Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7872
Gene name
LocationContig_9:177709..178441
Strand+
Gene length (bp)732
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01625 PMSR Peptide methionine sulfoxide reductase 1.3E-57 36 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09859|MSRA_SCHPO Probable peptide methionine sulfoxide reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mxr1 PE=3 SV=2 34 195 3.0E-53
sp|Q8TQV6|MSRA_METAC Peptide methionine sulfoxide reductase MsrA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msrA PE=3 SV=1 15 181 6.0E-45
sp|P40029|MSRA_YEAST Peptide methionine sulfoxide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR1 PE=1 SV=1 34 195 1.0E-44
sp|A3CUG3|MSRA_METMJ Peptide methionine sulfoxide reductase MsrA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=msrA PE=3 SV=1 34 180 5.0E-44
sp|Q9CCZ3|MSRA_MYCLE Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium leprae (strain TN) GN=msrA PE=3 SV=1 33 196 9.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09859|MSRA_SCHPO Probable peptide methionine sulfoxide reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mxr1 PE=3 SV=2 34 195 3.0E-53
sp|Q8TQV6|MSRA_METAC Peptide methionine sulfoxide reductase MsrA OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=msrA PE=3 SV=1 15 181 6.0E-45
sp|P40029|MSRA_YEAST Peptide methionine sulfoxide reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MXR1 PE=1 SV=1 34 195 1.0E-44
sp|A3CUG3|MSRA_METMJ Peptide methionine sulfoxide reductase MsrA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=msrA PE=3 SV=1 34 180 5.0E-44
sp|Q9CCZ3|MSRA_MYCLE Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium leprae (strain TN) GN=msrA PE=3 SV=1 33 196 9.0E-44
sp|B8ZTJ5|MSRA_MYCLB Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium leprae (strain Br4923) GN=msrA PE=3 SV=1 33 196 9.0E-44
sp|Q5YUS0|MSRA_NOCFA Peptide methionine sulfoxide reductase MsrA OS=Nocardia farcinica (strain IFM 10152) GN=msrA PE=3 SV=1 33 196 1.0E-43
sp|Q8PUD6|MSRA_METMA Peptide methionine sulfoxide reductase MsrA OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=msrA PE=3 SV=1 15 181 4.0E-43
sp|Q73U14|MSRA_MYCPA Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=msrA PE=3 SV=1 33 196 4.0E-43
sp|O26635|MSRA_METTH Peptide methionine sulfoxide reductase MsrA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=msrA PE=3 SV=1 37 184 8.0E-43
sp|A4T413|MSRA_MYCGI Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium gilvum (strain PYR-GCK) GN=msrA PE=3 SV=1 36 196 1.0E-42
sp|O69761|MSRA_PSEFL Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas fluorescens GN=msrA PE=3 SV=1 30 195 2.0E-42
sp|Q3SU08|MSRA_NITWN Peptide methionine sulfoxide reductase MsrA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=msrA PE=3 SV=1 33 196 3.0E-42
sp|B2HLR5|MSRA_MYCMM Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=msrA PE=3 SV=1 34 196 3.0E-42
sp|A0PWH2|MSRA_MYCUA Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium ulcerans (strain Agy99) GN=msrA PE=3 SV=1 34 196 3.0E-42
sp|A1TH24|MSRA_MYCVP Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=msrA PE=3 SV=1 34 196 4.0E-42
sp|P9WJM5|MSRA_MYCTU Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=msrA PE=1 SV=1 33 196 4.0E-42
sp|P9WJM4|MSRA_MYCTO Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=msrA PE=3 SV=1 33 196 4.0E-42
sp|A5TYL2|MSRA_MYCTA Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=msrA PE=3 SV=1 33 196 4.0E-42
sp|C1AJG2|MSRA_MYCBT Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=msrA PE=3 SV=1 33 196 4.0E-42
sp|A1KEV7|MSRA_MYCBP Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=msrA PE=3 SV=1 33 196 4.0E-42
sp|P0A5L1|MSRA_MYCBO Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=msrA PE=3 SV=1 33 196 4.0E-42
sp|C1F1B8|MSRA_ACIC5 Peptide methionine sulfoxide reductase MsrA OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=msrA PE=3 SV=1 37 181 5.0E-42
sp|Q4J9L3|MSRA_SULAC Peptide methionine sulfoxide reductase MsrA OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=msrA PE=3 SV=2 34 183 8.0E-42
sp|Q8YXZ4|MSRA1_NOSS1 Peptide methionine sulfoxide reductase MsrA 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=msrA1 PE=3 SV=1 32 181 2.0E-41
sp|Q7UJK0|MSRA1_RHOBA Peptide methionine sulfoxide reductase MsrA 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=msrA1 PE=3 SV=2 30 189 8.0E-41
sp|Q1B1N8|MSRA_MYCSS Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium sp. (strain MCS) GN=msrA PE=3 SV=1 38 196 8.0E-41
sp|A1UNG1|MSRA_MYCSK Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium sp. (strain KMS) GN=msrA PE=3 SV=1 38 196 8.0E-41
sp|Q7UJI2|MSRA2_RHOBA Peptide methionine sulfoxide reductase MsrA 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=msrA2 PE=3 SV=1 33 196 1.0E-40
sp|A3Q7V7|MSRA_MYCSJ Peptide methionine sulfoxide reductase MsrA OS=Mycobacterium sp. (strain JLS) GN=msrA PE=3 SV=1 38 196 2.0E-40
sp|Q12TP4|MSRA_METBU Peptide methionine sulfoxide reductase MsrA OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=msrA PE=3 SV=1 34 181 4.0E-40
sp|Q98JV5|MSRA1_RHILO Peptide methionine sulfoxide reductase MsrA 1 OS=Rhizobium loti (strain MAFF303099) GN=msrA1 PE=3 SV=1 33 196 5.0E-40
sp|Q92Y45|MSRA3_RHIME Peptide methionine sulfoxide reductase MsrA 3 OS=Rhizobium meliloti (strain 1021) GN=msrA3 PE=1 SV=1 33 196 2.0E-39
sp|Q9EWF7|MSRA_STRCO Peptide methionine sulfoxide reductase MsrA OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=msrA PE=3 SV=1 33 196 4.0E-39
sp|Q97Y45|MSRA_SULSO Peptide methionine sulfoxide reductase MsrA OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=msrA PE=3 SV=1 34 183 7.0E-39
sp|Q9LY14|MSRA3_ARATH Peptide methionine sulfoxide reductase A3 OS=Arabidopsis thaliana GN=MSRA3 PE=1 SV=1 1 180 1.0E-38
sp|Q747V4|MSRA_GEOSL Peptide methionine sulfoxide reductase MsrA OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=msrA PE=3 SV=1 28 181 2.0E-38
sp|Q3IUS0|MSRA_NATPD Peptide methionine sulfoxide reductase MsrA OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=msrA PE=3 SV=1 33 192 5.0E-38
sp|Q9FKF7|MSRA1_ARATH Peptide methionine sulfoxide reductase A1 OS=Arabidopsis thaliana GN=MSRA1 PE=2 SV=1 1 180 6.0E-38
sp|Q53W34|MSRA_THET8 Peptide methionine sulfoxide reductase MsrA OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=msrA PE=3 SV=1 32 189 9.0E-38
sp|Q746G0|MSRA_THET2 Peptide methionine sulfoxide reductase MsrA OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=msrA PE=3 SV=1 32 189 9.0E-38
sp|Q82I51|MSRA_STRAW Peptide methionine sulfoxide reductase MsrA OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=msrA PE=3 SV=1 33 196 2.0E-37
sp|O83641|MSRAB_TREPA Peptide methionine sulfoxide reductase MsrB/MsrA OS=Treponema pallidum (strain Nichols) GN=msrAB PE=3 SV=1 30 187 2.0E-37
sp|Q6AG94|MSRA_LEIXX Peptide methionine sulfoxide reductase MsrA OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=msrA PE=3 SV=1 33 196 2.0E-37
sp|Q39Z11|MSRA_GEOMG Peptide methionine sulfoxide reductase MsrA OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=msrA PE=3 SV=1 34 186 3.0E-37
sp|P54153|MSRA_SOLLC Peptide methionine sulfoxide reductase (Fragment) OS=Solanum lycopersicum GN=E4 PE=3 SV=1 34 181 3.0E-37
sp|Q2FQ35|MSRA_METHJ Peptide methionine sulfoxide reductase MsrA OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=msrA PE=3 SV=1 35 180 3.0E-37
sp|Q9HQG0|MSRA_HALSA Peptide methionine sulfoxide reductase MsrA OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=msrA PE=3 SV=1 33 189 3.0E-37
sp|B0R518|MSRA_HALS3 Peptide methionine sulfoxide reductase MsrA OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=msrA PE=3 SV=1 33 189 3.0E-37
sp|Q18J40|MSRA_HALWD Peptide methionine sulfoxide reductase MsrA OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=msrA PE=3 SV=1 33 192 5.0E-37
sp|Q551H3|MSRA_DICDI Peptide methionine sulfoxide reductase OS=Dictyostelium discoideum GN=msrA PE=3 SV=1 37 180 5.0E-37
sp|Q7XUP7|MSR21_ORYSJ Peptide methionine sulfoxide reductase A2-1 OS=Oryza sativa subsp. japonica GN=MSRA2-1 PE=2 SV=2 34 181 8.0E-37
sp|P54152|MSRA_FRAAN Peptide methionine sulfoxide reductase OS=Fragaria ananassa PE=2 SV=2 34 181 1.0E-36
sp|P54151|MSRA_BRANA Peptide methionine sulfoxide reductase OS=Brassica napus GN=PMSR PE=2 SV=1 34 180 2.0E-36
sp|Q9CN40|MSRA_PASMU Peptide methionine sulfoxide reductase MsrA OS=Pasteurella multocida (strain Pm70) GN=msrA PE=3 SV=1 33 189 2.0E-36
sp|C6DDM6|MSRA_PECCP Peptide methionine sulfoxide reductase MsrA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=msrA PE=3 SV=1 35 187 3.0E-36
sp|A4SWL6|MSRA_POLSQ Peptide methionine sulfoxide reductase MsrA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=msrA PE=3 SV=1 27 184 4.0E-36
sp|Q119G2|MSRA_TRIEI Peptide methionine sulfoxide reductase MsrA OS=Trichodesmium erythraeum (strain IMS101) GN=msrA PE=3 SV=1 37 184 6.0E-36
sp|Q9SEC2|MSRA_LACSA Peptide methionine sulfoxide reductase OS=Lactuca sativa PE=2 SV=1 34 180 9.0E-36
sp|P54150|MSRA4_ARATH Peptide methionine sulfoxide reductase A4, chloroplastic OS=Arabidopsis thaliana GN=MSR4 PE=1 SV=2 34 180 2.0E-35
sp|Q4FP80|MSRA_PELUB Peptide methionine sulfoxide reductase MsrA OS=Pelagibacter ubique (strain HTCC1062) GN=msrA PE=3 SV=1 34 181 7.0E-35
sp|A7MM56|MSRA_CROS8 Peptide methionine sulfoxide reductase MsrA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=msrA PE=3 SV=1 5 184 9.0E-35
sp|C3LRL2|MSRA_VIBCM Peptide methionine sulfoxide reductase MsrA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=msrA PE=3 SV=1 21 187 9.0E-35
sp|Q9KP30|MSRA_VIBCH Peptide methionine sulfoxide reductase MsrA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrA PE=3 SV=1 21 187 9.0E-35
sp|A5F587|MSRA_VIBC3 Peptide methionine sulfoxide reductase MsrA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=msrA PE=3 SV=1 21 187 9.0E-35
sp|P72800|MSRA2_SYNY3 Peptide methionine sulfoxide reductase MsrA 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=msrA2 PE=3 SV=1 1 184 1.0E-34
sp|Q9LY15|MSRA2_ARATH Peptide methionine sulfoxide reductase A2 OS=Arabidopsis thaliana GN=MRSA2 PE=1 SV=1 11 180 1.0E-34
sp|Q9ZEQ8|MSRA_DICD3 Peptide methionine sulfoxide reductase MsrA OS=Dickeya dadantii (strain 3937) GN=msrA PE=3 SV=1 34 187 3.0E-34
sp|Q7XUP6|MSR22_ORYSJ Peptide methionine sulfoxide reductase A2-2 OS=Oryza sativa subsp. japonica GN=MSRA2-2 PE=2 SV=2 34 181 5.0E-34
sp|C3KXI0|MSRA_CLOB6 Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain 657 / Type Ba4) GN=msrA PE=3 SV=1 37 193 5.0E-34
sp|Q6D151|MSRA_PECAS Peptide methionine sulfoxide reductase MsrA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msrA PE=3 SV=1 35 187 7.0E-34
sp|B1JML1|MSRA_YERPY Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|Q66F89|MSRA_YERPS Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|A4TRL2|MSRA_YERPP Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis (strain Pestoides F) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|Q1CEI4|MSRA_YERPN Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|A9R574|MSRA_YERPG Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|Q8ZB94|MSRA_YERPE Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|B2K2M6|MSRA_YERPB Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|Q1CBX8|MSRA_YERPA Peptide methionine sulfoxide reductase MsrA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|A7FMV2|MSRA_YERP3 Peptide methionine sulfoxide reductase MsrA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=msrA PE=3 SV=1 5 187 7.0E-34
sp|B1IMT7|MSRA_CLOBK Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Okra / Type B1) GN=msrA PE=3 SV=1 37 193 8.0E-34
sp|Q87SW6|MSRA_VIBPA Peptide methionine sulfoxide reductase MsrA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msrA PE=3 SV=1 34 187 1.0E-33
sp|Q336R9|MSRA4_ORYSJ Peptide methionine sulfoxide reductase A4, chloroplastic OS=Oryza sativa subsp. japonica GN=MSRA4 PE=2 SV=2 20 180 1.0E-33
sp|A7GEN6|MSRA_CLOBL Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=msrA PE=3 SV=1 37 193 1.0E-33
sp|C1FPF1|MSRA_CLOBJ Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Kyoto / Type A2) GN=msrA PE=3 SV=1 37 193 2.0E-33
sp|A8G8X6|MSRA_SERP5 Peptide methionine sulfoxide reductase MsrA OS=Serratia proteamaculans (strain 568) GN=msrA PE=3 SV=1 5 187 2.0E-33
sp|A5I348|MSRA_CLOBH Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=msrA PE=3 SV=1 37 193 2.0E-33
sp|A7FUX9|MSRA_CLOB1 Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=msrA PE=3 SV=1 37 193 2.0E-33
sp|B0KJ25|MSRA_PSEPG Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas putida (strain GB-1) GN=msrA PE=3 SV=1 41 187 2.0E-33
sp|Q88QZ8|MSRA_PSEPK Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas putida (strain KT2440) GN=msrA PE=3 SV=1 41 187 2.0E-33
sp|B1KU02|MSRA_CLOBM Peptide methionine sulfoxide reductase MsrA OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=msrA PE=3 SV=1 37 193 2.0E-33
sp|Q8Y1C6|MSRA_RALSO Peptide methionine sulfoxide reductase MsrA OS=Ralstonia solanacearum (strain GMI1000) GN=msrA PE=3 SV=1 34 189 2.0E-33
sp|B7K079|MSRA_CYAP8 Peptide methionine sulfoxide reductase MsrA OS=Cyanothece sp. (strain PCC 8801) GN=msrA PE=3 SV=1 8 187 3.0E-33
sp|Q0BPD5|MSRA_GRABC Peptide methionine sulfoxide reductase MsrA OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=msrA PE=3 SV=1 34 189 3.0E-33
sp|B0VL72|MSRA_ACIBS Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain SDF) GN=msrA PE=3 SV=1 34 200 4.0E-33
sp|Q9RTB6|MSRA_DEIRA Peptide methionine sulfoxide reductase MsrA OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=msrA PE=3 SV=1 7 184 4.0E-33
sp|B1JE82|MSRA_PSEPW Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas putida (strain W619) GN=msrA PE=3 SV=1 41 187 5.0E-33
sp|A9MEZ2|MSRA_SALAR Peptide methionine sulfoxide reductase MsrA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=msrA PE=3 SV=1 5 187 6.0E-33
sp|Q21JK7|MSRA_SACD2 Peptide methionine sulfoxide reductase MsrA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msrA PE=3 SV=1 34 187 6.0E-33
sp|Q2RRT3|MSRA_RHORT Peptide methionine sulfoxide reductase MsrA OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=msrA PE=3 SV=1 37 180 7.0E-33
sp|A5CWI5|MSRA_VESOH Peptide methionine sulfoxide reductase MsrA OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=msrA PE=3 SV=1 39 196 8.0E-33
sp|B0V4P7|MSRA_ACIBY Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain AYE) GN=msrA PE=3 SV=1 34 189 8.0E-33
sp|B2I399|MSRA_ACIBC Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain ACICU) GN=msrA PE=3 SV=1 34 189 8.0E-33
sp|B7I4T7|MSRA_ACIB5 Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain AB0057) GN=msrA PE=3 SV=1 34 189 8.0E-33
sp|B7H0P7|MSRA_ACIB3 Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain AB307-0294) GN=msrA PE=3 SV=1 34 189 8.0E-33
sp|A9AB97|MSRA_METM6 Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=msrA PE=3 SV=1 33 180 9.0E-33
sp|B1LRA3|MSRA_ECOSM Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=msrA PE=3 SV=1 5 187 9.0E-33
sp|A8M3K6|MSRA_SALAI Peptide methionine sulfoxide reductase MsrA OS=Salinispora arenicola (strain CNS-205) GN=msrA PE=3 SV=1 22 195 9.0E-33
sp|Q8DE84|MSRA_VIBVU Peptide methionine sulfoxide reductase MsrA OS=Vibrio vulnificus (strain CMCP6) GN=msrA PE=3 SV=1 12 187 1.0E-32
sp|Q1I3L0|MSRA_PSEE4 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas entomophila (strain L48) GN=msrA PE=3 SV=1 38 187 1.0E-32
sp|A9N540|MSRA_SALPB Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=msrA PE=3 SV=1 5 184 1.0E-32
sp|Q8ZK71|MSRA_SALTY Peptide methionine sulfoxide reductase MsrA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msrA PE=3 SV=1 5 184 1.0E-32
sp|B4T3H1|MSRA_SALNS Peptide methionine sulfoxide reductase MsrA OS=Salmonella newport (strain SL254) GN=msrA PE=3 SV=1 5 184 1.0E-32
sp|A1JIU0|MSRA_YERE8 Peptide methionine sulfoxide reductase MsrA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=msrA PE=3 SV=1 5 187 1.0E-32
sp|Q8EVK2|MSRA_MYCPE Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma penetrans (strain HF-2) GN=msrA PE=3 SV=1 38 187 2.0E-32
sp|B4TT49|MSRA_SALSV Peptide methionine sulfoxide reductase MsrA OS=Salmonella schwarzengrund (strain CVM19633) GN=msrA PE=3 SV=1 5 184 2.0E-32
sp|B5Y2Y3|MSRA_KLEP3 Peptide methionine sulfoxide reductase MsrA OS=Klebsiella pneumoniae (strain 342) GN=msrA PE=3 SV=1 5 187 2.0E-32
sp|Q899M3|MSRA_CLOTE Peptide methionine sulfoxide reductase MsrA OS=Clostridium tetani (strain Massachusetts / E88) GN=msrA PE=3 SV=1 38 187 2.0E-32
sp|A1AWS4|MSRA_RUTMC Peptide methionine sulfoxide reductase MsrA OS=Ruthia magnifica subsp. Calyptogena magnifica GN=msrA PE=3 SV=1 34 180 2.0E-32
sp|Q97MV3|MSRA_CLOAB Peptide methionine sulfoxide reductase MsrA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=msrA PE=3 SV=1 39 195 2.0E-32
sp|P72622|MSRA1_SYNY3 Peptide methionine sulfoxide reductase MsrA 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=msrA1 PE=3 SV=1 41 187 2.0E-32
sp|A3M1W6|MSRA_ACIBT Peptide methionine sulfoxide reductase MsrA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=msrA PE=3 SV=2 34 189 3.0E-32
sp|Q0ATD8|MSRA_MARMM Peptide methionine sulfoxide reductase MsrA OS=Maricaulis maris (strain MCS10) GN=msrA PE=3 SV=1 5 187 3.0E-32
sp|Q8YWD8|MSRA2_NOSS1 Peptide methionine sulfoxide reductase MsrA 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=msrA2 PE=3 SV=1 41 187 3.0E-32
sp|A6VFD6|MSRA_METM7 Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=msrA PE=3 SV=1 33 180 4.0E-32
sp|B6I2D2|MSRA_ECOSE Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain SE11) GN=msrA PE=3 SV=1 5 184 4.0E-32
sp|Q6L2S4|MSRA_PICTO Peptide methionine sulfoxide reductase MsrA OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=msrA PE=3 SV=1 35 184 4.0E-32
sp|A5CQY7|MSRA_CLAM3 Peptide methionine sulfoxide reductase MsrA OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=msrA PE=3 SV=1 34 184 5.0E-32
sp|Q602T2|MSRA_METCA Peptide methionine sulfoxide reductase MsrA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msrA PE=3 SV=1 8 190 5.0E-32
sp|Q6LYY1|MSRA_METMP Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain S2 / LL) GN=msrA PE=3 SV=1 31 180 6.0E-32
sp|Q8Z150|MSRA_SALTI Peptide methionine sulfoxide reductase MsrA OS=Salmonella typhi GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|B5BKM8|MSRA_SALPK Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi A (strain AKU_12601) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|C0Q6H8|MSRA_SALPC Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi C (strain RKS4594) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|Q5PJ81|MSRA_SALPA Peptide methionine sulfoxide reductase MsrA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|B4TFF2|MSRA_SALHS Peptide methionine sulfoxide reductase MsrA OS=Salmonella heidelberg (strain SL476) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|B5R9G7|MSRA_SALG2 Peptide methionine sulfoxide reductase MsrA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|B5R0T7|MSRA_SALEP Peptide methionine sulfoxide reductase MsrA OS=Salmonella enteritidis PT4 (strain P125109) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|B5FSB9|MSRA_SALDC Peptide methionine sulfoxide reductase MsrA OS=Salmonella dublin (strain CT_02021853) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|B1W2P8|MSRA_STRGG Peptide methionine sulfoxide reductase MsrA OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=msrA PE=3 SV=1 34 184 6.0E-32
sp|Q57GH3|MSRA_SALCH Peptide methionine sulfoxide reductase MsrA OS=Salmonella choleraesuis (strain SC-B67) GN=msrA PE=3 SV=1 5 184 6.0E-32
sp|Q04PP8|MSRA_LEPBJ Peptide methionine sulfoxide reductase MsrA OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=msrA PE=3 SV=1 37 189 7.0E-32
sp|Q8FLU6|MSRA_COREF Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=msrA PE=3 SV=2 38 192 7.0E-32
sp|A6TUE9|MSRA_ALKMQ Peptide methionine sulfoxide reductase MsrA OS=Alkaliphilus metalliredigens (strain QYMF) GN=msrA PE=3 SV=1 37 187 7.0E-32
sp|Q9APY4|MSRA_CORML Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium melassecola GN=msrA PE=3 SV=1 38 192 8.0E-32
sp|A4QHY3|MSRA_CORGB Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium glutamicum (strain R) GN=msrA PE=3 SV=1 38 192 8.0E-32
sp|Q31TF9|MSRA_SHIBS Peptide methionine sulfoxide reductase MsrA OS=Shigella boydii serotype 4 (strain Sb227) GN=msrA PE=3 SV=1 5 184 9.0E-32
sp|B5F3D4|MSRA_SALA4 Peptide methionine sulfoxide reductase MsrA OS=Salmonella agona (strain SL483) GN=msrA PE=3 SV=1 5 184 1.0E-31
sp|B5Z3H5|MSRA_ECO5E Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=msrA PE=3 SV=1 5 184 1.0E-31
sp|Q8XCG3|MSRA_ECO57 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O157:H7 GN=msrA PE=3 SV=3 5 184 1.0E-31
sp|B7UQN3|MSRA_ECO27 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=msrA PE=3 SV=1 5 184 1.0E-31
sp|B6IS04|MSRA_RHOCS Peptide methionine sulfoxide reductase MsrA OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=msrA PE=3 SV=1 34 187 1.0E-31
sp|Q8NLL5|MSRA_CORGL Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=msrA PE=3 SV=1 38 192 2.0E-31
sp|Q8Y640|MSRA_LISMO Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=msrA PE=3 SV=1 34 188 2.0E-31
sp|B8DDP2|MSRA_LISMH Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=msrA PE=3 SV=1 34 188 2.0E-31
sp|P54149|MSRA_BOVIN Mitochondrial peptide methionine sulfoxide reductase OS=Bos taurus GN=MSRA PE=1 SV=2 33 187 2.0E-31
sp|B2TZL3|MSRA_SHIB3 Peptide methionine sulfoxide reductase MsrA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B7NGF6|MSRA_ECOLU Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B7MTA1|MSRA_ECO81 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O81 (strain ED1a) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B7NUD2|MSRA_ECO7I Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|Q3YUC8|MSRA_SHISS Peptide methionine sulfoxide reductase MsrA OS=Shigella sonnei (strain Ss046) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|P0A745|MSRA_SHIFL Peptide methionine sulfoxide reductase MsrA OS=Shigella flexneri GN=msrA PE=3 SV=2 5 184 2.0E-31
sp|Q0SXG5|MSRA_SHIF8 Peptide methionine sulfoxide reductase MsrA OS=Shigella flexneri serotype 5b (strain 8401) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|P0A744|MSRA_ECOLI Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12) GN=msrA PE=1 SV=2 5 184 2.0E-31
sp|B1ISY2|MSRA_ECOLC Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|A8A7X5|MSRA_ECOHS Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O9:H4 (strain HS) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B1XDW8|MSRA_ECODH Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12 / DH10B) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|C4ZR95|MSRA_ECOBW Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B7M9I1|MSRA_ECO8A Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O8 (strain IAI1) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B7LCT1|MSRA_ECO55 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli (strain 55989 / EAEC) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|B7MLN1|MSRA_ECO45 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|A7ZV98|MSRA_ECO24 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|Q71YF6|MSRA_LISMF Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=msrA PE=3 SV=1 34 188 2.0E-31
sp|C1KWF9|MSRA_LISMC Peptide methionine sulfoxide reductase MsrA OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=msrA PE=3 SV=1 34 188 2.0E-31
sp|B7LMP0|MSRA_ESCF3 Peptide methionine sulfoxide reductase MsrA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=msrA PE=3 SV=1 5 184 2.0E-31
sp|Q7MYW1|MSRA_PHOLL Peptide methionine sulfoxide reductase MsrA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msrA PE=3 SV=1 34 187 3.0E-31
sp|A4FYX5|MSRA_METM5 Peptide methionine sulfoxide reductase MsrA OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=msrA PE=3 SV=1 33 180 4.0E-31
sp|Q9KLX6|MSRAB_VIBCH Peptide methionine sulfoxide reductase MsrA/MsrB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msrAB PE=3 SV=2 24 187 4.0E-31
sp|Q9UJ68|MSRA_HUMAN Mitochondrial peptide methionine sulfoxide reductase OS=Homo sapiens GN=MSRA PE=1 SV=1 33 187 4.0E-31
sp|Q4UR77|MSRA_XANC8 Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msrA PE=3 SV=1 41 187 4.0E-31
sp|Q4ZM24|MSRA_PSEU2 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msrA PE=3 SV=1 30 187 4.0E-31
sp|Q8PNY8|MSRA_XANAC Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msrA PE=3 SV=1 41 187 6.0E-31
sp|Q8PCA6|MSRA_XANCP Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msrA PE=3 SV=1 41 187 6.0E-31
sp|B0RUE7|MSRA_XANCB Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. campestris (strain B100) GN=msrA PE=3 SV=1 41 187 6.0E-31
sp|A4X3E5|MSRA_SALTO Peptide methionine sulfoxide reductase MsrA OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=msrA PE=3 SV=1 33 195 7.0E-31
sp|P54154|MSRA_BACSU Peptide methionine sulfoxide reductase MsrA OS=Bacillus subtilis (strain 168) GN=msrA PE=1 SV=1 30 188 1.0E-30
sp|C1DGW5|MSRA_AZOVD Peptide methionine sulfoxide reductase MsrA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=msrA PE=3 SV=1 41 184 1.0E-30
sp|Q328B8|MSRA_SHIDS Peptide methionine sulfoxide reductase MsrA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msrA PE=3 SV=1 5 184 1.0E-30
sp|B2VHZ5|MSRA_ERWT9 Peptide methionine sulfoxide reductase MsrA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=msrA PE=3 SV=1 33 179 1.0E-30
sp|Q055M2|MSRA_LEPBL Peptide methionine sulfoxide reductase MsrA OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=msrA PE=3 SV=1 37 189 1.0E-30
sp|C4LG69|MSRA_CORK4 Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=msrA PE=3 SV=1 38 192 2.0E-30
sp|Q0T9G6|MSRA_ECOL5 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msrA PE=3 SV=1 5 184 2.0E-30
sp|A8IPQ8|MSRA_AZOC5 Peptide methionine sulfoxide reductase MsrA OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=msrA PE=3 SV=1 38 184 2.0E-30
sp|Q98DV6|MSRA2_RHILO Peptide methionine sulfoxide reductase MsrA 2 OS=Rhizobium loti (strain MAFF303099) GN=msrA2 PE=3 SV=1 33 185 2.0E-30
sp|A4W5V5|MSRA_ENT38 Peptide methionine sulfoxide reductase MsrA OS=Enterobacter sp. (strain 638) GN=msrA PE=3 SV=1 5 184 2.0E-30
sp|Q8VS50|MSRA_XANCH Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. phaseoli GN=msrA PE=3 SV=1 41 187 2.0E-30
sp|Q65ID1|MSRA_BACLD Peptide methionine sulfoxide reductase MsrA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=msrA PE=3 SV=1 34 187 3.0E-30
sp|Q0TM63|MSRA_CLOP1 Peptide methionine sulfoxide reductase MsrA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=msrA PE=3 SV=1 38 187 3.0E-30
sp|C0RMK6|MSRA_BRUMB Peptide methionine sulfoxide reductase MsrA OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=msrA PE=3 SV=1 41 187 3.0E-30
sp|Q8YDE7|MSRA_BRUME Peptide methionine sulfoxide reductase MsrA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=msrA PE=3 SV=1 41 187 3.0E-30
sp|Q8FUZ0|MSRA_BRUSU Peptide methionine sulfoxide reductase MsrA OS=Brucella suis biovar 1 (strain 1330) GN=msrA PE=3 SV=1 41 187 3.0E-30
sp|Q8XH97|MSRA_CLOPE Peptide methionine sulfoxide reductase MsrA OS=Clostridium perfringens (strain 13 / Type A) GN=msrA PE=3 SV=1 38 187 4.0E-30
sp|Q8FAG4|MSRA_ECOL6 Peptide methionine sulfoxide reductase MsrA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msrA PE=3 SV=3 5 184 4.0E-30
sp|Q92AE8|MSRA_LISIN Peptide methionine sulfoxide reductase MsrA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=msrA PE=3 SV=1 34 188 4.0E-30
sp|Q923M1|MSRA_RAT Mitochondrial peptide methionine sulfoxide reductase OS=Rattus norvegicus GN=Msra PE=1 SV=1 33 187 4.0E-30
sp|A9WW77|MSRA_BRUSI Peptide methionine sulfoxide reductase MsrA OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=msrA PE=3 SV=1 41 187 4.0E-30
sp|A5VVX1|MSRA_BRUO2 Peptide methionine sulfoxide reductase MsrA OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=msrA PE=3 SV=1 41 187 4.0E-30
sp|A9MCZ5|MSRA_BRUC2 Peptide methionine sulfoxide reductase MsrA OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=msrA PE=3 SV=1 41 187 4.0E-30
sp|Q576P8|MSRA_BRUAB Peptide methionine sulfoxide reductase MsrA OS=Brucella abortus biovar 1 (strain 9-941) GN=msrA PE=3 SV=1 41 187 4.0E-30
sp|Q2YJM1|MSRA_BRUA2 Peptide methionine sulfoxide reductase MsrA OS=Brucella abortus (strain 2308) GN=msrA PE=3 SV=1 41 187 4.0E-30
sp|B2SC53|MSRA_BRUA1 Peptide methionine sulfoxide reductase MsrA OS=Brucella abortus (strain S19) GN=msrA PE=3 SV=1 41 187 4.0E-30
sp|A0AJW5|MSRA_LISW6 Peptide methionine sulfoxide reductase MsrA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=msrA PE=3 SV=1 34 188 5.0E-30
sp|Q0SPW9|MSRA_CLOPS Peptide methionine sulfoxide reductase MsrA OS=Clostridium perfringens (strain SM101 / Type A) GN=msrA PE=3 SV=1 37 187 5.0E-30
sp|Q3BX45|MSRA_XANC5 Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msrA PE=3 SV=1 41 187 5.0E-30
sp|A6Q418|MSRA_NITSB Peptide methionine sulfoxide reductase MsrA OS=Nitratiruptor sp. (strain SB155-2) GN=msrA PE=3 SV=1 38 184 6.0E-30
sp|Q6NEL2|MSRA_CORDI Peptide methionine sulfoxide reductase MsrA OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=msrA PE=1 SV=1 33 192 6.0E-30
sp|Q9D6Y7|MSRA_MOUSE Mitochondrial peptide methionine sulfoxide reductase OS=Mus musculus GN=Msra PE=1 SV=1 33 187 6.0E-30
sp|A7Z5S2|MSRA_BACMF Peptide methionine sulfoxide reductase MsrA OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=msrA PE=3 SV=1 30 187 8.0E-30
sp|B0RBB1|MSRA_CLAMS Peptide methionine sulfoxide reductase MsrA OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=msrA PE=3 SV=1 34 184 9.0E-30
sp|A4XPS6|MSRA_PSEMY Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas mendocina (strain ymp) GN=msrA PE=3 SV=1 32 184 1.0E-29
sp|A8L177|MSRA_FRASN Peptide methionine sulfoxide reductase MsrA OS=Frankia sp. (strain EAN1pec) GN=msrA PE=3 SV=1 20 190 3.0E-29
sp|Q9CE42|MSRA2_LACLA Peptide methionine sulfoxide reductase MsrA 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=msrA2 PE=3 SV=1 33 197 3.0E-29
sp|Q93S39|MSRA_OCHAN Peptide methionine sulfoxide reductase MsrA OS=Ochrobactrum anthropi GN=msrA PE=2 SV=1 29 187 4.0E-29
sp|A6WYH5|MSRA_OCHA4 Peptide methionine sulfoxide reductase MsrA OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=msrA PE=3 SV=1 38 187 5.0E-29
sp|Q48CJ2|MSRA_PSE14 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msrA PE=3 SV=1 30 187 6.0E-29
sp|Q2NZR7|MSRA_XANOM Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msrA PE=3 SV=1 41 187 1.0E-28
sp|B2SQI9|MSRA_XANOP Peptide methionine sulfoxide reductase MsrA OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=msrA PE=3 SV=1 41 187 1.0E-28
sp|Q9A9I6|MSRA1_CAUCR Peptide methionine sulfoxide reductase MsrA 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=msrA1 PE=3 SV=1 20 187 2.0E-28
sp|Q87D27|MSRA_XYLFT Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msrA PE=3 SV=1 35 187 4.0E-28
sp|B2I4P8|MSRA_XYLF2 Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain M23) GN=msrA PE=3 SV=1 35 187 4.0E-28
sp|Q88AI5|MSRA_PSESM Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msrA PE=3 SV=1 34 187 5.0E-28
sp|Q6LV65|MSRA_PHOPR Peptide methionine sulfoxide reductase MsrA OS=Photobacterium profundum GN=msrA PE=3 SV=1 4 187 6.0E-28
sp|A8FL58|MSRA_CAMJ8 Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=msrA PE=3 SV=1 37 189 6.0E-28
sp|Q1WU33|MSRA_LACS1 Peptide methionine sulfoxide reductase MsrA OS=Lactobacillus salivarius (strain UCC118) GN=msrA PE=3 SV=1 38 187 6.0E-28
sp|A1VYZ7|MSRA_CAMJJ Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=msrA PE=3 SV=1 37 189 6.0E-28
sp|Q7NVL7|MSRA_CHRVO Peptide methionine sulfoxide reductase MsrA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msrA PE=3 SV=1 38 176 7.0E-28
sp|A7H4H5|MSRA_CAMJD Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=msrA PE=3 SV=1 37 189 8.0E-28
sp|A8FEA4|MSRA_BACP2 Peptide methionine sulfoxide reductase MsrA OS=Bacillus pumilus (strain SAFR-032) GN=msrA PE=3 SV=1 30 188 9.0E-28
sp|B0U2B7|MSRA_XYLFM Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain M12) GN=msrA PE=3 SV=1 41 187 1.0E-27
sp|Q5HG58|MSRA_STAAC Peptide methionine sulfoxide reductase MsrA OS=Staphylococcus aureus (strain COL) GN=msrA PE=3 SV=1 38 187 1.0E-27
sp|P0A083|MSRA1_STAAW Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain MW2) GN=msrA1 PE=3 SV=1 38 187 1.0E-27
sp|Q6G9J8|MSRA1_STAAS Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain MSSA476) GN=msrA1 PE=3 SV=1 38 187 1.0E-27
sp|Q6GH44|MSRA1_STAAR Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain MRSA252) GN=msrA1 PE=3 SV=1 38 187 1.0E-27
sp|P0A082|MSRA1_STAAN Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain N315) GN=msrA1 PE=1 SV=1 38 187 1.0E-27
sp|P0A081|MSRA1_STAAM Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=msrA1 PE=1 SV=1 38 187 1.0E-27
sp|P0A084|MSRA1_STAA8 Peptide methionine sulfoxide reductase MsrA 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=msrA1 PE=3 SV=1 38 187 1.0E-27
sp|Q8E434|MSRA_STRA3 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=msrA PE=3 SV=1 38 191 1.0E-27
sp|O25011|MSRAB_HELPY Peptide methionine sulfoxide reductase MsrA/MsrB OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=msrAB PE=3 SV=1 34 187 1.0E-27
sp|A2RG28|MSRA_STRPG Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=msrA PE=3 SV=1 38 187 1.0E-27
sp|Q8P272|MSRA_STRP8 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrA PE=3 SV=1 38 187 1.0E-27
sp|Q5XDH1|MSRA_STRP6 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrA PE=3 SV=1 38 187 1.0E-27
sp|Q8DYH1|MSRA_STRA5 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=msrA PE=3 SV=1 38 191 1.0E-27
sp|Q3K013|MSRA_STRA1 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=msrA PE=3 SV=1 38 191 1.0E-27
sp|Q9AJF7|MSRA_THEVU Peptide methionine sulfoxide reductase MsrA OS=Thermoactinomyces vulgaris GN=msrA PE=3 SV=1 35 145 1.0E-27
sp|P0DC39|MSRA_STRPQ Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrA.2 PE=3 SV=1 38 187 2.0E-27
sp|P0DC38|MSRA_STRP3 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrA.2 PE=3 SV=1 38 187 2.0E-27
sp|Q1JI75|MSRA_STRPD Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=msrA PE=3 SV=1 38 187 2.0E-27
sp|Q7D255|MSRA_AGRFC Peptide methionine sulfoxide reductase MsrA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=msrA PE=3 SV=2 34 187 2.0E-27
sp|A5WC53|MSRA_PSYWF Peptide methionine sulfoxide reductase MsrA OS=Psychrobacter sp. (strain PRwf-1) GN=msrA PE=3 SV=1 34 189 2.0E-27
sp|P65446|MSRA2_STAAN Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain N315) GN=msrA2 PE=1 SV=1 34 187 2.0E-27
sp|P65445|MSRA2_STAAM Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=msrA2 PE=3 SV=1 34 187 2.0E-27
sp|Q48UX4|MSRA_STRPM Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=msrA PE=3 SV=1 38 187 3.0E-27
sp|Q9PC45|MSRA_XYLFA Peptide methionine sulfoxide reductase MsrA OS=Xylella fastidiosa (strain 9a5c) GN=msrA PE=3 SV=1 41 187 3.0E-27
sp|B9LA36|MSRA_NAUPA Peptide methionine sulfoxide reductase MsrA OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=msrA PE=3 SV=1 37 184 3.0E-27
sp|P0A085|MSRA2_STAAW Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain MW2) GN=msrA2 PE=3 SV=1 34 187 3.0E-27
sp|Q6G9D7|MSRA2_STAAS Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain MSSA476) GN=msrA2 PE=3 SV=1 34 187 3.0E-27
sp|P0A086|MSRA2_STAA8 Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=msrA2 PE=1 SV=1 34 187 3.0E-27
sp|A1R7D2|MSRA_ARTAT Peptide methionine sulfoxide reductase MsrA OS=Arthrobacter aurescens (strain TC1) GN=msrA PE=3 SV=1 38 184 4.0E-27
sp|Q9A149|MSRA_STRP1 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M1 GN=msrA PE=3 SV=1 38 187 4.0E-27
sp|B5XK66|MSRA_STRPZ Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=msrA PE=3 SV=1 38 187 5.0E-27
sp|Q1JD56|MSRA_STRPB Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=msrA PE=3 SV=1 38 187 5.0E-27
sp|Q6GGY3|MSRA2_STAAR Peptide methionine sulfoxide reductase MsrA 2 OS=Staphylococcus aureus (strain MRSA252) GN=msrA2 PE=3 SV=1 34 187 5.0E-27
sp|Q1JN29|MSRA_STRPC Peptide methionine sulfoxide reductase MsrA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=msrA PE=3 SV=1 38 187 6.0E-27
sp|Q2W5W8|MSRA_MAGSA Peptide methionine sulfoxide reductase MsrA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=msrA PE=3 SV=1 34 184 6.0E-27
sp|B4U465|MSRA_STREM Peptide methionine sulfoxide reductase MsrA OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=msrA PE=3 SV=1 38 187 7.0E-27
sp|C0MCD1|MSRA_STRS7 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=msrA PE=3 SV=1 38 187 7.0E-27
sp|Q9PHN0|MSRA_CAMJE Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=mrsA PE=1 SV=1 37 184 7.0E-27
sp|Q1Q8I3|MSRA_PSYCK Peptide methionine sulfoxide reductase MsrA OS=Psychrobacter cryohalolentis (strain K5) GN=msrA PE=3 SV=1 34 189 8.0E-27
sp|B8HA70|MSRA_ARTCA Peptide methionine sulfoxide reductase MsrA OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=msrA PE=3 SV=1 37 184 9.0E-27
sp|Q9ZMK8|MSRAB_HELPJ Peptide methionine sulfoxide reductase MsrA/MsrB OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=msrAB PE=3 SV=1 34 187 9.0E-27
sp|C0MBS9|MSRA_STRE4 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus equi subsp. equi (strain 4047) GN=msrA PE=3 SV=1 38 187 1.0E-26
sp|Q5HVD4|MSRA_CAMJR Peptide methionine sulfoxide reductase MsrA OS=Campylobacter jejuni (strain RM1221) GN=msrA PE=3 SV=1 38 184 1.0E-26
sp|Q8DSY4|MSRA_STRMU Peptide methionine sulfoxide reductase MsrA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=msrA PE=3 SV=1 38 195 2.0E-26
sp|Q38XB4|MSRA_LACSS Peptide methionine sulfoxide reductase MsrA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=msrA PE=3 SV=1 33 184 2.0E-26
sp|A0JXQ4|MSRA_ARTS2 Peptide methionine sulfoxide reductase MsrA OS=Arthrobacter sp. (strain FB24) GN=msrA PE=3 SV=1 37 184 2.0E-26
sp|Q92SY7|MSRA1_RHIME Peptide methionine sulfoxide reductase MsrA 1 OS=Rhizobium meliloti (strain 1021) GN=msrA1 PE=3 SV=1 41 187 2.0E-26
sp|A9KPX7|MSRA_CLOPH Peptide methionine sulfoxide reductase MsrA OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=msrA PE=3 SV=1 38 187 2.0E-26
sp|A5VKT1|MSRA_LACRD Peptide methionine sulfoxide reductase MsrA OS=Lactobacillus reuteri (strain DSM 20016) GN=msrA PE=3 SV=1 38 184 3.0E-26
sp|B8IJD1|MSRA_METNO Peptide methionine sulfoxide reductase MsrA OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=msrA PE=3 SV=1 8 187 3.0E-26
sp|Q9HUF1|MSRA_PSEAE Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msrA PE=3 SV=1 34 187 4.0E-26
sp|B7V3B1|MSRA_PSEA8 Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain LESB58) GN=msrA PE=3 SV=1 34 187 4.0E-26
sp|B0UCG5|MSRA_METS4 Peptide methionine sulfoxide reductase MsrA OS=Methylobacterium sp. (strain 4-46) GN=msrA PE=3 SV=1 8 187 5.0E-26
sp|Q4FQB0|MSRA_PSYA2 Peptide methionine sulfoxide reductase MsrA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msrA PE=3 SV=1 34 189 7.0E-26
sp|Q02EZ9|MSRA_PSEAB Peptide methionine sulfoxide reductase MsrA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=msrA PE=3 SV=1 34 187 8.0E-26
sp|Q9KAN8|MSRA_BACHD Peptide methionine sulfoxide reductase MsrA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=msrA PE=3 SV=1 34 188 1.0E-25
sp|Q9K1N8|MSRAB_NEIMB Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup B (strain MC58) GN=msrAB PE=3 SV=1 33 187 1.0E-25
sp|Q9JWM8|MSRAB_NEIMA Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msrAB PE=1 SV=1 33 187 1.0E-25
sp|P14930|MSRAB_NEIGO Peptide methionine sulfoxide reductase MsrA/MsrB OS=Neisseria gonorrhoeae GN=msrAB PE=1 SV=2 33 200 2.0E-25
sp|B9DRF3|MSRA_STRU0 Peptide methionine sulfoxide reductase MsrA OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=msrA PE=3 SV=1 38 187 2.0E-25
sp|P47648|MSRA_MYCGE Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=msrA PE=1 SV=1 39 187 3.0E-25
sp|P86890|MSRAB_ENTFL Peptide methionine sulfoxide reductase msrA/msrB OS=Enterococcus faecalis GN=msrAB PE=1 SV=1 34 187 3.0E-25
sp|Q9CFC8|MSRA1_LACLA Peptide methionine sulfoxide reductase MsrA 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=msrA1 PE=3 SV=1 33 189 1.0E-24
sp|Q9AL99|MSRAB_AGGAC Peptide methionine sulfoxide reductase MsrA/MsrB OS=Aggregatibacter actinomycetemcomitans GN=msrAB PE=3 SV=1 38 187 2.0E-24
sp|Q9A9E9|MSRA2_CAUCR Peptide methionine sulfoxide reductase MsrA 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=msrA2 PE=3 SV=1 33 187 2.0E-24
sp|Q9LAM9|MSRAB_STRGC Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=msrAB PE=3 SV=1 38 201 6.0E-24
sp|P75188|MSRA_MYCPN Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=msrA PE=3 SV=1 38 187 7.0E-24
sp|Q8P046|MSRAB_STRP8 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=msrAB PE=3 SV=2 35 187 1.0E-23
sp|Q5XAX5|MSRAB_STRP6 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=msrAB PE=3 SV=2 35 187 1.0E-23
sp|Q99YT1|MSRAB_STRP1 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M1 GN=msrAB PE=3 SV=2 35 187 1.0E-23
sp|Q03W54|MSRA_LEUMM Peptide methionine sulfoxide reductase MsrA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=msrA PE=3 SV=1 34 184 1.0E-23
sp|P45213|MSRAB_HAEIN Peptide methionine sulfoxide reductase MsrA/MsrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msrAB PE=1 SV=1 14 201 7.0E-23
sp|P0DC41|MSRAB_STRPQ Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=msrAB PE=3 SV=1 35 187 8.0E-23
sp|P0DC40|MSRAB_STRP3 Peptide methionine sulfoxide reductase MsrA/MsrB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=msrAB PE=3 SV=1 35 187 8.0E-23
sp|B3PND9|MSRA_MYCA5 Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma arthritidis (strain 158L3-1) GN=msrA PE=3 SV=1 38 186 2.0E-22
sp|P0A3R0|MSAB1_STRR6 Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB1 PE=1 SV=1 38 201 2.0E-21
sp|P0A3Q9|MSAB1_STRPN Peptide methionine sulfoxide reductase MsrA/MsrB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB1 PE=1 SV=1 38 201 2.0E-21
sp|Q92LI5|MSRA2_RHIME Peptide methionine sulfoxide reductase MsrA 2 OS=Rhizobium meliloti (strain 1021) GN=msrA2 PE=3 SV=1 34 187 4.0E-21
sp|B5ZB99|MSRA_UREU1 Peptide methionine sulfoxide reductase MsrA OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=msrA PE=3 SV=1 38 187 4.0E-21
sp|P08761|MSRA_DROME Peptide methionine sulfoxide reductase OS=Drosophila melanogaster GN=Eip71CD PE=2 SV=2 36 183 6.0E-21
sp|Q93KF3|MSRAB_CAMFE Peptide methionine sulfoxide reductase MsrA/MsrB OS=Campylobacter fetus GN=msrAB PE=3 SV=1 28 187 7.0E-21
sp|Q9PQK2|MSRA_UREPA Peptide methionine sulfoxide reductase MsrA OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=msrA PE=3 SV=1 38 187 2.0E-20
sp|B1AIS8|MSRA_UREP2 Peptide methionine sulfoxide reductase MsrA OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=msrA PE=3 SV=1 38 187 2.0E-20
sp|P65444|MSAB2_STRR6 Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=msrAB2 PE=3 SV=1 38 187 2.0E-20
sp|P65443|MSAB2_STRPN Peptide methionine sulfoxide reductase MsrA/MsrB 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=msrAB2 PE=3 SV=1 38 187 2.0E-20
sp|Q9SL43|MSRA5_ARATH Peptide methionine sulfoxide reductase A5 OS=Arabidopsis thaliana GN=MSRA5 PE=2 SV=1 31 184 2.0E-20
sp|Q98PE5|MSRA_MYCPU Peptide methionine sulfoxide reductase MsrA OS=Mycoplasma pulmonis (strain UAB CTIP) GN=msrA PE=3 SV=2 38 187 5.0E-20
sp|Q5VPG8|MSRA5_ORYSJ Peptide methionine sulfoxide reductase A5 OS=Oryza sativa subsp. japonica GN=MSRA5 PE=2 SV=1 39 179 4.0E-19
sp|Q7VI69|MSRA_HELHP Peptide methionine sulfoxide reductase MsrA OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=msrA PE=3 SV=1 38 187 1.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0008113 peptide-methionine (S)-S-oxide reductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0016491 oxidoreductase activity No
GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7872
MGLASLIGRIIRPPRLSITPEGTSTATGNSRPTQLCTIAAGCFWGVEHMYRRHFANQGLVDISVGYIGGSFDAPT
YADVCQGVTGHAEAAQIVFDPAAVTYRQLIEFFYRMHDPTTPDRQGPDQGSQYRSAIFFHNAEQEEIAHQVKTAA
NAQWWRGEIVTKILPAEQWWRAEDNHQRYLQLHPTGYECPSHFLRPFSPLVYQ*
Coding >OphauB2|7872
ATGGGTCTCGCATCCCTCATTGGGCGCATCATCCGCCCTCCACGCCTCTCCATTACCCCCGAGGGCACAAGCACG
GCCACTGGCAACAGCCGCCCGACACAGCTATGCACCATTGCCGCTGGCTGCTTCTGGGGCGTCGAACACATGTAC
CGCCGCCACTTTGCCAACCAGGGCCTTGTTGACATTTCGGTTGGCTATATTGGCGGCAGCTTTGATGCGCCGACG
TATGCAGATGTGTGCCAGGGCGTGACGGGACACGCAGAAGCTGCCCAAATCGTCTTTGACCCCGCCGCCGTGACT
TATCGCCAGCTCATTGAATTCTTTTACCGAATGCACGATCCCACCACTCCGGACCGCCAGGGCCCAGACCAAGGC
TCCCAGTACCGCTCCGCCATCTTCTTCCACAATGCCGAGCAAGAAGAGATTGCCCATCAAGTCAAGACGGCCGCC
AACGCGCAATGGTGGCGAGGCGAAATTGTCACCAAGATTCTCCCCGCAGAGCAGTGGTGGCGCGCAGAGGACAAT
CACCAAAGATATCTTCAACTGCATCCAACCGGCTACGAGTGCCCTAGCCATTTCCTACGACCCTTTTCGCCCCTC
GTATACCAGTAG
Transcript >OphauB2|7872
ATGGGTCTCGCATCCCTCATTGGGCGCATCATCCGCCCTCCACGCCTCTCCATTACCCCCGAGGGCACAAGCACG
GCCACTGGCAACAGCCGCCCGACACAGCTATGCACCATTGCCGCTGGCTGCTTCTGGGGCGTCGAACACATGTAC
CGCCGCCACTTTGCCAACCAGGGCCTTGTTGACATTTCGGTTGGCTATATTGGCGGCAGCTTTGATGCGCCGACG
TATGCAGATGTGTGCCAGGGCGTGACGGGACACGCAGAAGCTGCCCAAATCGTCTTTGACCCCGCCGCCGTGACT
TATCGCCAGCTCATTGAATTCTTTTACCGAATGCACGATCCCACCACTCCGGACCGCCAGGGCCCAGACCAAGGC
TCCCAGTACCGCTCCGCCATCTTCTTCCACAATGCCGAGCAAGAAGAGATTGCCCATCAAGTCAAGACGGCCGCC
AACGCGCAATGGTGGCGAGGCGAAATTGTCACCAAGATTCTCCCCGCAGAGCAGTGGTGGCGCGCAGAGGACAAT
CACCAAAGATATCTTCAACTGCATCCAACCGGCTACGAGTGCCCTAGCCATTTCCTACGACCCTTTTCGCCCCTC
GTATACCAGTAG
Gene >OphauB2|7872
ATGGGTCTCGCATCCCTCATTGGGCGCATCATCCGCCCTCCACGCCTCTCCATTACCCCCGAGGGCACAAGCACG
GCCACTGGCAACAGCCGCCCGACACAGCTATGCACCATTGCCGCTGGCTGCTTCTGGGGCGTCGAACACATGTAC
CGCCGCCACTTTGCCAACCAGGGCCTTGTTGACATTTCGGTTGGCTATATTGGCGGCAGCTTTGATGCGCCGACG
TATGCAGATGTGTGCCAGGGCGTGACGGGACGTGGGTCTTTTTTCTTTTTTTTTTCCTTGCCTTTTTTCCTTTGC
CTCTTTTCCTCTAGTCTCTTTTGCTTTCCATGATAATCAAGGCAAAAAGACTAACAAGATTGAAACCCGGTTGCA
GACGCAGAAGCTGCCCAAATCGTCTTTGACCCCGCCGCCGTGACTTATCGCCAGCTCATTGAATTCTTTTACCGA
ATGCACGATCCCACCACTCCGGACCGCCAGGGCCCAGACCAAGGCTCCCAGTACCGCTCCGCCATCTTCTTCCAC
AATGCCGAGCAAGAAGAGATTGCCCATCAAGTCAAGACGGCCGCCAACGCGCAATGGTGGCGAGGCGAAATTGTC
ACCAAGATTCTCCCCGCAGAGCAGTGGTGGCGCGCAGAGGACAATCACCAAAGATATCTTCAACTGCATCCAACC
GGCTACGAGTGCCCTAGCCATTTCCTACGACCCTTTTCGCCCCTCGTATACCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail