Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7867
Gene name
LocationContig_9:164385..165051
Strand-
Gene length (bp)666
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07947 YhhN YhhN family 2.0E-31 35 216

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P64838|Y1436_MYCBO Uncharacterized membrane protein Mb1436 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1436 PE=3 SV=2 57 221 6.0E-06
sp|P9WG51|Y1401_MYCTU Uncharacterized membrane protein Rv1401 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1401 PE=1 SV=2 57 221 6.0E-06
sp|P9WG50|Y1401_MYCTO Uncharacterized membrane protein MT1445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1445 PE=3 SV=2 57 221 6.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 81 103 22
3 110 132 22
4 142 161 19
5 166 188 22
6 198 220 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7867
MTALETALESALVCGSIGAALQYGRQVCAPASRSRMASKTVSTMLLALLAATGGPSWLLTLALGLCAIGDGFLAW
PGDACFLCGLGSFLAAHVCYTLLYCRLGHGLGSMLALSRLAAAAFLAALTATAVCVLVPRVDKHMKIPIVLYAAT
ILIMALTALTLQNRALVITGSVCLVLSDAVLAADEFLVATDYQYRSRMQIFVWLSYYLGQLLVTSGLTMYR*
Coding >OphauB2|7867
ATGACTGCCCTTGAGACTGCCCTTGAATCCGCTCTAGTCTGCGGCTCCATTGGCGCAGCACTGCAGTATGGGAGG
CAGGTTTGTGCGCCCGCAAGCAGGTCCCGCATGGCGTCCAAGACTGTCTCAACGATGCTGCTGGCCCTCTTAGCG
GCCACAGGCGGGCCGTCGTGGCTGCTTACACTTGCCCTGGGCCTGTGCGCAATTGGCGATGGGTTCCTCGCATGG
CCTGGCGACGCATGCTTTTTGTGTGGTCTCGGCAGCTTCCTGGCGGCTCATGTCTGCTACACGTTGCTCTATTGC
CGACTCGGTCACGGCCTCGGCTCAATGCTGGCCTTGTCGAGACTTGCCGCCGCTGCATTCCTCGCCGCACTGACG
GCCACGGCTGTTTGCGTCTTGGTGCCACGCGTCGACAAGCACATGAAGATACCTATTGTCTTGTACGCCGCTACT
ATCCTGATAATGGCTCTGACGGCCCTCACTCTGCAAAACCGCGCACTCGTCATCACTGGAAGCGTGTGCCTGGTC
TTGTCAGACGCAGTGTTGGCAGCCGACGAGTTTCTGGTTGCCACTGATTACCAATATCGATCAAGGATGCAGATT
TTTGTCTGGCTGTCATACTACCTGGGACAGCTCCTGGTTACCTCTGGGCTTACTATGTACCGATAG
Transcript >OphauB2|7867
ATGACTGCCCTTGAGACTGCCCTTGAATCCGCTCTAGTCTGCGGCTCCATTGGCGCAGCACTGCAGTATGGGAGG
CAGGTTTGTGCGCCCGCAAGCAGGTCCCGCATGGCGTCCAAGACTGTCTCAACGATGCTGCTGGCCCTCTTAGCG
GCCACAGGCGGGCCGTCGTGGCTGCTTACACTTGCCCTGGGCCTGTGCGCAATTGGCGATGGGTTCCTCGCATGG
CCTGGCGACGCATGCTTTTTGTGTGGTCTCGGCAGCTTCCTGGCGGCTCATGTCTGCTACACGTTGCTCTATTGC
CGACTCGGTCACGGCCTCGGCTCAATGCTGGCCTTGTCGAGACTTGCCGCCGCTGCATTCCTCGCCGCACTGACG
GCCACGGCTGTTTGCGTCTTGGTGCCACGCGTCGACAAGCACATGAAGATACCTATTGTCTTGTACGCCGCTACT
ATCCTGATAATGGCTCTGACGGCCCTCACTCTGCAAAACCGCGCACTCGTCATCACTGGAAGCGTGTGCCTGGTC
TTGTCAGACGCAGTGTTGGCAGCCGACGAGTTTCTGGTTGCCACTGATTACCAATATCGATCAAGGATGCAGATT
TTTGTCTGGCTGTCATACTACCTGGGACAGCTCCTGGTTACCTCTGGGCTTACTATGTACCGATAG
Gene >OphauB2|7867
ATGACTGCCCTTGAGACTGCCCTTGAATCCGCTCTAGTCTGCGGCTCCATTGGCGCAGCACTGCAGTATGGGAGG
CAGGTTTGTGCGCCCGCAAGCAGGTCCCGCATGGCGTCCAAGACTGTCTCAACGATGCTGCTGGCCCTCTTAGCG
GCCACAGGCGGGCCGTCGTGGCTGCTTACACTTGCCCTGGGCCTGTGCGCAATTGGCGATGGGTTCCTCGCATGG
CCTGGCGACGCATGCTTTTTGTGTGGTCTCGGCAGCTTCCTGGCGGCTCATGTCTGCTACACGTTGCTCTATTGC
CGACTCGGTCACGGCCTCGGCTCAATGCTGGCCTTGTCGAGACTTGCCGCCGCTGCATTCCTCGCCGCACTGACG
GCCACGGCTGTTTGCGTCTTGGTGCCACGCGTCGACAAGCACATGAAGATACCTATTGTCTTGTACGCCGCTACT
ATCCTGATAATGGCTCTGACGGCCCTCACTCTGCAAAACCGCGCACTCGTCATCACTGGAAGCGTGTGCCTGGTC
TTGTCAGACGCAGTGTTGGCAGCCGACGAGTTTCTGGTTGCCACTGATTACCAATATCGATCAAGGATGCAGATT
TTTGTCTGGCTGTCATACTACCTGGGACAGCTCCTGGTTACCTCTGGGCTTACTATGTACCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail