU Mitochondrial distribution and morphology protein 12 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MDM12 PE=3 SV=3 1 137 6.0E-11
sp|Q6CI13|MDM12_YARLI Mitochondrial distribution and morphology protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM12 PE=3 SV=1 1 70 7.0E-11
sp|B3LJ47|MDM12_YEAS1 Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=MDM12 PE=3 SV=1 1 123 8.0E-11
sp|Q92328|MDM12_YEAST Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM12 PE=1 SV=2 1 123 1.0E-10
sp|A6ZNJ7|MDM12_YEAS7 Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDM12 PE=3 SV=1 1 123 1.0E-10
sp|B5VRP4|MDM12_YEAS6 Mitochondrial distribution and morphology protein 12 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MDM12 PE=3 SV=1 1 123 1.0E-10
sp|A5E771|MDM12_LODEL Mitochondrial distribution and morphology protein 12 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MDM12 PE=3 SV=1 1 70 2.0E-10
sp|A3LWH1|MDM12_PICST Mitochondrial distribution and morphology protein 12 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MDM12 PE=3 SV=3 1 76 1.0E-09
sp|C4YBT3|MDM12_CLAL4 Mitochondrial distribution and morphology protein 12 OS=Clavispora lusitaniae (strain ATCC 42720) GN=MDM12 PE=3 SV=1 1 77 2.0E-09
sp|C5DEN8|MDM12_LACTC Mitochondrial distribution and morphology protein 12 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=MDM12 PE=3 SV=1 1 70 2.0E-09
sp|B6K4Z5|MDM12_SCHJY Mitochondrial distribution and morphology protein 12 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=mdm12 PE=3 SV=1 1 74 5.0E-09
sp|C4R415|MDM12_PICPG Mitochondrial distribution and morphology protein 12 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=MDM12 PE=3 SV=1 1 85 8.0E-09
sp|B9WK07|MDM12_CANDC Mitochondrial distribution and morphology protein 12 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=MDM12 PE=3 SV=1 1 73 1.0E-08
sp|Q59S52|MDM12_CANAL Mitochondrial distribution and morphology protein 12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM12 PE=3 SV=1 1 73 2.0E-08
sp|C4YTH8|MDM12_CANAW Mitochondrial distribution and morphology protein 12 OS=Candida albicans (strain WO-1) GN=MDM12 PE=3 SV=1 1 73 2.0E-08
sp|C5MFK7|MDM12_CANTT Mitochondrial distribution and morphology protein 12 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=MDM12 PE=3 SV=1 1 87 1.0E-07
sp|Q75CC2|MDM12_ASHGO Mitochondrial distribution and morphology protein 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDM12 PE=3 SV=2 1 71 2.0E-07
sp|Q92377|MDM12_SCHPO Mitochondrial distribution and morphology protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm12 PE=3 SV=1 1 91 2.0E-07
sp|A8PSC0|MDM12_MALGO Mitochondrial distribution and morphology protein 12 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDM12 PE=3 SV=1 298 445 2.0E-07
sp|A7TFP8|MDM12_VANPO Mitochondrial distribution and morphology protein 12 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDM12 PE=3 SV=1 1 100 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7881
MSIDLNWETLTSGPDGEALAERIRCFIHDKFQTVPLPRFIRSVEVHGFDFGGVAPELELKDVTDPLPDFYEQEIE
EDCDESDEDDEEQKTNDGYVGGGARYAAYEARLEREQARRRPPPPSPLGLSRSAAAAAAAALRMRGEAVPGDLGS
PFLGSSTPGILGGPGLGYFQGHLTTGTHTPLAAVAGAAGHKTRHDGTLPAPFQLQSSLASHMRRASAHSSVSLPD
EQTLREKSSVSTLAPTSIGTSRPPTRDAQQQLSPVGSDADEAQRAQTEAGKRRREARADDVQAVFRIRYAGDVRL
NLTAEILLDYPMPSFVGIPLKLNITGLSFDGVGVLAHIRRRLHFCFLGPDDAAAAVGAEAGDQHHHDGGGAAPVN
RQQADGAAAMSHGRFAGLLQEIRVESEIGQRQGGKQSLKNVGKVERFVLEQVRRIFDEEFVYPSFWTFLV*
Coding >OphauB2|7881
ATGTCGATTGATCTCAATTGGGAGACACTGACAAGTGGCCCCGACGGTGAGGCGCTGGCGGAGCGCATCCGCTGC
TTCATCCACGACAAGTTCCAGACGGTTCCGCTGCCGCGCTTTATCCGGTCTGTCGAGGTGCATGGCTTTGACTTT
GGCGGCGTGGCACCCGAGCTGGAGCTCAAGGACGTGACGGATCCGCTGCCCGACTTTTACGAGCAGGAAATCGAA
GAGGATTGCGATGAAAGCGACGAGGACGACGAGGAGCAGAAGACGAATGACGGCTACGTTGGTGGAGGAGCGAGA
TATGCCGCTTACGAGGCAAGACTTGAACGAGAGCAGGCAAGGCGGCGACCACCACCGCCGTCACCGCTGGGACTG
AGCAGGTCGGCAGCAGCAGCGGCGGCGGCAGCGCTGAGGATGCGTGGCGAGGCTGTGCCGGGCGACCTGGGCAGT
CCCTTTCTCGGCTCCTCAACTCCGGGCATTCTGGGCGGCCCGGGCCTGGGCTACTTCCAGGGCCATTTGACCACG
GGAACACACACGCCCTTGGCGGCCGTTGCCGGAGCAGCGGGACACAAGACGCGGCACGACGGGACGCTGCCAGCG
CCCTTTCAGCTGCAAAGCTCGCTCGCCAGCCACATGCGACGGGCCTCGGCCCACAGCAGCGTCTCCTTGCCCGAC
GAGCAGACGCTGCGCGAGAAATCGAGCGTGTCGACTCTTGCGCCCACCTCGATTGGCACGTCGCGGCCGCCCACG
CGGGATGCGCAGCAGCAGCTCTCGCCCGTGGGCAGCGACGCGGACGAGGCGCAGCGAGCTCAAACCGAAGCAGGC
AAGAGACGACGCGAGGCGCGCGCCGACGACGTGCAGGCCGTCTTTCGAATCCGCTACGCGGGCGACGTGCGCCTC
AACCTGACGGCCGAGATTCTCCTCGACTACCCCATGCCCAGCTTTGTGGGCATCCCGCTCAAGCTCAACATTACG
GGCTTGTCGTTTGACGGCGTCGGCGTCTTGGCGCATATCCGCCGCCGCCTGCACTTTTGCTTCCTGGGCCCGGAC
GATGCCGCTGCGGCTGTGGGCGCCGAGGCTGGCGACCAGCACCACCATGATGGGGGCGGCGCTGCGCCTGTCAAT
CGCCAGCAGGCCGACGGTGCTGCCGCAATGAGTCATGGCAGGTTTGCCGGCTTGCTGCAAGAGATTCGCGTCGAG
AGCGAGATTGGCCAGCGTCAGGGCGGCAAGCAGAGCCTCAAGAACGTGGGCAAGGTGGAGCGCTTTGTGCTCGAG
CAGGTCAGGAGGATTTTTGACGAGGAGTTTGTCTATCCCAGCTTCTGGACCTTTTTGGTCTGA
Transcript >OphauB2|7881
ATGTCGATTGATCTCAATTGGGAGACACTGACAAGTGGCCCCGACGGTGAGGCGCTGGCGGAGCGCATCCGCTGC
TTCATCCACGACAAGTTCCAGACGGTTCCGCTGCCGCGCTTTATCCGGTCTGTCGAGGTGCATGGCTTTGACTTT
GGCGGCGTGGCACCCGAGCTGGAGCTCAAGGACGTGACGGATCCGCTGCCCGACTTTTACGAGCAGGAAATCGAA
GAGGATTGCGATGAAAGCGACGAGGACGACGAGGAGCAGAAGACGAATGACGGCTACGTTGGTGGAGGAGCGAGA
TATGCCGCTTACGAGGCAAGACTTGAACGAGAGCAGGCAAGGCGGCGACCACCACCGCCGTCACCGCTGGGACTG
AGCAGGTCGGCAGCAGCAGCGGCGGCGGCAGCGCTGAGGATGCGTGGCGAGGCTGTGCCGGGCGACCTGGGCAGT
CCCTTTCTCGGCTCCTCAACTCCGGGCATTCTGGGCGGCCCGGGCCTGGGCTACTTCCAGGGCCATTTGACCACG
GGAACACACACGCCCTTGGCGGCCGTTGCCGGAGCAGCGGGACACAAGACGCGGCACGACGGGACGCTGCCAGCG
CCCTTTCAGCTGCAAAGCTCGCTCGCCAGCCACATGCGACGGGCCTCGGCCCACAGCAGCGTCTCCTTGCCCGAC
GAGCAGACGCTGCGCGAGAAATCGAGCGTGTCGACTCTTGCGCCCACCTCGATTGGCACGTCGCGGCCGCCCACG
CGGGATGCGCAGCAGCAGCTCTCGCCCGTGGGCAGCGACGCGGACGAGGCGCAGCGAGCTCAAACCGAAGCAGGC
AAGAGACGACGCGAGGCGCGCGCCGACGACGTGCAGGCCGTCTTTCGAATCCGCTACGCGGGCGACGTGCGCCTC
AACCTGACGGCCGAGATTCTCCTCGACTACCCCATGCCCAGCTTTGTGGGCATCCCGCTCAAGCTCAACATTACG
GGCTTGTCGTTTGACGGCGTCGGCGTCTTGGCGCATATCCGCCGCCGCCTGCACTTTTGCTTCCTGGGCCCGGAC
GATGCCGCTGCGGCTGTGGGCGCCGAGGCTGGCGACCAGCACCACCATGATGGGGGCGGCGCTGCGCCTGTCAAT
CGCCAGCAGGCCGACGGTGCTGCCGCAATGAGTCATGGCAGGTTTGCCGGCTTGCTGCAAGAGATTCGCGTCGAG
AGCGAGATTGGCCAGCGTCAGGGCGGCAAGCAGAGCCTCAAGAACGTGGGCAAGGTGGAGCGCTTTGTGCTCGAG
CAGGTCAGGAGGATTTTTGACGAGGAGTTTGTCTATCCCAGCTTCTGGACCTTTTTGGTCTGA
Gene >OphauB2|7881
ATGTCGATTGATCTCAATTGGGAGACACTGACAAGTGGCCCCGACGGTGAGGCGCTGGCGGAGCGCATCCGCTGC
TTCATCCACGACAAGTTCCAGACGGTTCCGCTGCCGCGCTTTATCCGGTCTGTCGAGGTGCATGGCTTTGACTTT
GGCGGCGTGGCACCCGAGCTGGAGCTCAAGGACGTGACGGATCCGCTGCCCGACTTTTACGAGCAGGAAATCGAA
GAGGATTGCGATGAAAGCGACGAGGACGACGAGGAGCAGAAGACGAATGACGGCTACGTTGGTGGAGGAGCGAGA
TATGCCGCTTACGAGGCAAGACTTGAACGAGAGCAGGCAAGGCGGCGACCACCACCGCCGTCACCGCTGGGACTG
AGCAGGTCGGCAGCAGCAGCGGCGGCGGCAGCGCTGAGGATGCGTGGCGAGGCTGTGCCGGGCGACCTGGGCAGT
CCCTTTCTCGGCTCCTCAACTCCGGGCATTCTGGGCGGCCCGGGCCTGGGCTACTTCCAGGGCCATTTGACCACG
GGAACACACACGCCCTTGGCGGCCGTTGCCGGAGCAGCGGGACACAAGACGCGGCACGACGGGACGCTGCCAGCG
CCCTTTCAGCTGCAAAGCTCGCTCGCCAGCCACATGCGACGGGCCTCGGCCCACAGCAGCGTCTCCTTGCCCGAC
GAGCAGACGCTGCGCGAGAAATCGAGCGTGTCGACTCTTGCGCCCACCTCGATTGGCACGTCGCGGCCGCCCACG
CGGGATGCGCAGCAGCAGCTCTCGCCCGTGGGCAGCGACGCGGACGAGGCGCAGCGAGCTCAAACCGAAGCAGGC
AAGAGACGACGCGAGGCGCGCGCCGACGACGTGCAGGCCGTCTTTCGAATCCGCTACGCGGGCGACGTGCGCCTC
AACCTGACGGCCGAGATTCTCCTCGACTACCCCATGCCCAGCTTTGTGGGCATCCCGCTCAAGCTCAACATTACG
GGCTTGTCGTTTGACGGCGTCGGCGTCTTGGCGCATATCCGCCGCCGCCTGCACTTTTGCTTCCTGGGCCCGGAC
GATGCCGCTGCGGCTGTGGGCGCCGAGGCTGGCGACCAGCACCACCATGATGGGGGCGGCGCTGCGCCTGTCAAT
CGCCAGCAGGCCGACGGTGCTGCCGCAATGAGTCATGGCAGGTTTGCCGGCTTGCTGCAAGAGATTCGCGTCGAG
AGCGAGATTGGCCAGCGTCAGGGCGGCAAGCAGAGCCTCAAGAACGTGGGCAAGGTGGAGCGCTTTGTGCTCGAG
CAGGTCAGGAGGATTTTTGACGAGGAGTTTGTCTATCCCAGCTTCTGGACCTTTTTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail