Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7862
Gene name
LocationContig_9:152492..153546
Strand-
Gene length (bp)1054
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05817 Ribophorin_II Oligosaccharyltransferase subunit Ribophorin II 1.4E-24 29 275

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02795|OSTD_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWP1 PE=1 SV=1 75 272 2.0E-14
sp|Q93Z16|RPN2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Arabidopsis thaliana GN=RPN2 PE=2 SV=1 40 275 9.0E-11
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 77 281 2.0E-10
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 77 281 2.0E-10
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 77 281 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02795|OSTD_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit SWP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWP1 PE=1 SV=1 75 272 2.0E-14
sp|Q93Z16|RPN2_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Arabidopsis thaliana GN=RPN2 PE=2 SV=1 40 275 9.0E-11
sp|P25235|RPN2_RAT Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Rattus norvegicus GN=Rpn2 PE=2 SV=2 77 281 2.0E-10
sp|Q9DBG6|RPN2_MOUSE Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Mus musculus GN=Rpn2 PE=1 SV=1 77 281 2.0E-10
sp|P04844|RPN2_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens GN=RPN2 PE=1 SV=3 77 281 2.0E-10
sp|Q5RBM1|RPN2_PONAB Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Pongo abelii GN=RPN2 PE=2 SV=1 77 281 6.0E-10
sp|Q3SZI6|RPN2_BOVIN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Bos taurus GN=RPN2 PE=2 SV=1 77 281 1.0E-08
sp|O74943|YJB6_SCHPO Uncharacterized protein C553.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.06 PE=3 SV=1 3 252 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008250 oligosaccharyltransferase complex Yes
GO:0006487 protein N-linked glycosylation Yes
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:1990234 transferase complex No
GO:1902494 catalytic complex No
GO:0031224 intrinsic component of membrane No
GO:0036211 protein modification process No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0006486 protein glycosylation No
GO:0044238 primary metabolic process No
GO:0032991 protein-containing complex No
GO:0070085 glycosylation No
GO:0098796 membrane protein complex No
GO:0043413 macromolecule glycosylation No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 188 210 22
2 223 245 22
3 250 272 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7862
MRFLTASVLVAAAAGTVRAVTSWDFSDASATVTSKKDDDVVQSFTSSEQVKQTITLGYDGALKLSLTTKEGTKPK
RPHQAFLMVKEPSSGLETSFPLKVKDSGKATAQIALKDLPVQLLLSPRPLEASLVIGSTGSAVGLLTPVFDIALK
HDPSAQKPSYEYPERYKRLEEIYHTFGQDPKSPPKAISMVFVLAVLGAVPALAIGWLFVGANASHAKKALGDSPL
SHVMFFGSIVAMETVFWLYYRNWNLFQALPAMSLVGLVALLSGTRALGEVQRRRLAGER*
Coding >OphauB2|7862
ATGCGCTTTCTGACGGCTTCAGTTTTGGTTGCTGCGGCTGCAGGTACTGTTAGGGCCGTGACGTCGTGGGATTTC
TCAGACGCATCTGCCACAGTGACGTCGAAAAAGGACGACGACGTGGTGCAGAGCTTCACAAGCTCGGAGCAGGTC
AAGCAAACCATTACGCTTGGGTATGATGGCGCTCTTAAGCTATCATTGACGACCAAAGAGGGTACCAAGCCAAAG
CGGCCACACCAAGCTTTCCTCATGGTCAAGGAACCCTCATCAGGCCTTGAGACTTCTTTCCCTCTCAAGGTTAAG
GATAGTGGGAAAGCAACAGCGCAGATTGCGCTCAAGGACTTGCCCGTGCAGCTGCTTCTCTCACCCAGGCCTCTA
GAAGCAAGCCTTGTTATAGGCTCAACTGGCTCAGCAGTGGGATTGTTGACACCCGTATTCGACATTGCGCTCAAG
CACGATCCCAGTGCGCAAAAACCGAGCTACGAATATCCTGAGCGCTACAAGCGGTTGGAGGAGATATACCATACG
TTTGGCCAAGACCCCAAGAGTCCACCCAAGGCCATATCCATGGTATTCGTGCTCGCTGTTCTTGGTGCAGTTCCA
GCTCTAGCTATTGGCTGGCTTTTTGTCGGCGCTAATGCGAGCCACGCCAAAAAGGCGCTGGGTGACTCTCCGTTG
TCACACGTCATGTTTTTCGGCTCCATTGTGGCCATGGAGACGGTTTTTTGGTTATACTACCGCAACTGGAATCTG
TTTCAAGCGCTTCCGGCCATGAGTCTTGTCGGTTTGGTGGCGCTTTTGAGCGGCACACGGGCGTTGGGTGAAGTG
CAGCGTCGGCGTTTGGCTGGTGAACGATGA
Transcript >OphauB2|7862
ATGCGCTTTCTGACGGCTTCAGTTTTGGTTGCTGCGGCTGCAGGTACTGTTAGGGCCGTGACGTCGTGGGATTTC
TCAGACGCATCTGCCACAGTGACGTCGAAAAAGGACGACGACGTGGTGCAGAGCTTCACAAGCTCGGAGCAGGTC
AAGCAAACCATTACGCTTGGGTATGATGGCGCTCTTAAGCTATCATTGACGACCAAAGAGGGTACCAAGCCAAAG
CGGCCACACCAAGCTTTCCTCATGGTCAAGGAACCCTCATCAGGCCTTGAGACTTCTTTCCCTCTCAAGGTTAAG
GATAGTGGGAAAGCAACAGCGCAGATTGCGCTCAAGGACTTGCCCGTGCAGCTGCTTCTCTCACCCAGGCCTCTA
GAAGCAAGCCTTGTTATAGGCTCAACTGGCTCAGCAGTGGGATTGTTGACACCCGTATTCGACATTGCGCTCAAG
CACGATCCCAGTGCGCAAAAACCGAGCTACGAATATCCTGAGCGCTACAAGCGGTTGGAGGAGATATACCATACG
TTTGGCCAAGACCCCAAGAGTCCACCCAAGGCCATATCCATGGTATTCGTGCTCGCTGTTCTTGGTGCAGTTCCA
GCTCTAGCTATTGGCTGGCTTTTTGTCGGCGCTAATGCGAGCCACGCCAAAAAGGCGCTGGGTGACTCTCCGTTG
TCACACGTCATGTTTTTCGGCTCCATTGTGGCCATGGAGACGGTTTTTTGGTTATACTACCGCAACTGGAATCTG
TTTCAAGCGCTTCCGGCCATGAGTCTTGTCGGTTTGGTGGCGCTTTTGAGCGGCACACGGGCGTTGGGTGAAGTG
CAGCGTCGGCGTTTGGCTGGTGAACGATGA
Gene >OphauB2|7862
ATGCGCTTTCTGACGGCTTCAGTTTTGGTTGCTGCGGCTGCAGGTACTGTTAGGGCCGTGACGTCGTGGGATTTC
TCAGACGCATCTGCCACAGTGACGTCGAAAAAGGACGACGACGTGGTGCAGAGGTGAGCATGGACAAGACCAAAT
GGTGCATCAGGGAAGGAGGCGGCTAATACAAGCTTGTCAACAGCTTCACAAGCTCGGAGCAGGTCAAGCAAACCA
TTACGCTTGGGTATGATGGCGCTCTTAAGCTATCATTGACGACCAAAGAGGGTACCAAGCCAAAGCGGCCACACC
AAGCTTTCCTCATGGTCAAGGAACCCTCATCAGGCCTTGAGACTTCTTTCCCTCTCAAGGTTAAGGATAGTGGGA
AAGCAACAGCGCAGATTGTGTGTCGCATTCACTGTCGAGGCATCGCAAGACTCATGACACTAACCAAGGAGAACA
ATTTAGGCGCTCAAGGACTTGCCCGTGCAGCTGCTTCTCTCACCCAGGCCTCTAGAAGCAAGCCTTGTTATAGGC
TCAACTGGCTCAGCAGTGGGATTGTTGACACCCGTATTCGACATTGCGCTCAAGCACGATCCCAGTGCGCAAAAA
CCGAGCTACGAATATCCTGAGCGCTACAAGCGGTTGGAGGAGATATACCATACGTTTGGCCAAGACCCCAAGAGT
CCACCCAAGGCCATATCCATGGTATTCGTGCTCGCTGTTCTTGGTGCAGTTCCAGCTCTAGCTATTGGCGTAAGA
CGCTGACGCCCAAGGAAAAGAAAAAAAGAAGTTTTGATGGCTAACACATACGTGTTTTTTGCAGTGGCTTTTTGT
CGGCGCTAATGCGAGCCACGCCAAAAAGGCGCTGGGTGACTCTCCGTTGTCACACGTCATGTTTTTCGGCTCCAT
TGTGGCCATGGAGACGGTTTTTTGGTTATACTACCGCAACTGGAATCTGTTTCAAGCGCTTCCGGCCATGAGTCT
TGTCGGTTTGGTGGCGCTTTTGAGCGGCACACGGGCGTTGGGTGAAGTGCAGCGTCGGCGTTTGGCTGGTGAACG
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail