Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7873
Gene name
LocationContig_9:178671..179755
Strand-
Gene length (bp)1084
Transcript length (bp)1014
Coding sequence length (bp)1014
Protein length (aa) 338

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 2.6E-33 113 329

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q91VC9|GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus GN=Ghitm PE=1 SV=1 103 337 2.0E-26
sp|Q9H3K2|GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens GN=GHITM PE=1 SV=2 103 337 6.0E-26
sp|Q5XIA8|GHITM_RAT Growth hormone-inducible transmembrane protein OS=Rattus norvegicus GN=Ghitm PE=2 SV=1 103 337 3.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 82 100 18
2 115 134 19
3 146 168 22
4 191 213 22
5 234 256 22
6 271 288 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7873
MFSTMAIRQAPARLGQHLPSLTRAVVRPASKRSMHQAAPMRGLVSRLASTRSAFGRCGSRAYHQNASQQANAASG
ENLSKKLLVGGAVFGGSLVMLNLLFNGEKRDGIPLFEREYLNSTFLHTGLGVGIIGLTAKQMVQSGFVFRIMVTN
PMVVGLGGLALSFATMFATRSISPENYVAKYACWTAFNATQAAFVAPLLAFVPLPLLARAGLYTVGMMGALSFIG
ATAKQEKYIYIGGPLLAGAAIVAMSGLAPLVLPATAIRTLAITDSIWLWGGLAVFGGFTLYDVQKVLKHARLAQA
GLRPRDPVNESISLELDFLNIFIRMVQILMMTNSNRR*
Coding >OphauB2|7873
ATGTTCTCCACCATGGCTATCCGTCAGGCCCCGGCACGCCTTGGACAACACCTGCCGAGCTTGACAAGGGCGGTT
GTCCGCCCGGCTTCGAAGCGAAGCATGCACCAAGCGGCGCCCATGAGGGGCCTCGTTTCGCGACTGGCGAGCACA
CGCAGTGCCTTTGGTCGATGCGGAAGCCGAGCCTATCACCAAAATGCATCACAGCAGGCAAACGCAGCCAGTGGC
GAAAACTTGTCCAAGAAGCTCCTTGTTGGAGGAGCCGTCTTTGGCGGATCTCTAGTCATGTTGAACCTCTTGTTC
AATGGCGAAAAGAGGGATGGAATACCGTTATTCGAGCGCGAGTACCTCAATAGCACGTTTTTGCACACGGGCCTG
GGCGTTGGCATCATTGGCTTGACGGCCAAGCAAATGGTGCAGTCGGGCTTTGTGTTCCGCATCATGGTGACGAAT
CCCATGGTTGTTGGTCTTGGAGGCTTGGCACTCAGCTTTGCCACCATGTTTGCCACTCGTTCTATTAGTCCCGAA
AACTACGTGGCCAAGTATGCCTGCTGGACAGCCTTTAACGCTACGCAAGCTGCCTTTGTAGCACCCCTCTTGGCC
TTTGTGCCGCTGCCGCTGCTGGCGCGCGCTGGCTTGTACACGGTGGGCATGATGGGCGCGCTGAGTTTTATCGGC
GCCACGGCCAAGCAGGAAAAGTACATTTACATTGGTGGGCCGCTGCTGGCGGGTGCCGCCATTGTGGCCATGTCG
GGCCTGGCGCCGCTTGTGTTGCCGGCCACGGCAATACGCACTCTGGCCATTACCGACTCGATTTGGCTCTGGGGC
GGCTTGGCTGTCTTTGGCGGCTTTACGCTCTACGATGTACAAAAGGTGTTGAAACATGCACGACTGGCCCAGGCG
GGCCTAAGGCCACGGGATCCCGTTAATGAGAGCATCTCGCTGGAGCTCGACTTTCTCAACATTTTTATTCGCATG
GTGCAAATCCTCATGATGACGAATTCGAACCGGCGCTGA
Transcript >OphauB2|7873
ATGTTCTCCACCATGGCTATCCGTCAGGCCCCGGCACGCCTTGGACAACACCTGCCGAGCTTGACAAGGGCGGTT
GTCCGCCCGGCTTCGAAGCGAAGCATGCACCAAGCGGCGCCCATGAGGGGCCTCGTTTCGCGACTGGCGAGCACA
CGCAGTGCCTTTGGTCGATGCGGAAGCCGAGCCTATCACCAAAATGCATCACAGCAGGCAAACGCAGCCAGTGGC
GAAAACTTGTCCAAGAAGCTCCTTGTTGGAGGAGCCGTCTTTGGCGGATCTCTAGTCATGTTGAACCTCTTGTTC
AATGGCGAAAAGAGGGATGGAATACCGTTATTCGAGCGCGAGTACCTCAATAGCACGTTTTTGCACACGGGCCTG
GGCGTTGGCATCATTGGCTTGACGGCCAAGCAAATGGTGCAGTCGGGCTTTGTGTTCCGCATCATGGTGACGAAT
CCCATGGTTGTTGGTCTTGGAGGCTTGGCACTCAGCTTTGCCACCATGTTTGCCACTCGTTCTATTAGTCCCGAA
AACTACGTGGCCAAGTATGCCTGCTGGACAGCCTTTAACGCTACGCAAGCTGCCTTTGTAGCACCCCTCTTGGCC
TTTGTGCCGCTGCCGCTGCTGGCGCGCGCTGGCTTGTACACGGTGGGCATGATGGGCGCGCTGAGTTTTATCGGC
GCCACGGCCAAGCAGGAAAAGTACATTTACATTGGTGGGCCGCTGCTGGCGGGTGCCGCCATTGTGGCCATGTCG
GGCCTGGCGCCGCTTGTGTTGCCGGCCACGGCAATACGCACTCTGGCCATTACCGACTCGATTTGGCTCTGGGGC
GGCTTGGCTGTCTTTGGCGGCTTTACGCTCTACGATGTACAAAAGGTGTTGAAACATGCACGACTGGCCCAGGCG
GGCCTAAGGCCACGGGATCCCGTTAATGAGAGCATCTCGCTGGAGCTCGACTTTCTCAACATTTTTATTCGCATG
GTGCAAATCCTCATGATGACGAATTCGAACCGGCGCTGA
Gene >OphauB2|7873
ATGTTCTCCACCATGGCTATCCGTCAGGCCCCGGCACGCCTTGGACAACACCTGCCGAGCTTGACAAGGGCGGTT
GTCCGCCCGGCTTCGAAGCGAAGCATGCACCAAGCGGCGCCCATGAGGGGCCTCGTTTCGCGACTGGCGAGCACA
CGCAGTGCCTTTGGTCGATGCGGAAGCCGAGCCTATCACCAAAATGCATCACAGCAGGCAAACGCAGCCAGTGGC
GAAAACTTGTCCAAGAAGCTCCTTGTTGGAGGAGCCGTCTTTGGCGGATCTCTAGTCATGTTGAACCTCTTGTTC
AATGGCGAAAAGAGGGATGGAATACCGTTATTCGAGCGCGAGTACCTCAATAGCACGTTTTTGCACACGGGCCTG
GGCGTTGGCATCATTGGCTTGACGGCCAAGCAAATGGTGCAGTCGGGCTTTGTGTTCCGCATCATGGTGACGAAT
CCCATGGTTGTTGGTCTTGGAGGCTTGGCACTCAGCTTTGCCACCATGTTTGCCACTCGTTCTATTAGTCCCGAA
AAGTAAGTGCAAGGCACAGCCATGGGGGGCAAAATTAACAAGGGCAAAAATGGAAGCTAACTAGAGTCGTAGCTA
CGTGGCCAAGTATGCCTGCTGGACAGCCTTTAACGCTACGCAAGCTGCCTTTGTAGCACCCCTCTTGGCCTTTGT
GCCGCTGCCGCTGCTGGCGCGCGCTGGCTTGTACACGGTGGGCATGATGGGCGCGCTGAGTTTTATCGGCGCCAC
GGCCAAGCAGGAAAAGTACATTTACATTGGTGGGCCGCTGCTGGCGGGTGCCGCCATTGTGGCCATGTCGGGCCT
GGCGCCGCTTGTGTTGCCGGCCACGGCAATACGCACTCTGGCCATTACCGACTCGATTTGGCTCTGGGGCGGCTT
GGCTGTCTTTGGCGGCTTTACGCTCTACGATGTACAAAAGGTGTTGAAACATGCACGACTGGCCCAGGCGGGCCT
AAGGCCACGGGATCCCGTTAATGAGAGCATCTCGCTGGAGCTCGACTTTCTCAACATTTTTATTCGCATGGTGCA
AATCCTCATGATGACGAATTCGAACCGGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail