Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7857
Gene name
LocationContig_9:135879..137446
Strand+
Gene length (bp)1567
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.5E-35 48 323

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S4Z6|FDFT_NEUCR Probable squalene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-6 PE=3 SV=1 3 420 0.0E+00
sp|Q9Y753|FDFT_YARLI Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 1 420 6.0E-123
sp|P36596|FDFT_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg9 PE=1 SV=1 12 367 2.0E-117
sp|O74165|FDFT_CYBJA Squalene synthase OS=Cyberlindnera jadinii GN=ERG9 PE=3 SV=1 1 370 1.0E-113
sp|P78589|FDFT_CANAX Squalene synthase OS=Candida albicans GN=ERG9 PE=3 SV=1 1 409 9.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S4Z6|FDFT_NEUCR Probable squalene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-6 PE=3 SV=1 3 420 0.0E+00
sp|Q9Y753|FDFT_YARLI Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 1 420 6.0E-123
sp|P36596|FDFT_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg9 PE=1 SV=1 12 367 2.0E-117
sp|O74165|FDFT_CYBJA Squalene synthase OS=Cyberlindnera jadinii GN=ERG9 PE=3 SV=1 1 370 1.0E-113
sp|P78589|FDFT_CANAX Squalene synthase OS=Candida albicans GN=ERG9 PE=3 SV=1 1 409 9.0E-109
sp|P29704|FDFT_YEAST Squalene synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG9 PE=1 SV=2 1 414 5.0E-107
sp|Q752X9|FDFT_ASHGO Squalene synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG9 PE=3 SV=1 9 369 1.0E-102
sp|Q9HGZ6|FDFT_CANGA Squalene synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG9 PE=3 SV=2 8 369 3.0E-101
sp|Q92459|FDFT_USTMA Squalene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG9 PE=3 SV=2 1 365 8.0E-100
sp|P53798|FDFT_MOUSE Squalene synthase OS=Mus musculus GN=Fdft1 PE=1 SV=2 9 369 8.0E-92
sp|Q5R6U3|FDFT_PONAB Squalene synthase OS=Pongo abelii GN=FDFT1 PE=2 SV=1 9 369 4.0E-89
sp|P37268|FDFT_HUMAN Squalene synthase OS=Homo sapiens GN=FDFT1 PE=1 SV=1 9 369 4.0E-89
sp|Q32KR6|FDFT_BOVIN Squalene synthase OS=Bos taurus GN=FDFT1 PE=2 SV=1 9 369 4.0E-89
sp|Q02769|FDFT_RAT Squalene synthase OS=Rattus norvegicus GN=Fdft1 PE=2 SV=1 9 379 4.0E-88
sp|Q9SDW9|BSS_BOTBR Squalene synthase OS=Botryococcus braunii GN=BSS PE=1 SV=1 41 353 3.0E-74
sp|P53800|FDFT_NICBE Squalene synthase OS=Nicotiana benthamiana PE=2 SV=1 1 329 1.0E-72
sp|P53799|FDFT_ARATH Squalene synthase OS=Arabidopsis thaliana GN=SQS1 PE=1 SV=1 41 404 2.0E-71
sp|Q54DR1|FDFT_DICDI Squalene synthase OS=Dictyostelium discoideum GN=fdfT PE=3 SV=1 41 329 4.0E-64
sp|G0Y287|BOSS_BOTBR Botryococcus squalene synthase OS=Botryococcus braunii GN=SSL-2 PE=1 SV=1 9 330 2.0E-61
sp|G0Y288|BOCS_BOTBR Botryococcene synthase OS=Botryococcus braunii GN=SSL-3 PE=2 SV=1 9 333 2.0E-59
sp|G0Y286|PSDS_BOTBR Presqualene diphosphate synthase OS=Botryococcus braunii GN=SSL-1 PE=1 SV=1 7 332 9.0E-53
sp|Q4L976|CRTM_STAHJ Dehydrosqualene synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=crtM PE=3 SV=1 31 237 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 392 414 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7857
MGALYYILHPNQLRSIVQWKLWHDPVHTRDVSSEPETLKECYRLLNMTSRSFASVIQELTSEIRVPVVLFYLVLR
GLDTIEDDMTIPIDKKVSMLCNFYKTMETDGWQFHESNEKDRELLEKFDVVITELKRIKKPSYEIIHDLTQKMGK
GMADYAQNTDFIENGVQTVKDYELYCHYVAGLVGEGLTRLFVVTELGNPKLSERPSLTESMGQILQKTNIIRDIH
EDWLDGRRWYPKEIWSKYVDRWEDLFDVKYRDQALNCISEMVLDALKHVEECLFYMAAMREQSVFNFVAIPQTMA
IATLELTFRNPAVLERNVKITKGDACQIMMESTQNLFTNDPRDPNFLDISTRCAKIEQFIETLYPRQDPKILAAE
NAKRQRKEPTSDPSEGLIMFGIVTLCLIFISAIMLGTAWAMGAKFPAISDLLNEPKTAMPIPEAVPIGRDEL*
Coding >OphauB2|7857
ATGGGCGCCTTATACTACATACTTCACCCTAATCAGCTGCGGTCAATTGTACAATGGAAGCTCTGGCACGACCCT
GTACACACGCGCGATGTCTCGAGCGAGCCTGAGACGCTCAAAGAATGCTACCGCTTACTCAACATGACTAGCCGT
AGCTTTGCCTCAGTGATACAGGAGCTCACCAGTGAAATCCGCGTTCCAGTCGTCCTCTTCTACCTGGTCCTGCGC
GGCCTTGATACCATCGAGGATGACATGACCATCCCTATCGACAAGAAGGTGTCAATGCTGTGCAACTTCTACAAG
ACTATGGAAACAGATGGCTGGCAATTCCACGAAAGCAACGAAAAGGACCGCGAACTCCTGGAGAAGTTCGATGTT
GTCATTACAGAGCTCAAAAGGATCAAGAAGCCTTCCTACGAAATCATACATGACTTGACACAAAAAATGGGCAAA
GGAATGGCCGACTATGCTCAGAACACAGACTTTATCGAAAATGGCGTTCAAACCGTTAAAGACTACGAGCTCTAC
TGTCACTACGTTGCAGGTCTCGTTGGCGAAGGGTTGACGCGGCTATTCGTCGTAACAGAGCTAGGCAACCCCAAG
CTTTCTGAGCGACCAAGTTTGACAGAGTCTATGGGCCAAATTCTACAAAAAACCAACATCATCCGCGATATTCAC
GAAGACTGGCTAGATGGCAGACGATGGTACCCAAAGGAGATCTGGAGCAAATACGTCGACCGCTGGGAGGATTTG
TTCGACGTCAAGTATCGCGATCAAGCCCTTAATTGTATTTCGGAAATGGTTCTCGATGCGCTCAAACATGTCGAG
GAATGCCTCTTTTACATGGCAGCCATGCGGGAACAAAGCGTCTTCAACTTTGTCGCCATTCCCCAGACCATGGCA
ATTGCCACACTCGAACTAACATTTCGCAATCCAGCCGTGTTGGAGAGAAACGTCAAGATTACCAAAGGCGATGCC
TGCCAGATTATGATGGAATCAACTCAAAATCTTTTCACCAACGATCCCCGGGATCCCAATTTCCTGGATATAAGC
ACACGATGTGCCAAAATTGAACAGTTCATCGAGACGCTATACCCTAGGCAGGATCCCAAGATACTCGCCGCTGAA
AATGCAAAGCGGCAGAGAAAGGAGCCTACATCAGATCCAAGTGAAGGTTTGATCATGTTCGGCATTGTCACGCTC
TGTCTCATCTTTATTTCCGCCATCATGCTCGGAACAGCTTGGGCCATGGGGGCCAAGTTTCCCGCCATTTCTGAT
CTCCTCAACGAACCCAAGACGGCGATGCCGATACCAGAAGCCGTTCCTATAGGACGCGATGAACTTTAG
Transcript >OphauB2|7857
ATGGGCGCCTTATACTACATACTTCACCCTAATCAGCTGCGGTCAATTGTACAATGGAAGCTCTGGCACGACCCT
GTACACACGCGCGATGTCTCGAGCGAGCCTGAGACGCTCAAAGAATGCTACCGCTTACTCAACATGACTAGCCGT
AGCTTTGCCTCAGTGATACAGGAGCTCACCAGTGAAATCCGCGTTCCAGTCGTCCTCTTCTACCTGGTCCTGCGC
GGCCTTGATACCATCGAGGATGACATGACCATCCCTATCGACAAGAAGGTGTCAATGCTGTGCAACTTCTACAAG
ACTATGGAAACAGATGGCTGGCAATTCCACGAAAGCAACGAAAAGGACCGCGAACTCCTGGAGAAGTTCGATGTT
GTCATTACAGAGCTCAAAAGGATCAAGAAGCCTTCCTACGAAATCATACATGACTTGACACAAAAAATGGGCAAA
GGAATGGCCGACTATGCTCAGAACACAGACTTTATCGAAAATGGCGTTCAAACCGTTAAAGACTACGAGCTCTAC
TGTCACTACGTTGCAGGTCTCGTTGGCGAAGGGTTGACGCGGCTATTCGTCGTAACAGAGCTAGGCAACCCCAAG
CTTTCTGAGCGACCAAGTTTGACAGAGTCTATGGGCCAAATTCTACAAAAAACCAACATCATCCGCGATATTCAC
GAAGACTGGCTAGATGGCAGACGATGGTACCCAAAGGAGATCTGGAGCAAATACGTCGACCGCTGGGAGGATTTG
TTCGACGTCAAGTATCGCGATCAAGCCCTTAATTGTATTTCGGAAATGGTTCTCGATGCGCTCAAACATGTCGAG
GAATGCCTCTTTTACATGGCAGCCATGCGGGAACAAAGCGTCTTCAACTTTGTCGCCATTCCCCAGACCATGGCA
ATTGCCACACTCGAACTAACATTTCGCAATCCAGCCGTGTTGGAGAGAAACGTCAAGATTACCAAAGGCGATGCC
TGCCAGATTATGATGGAATCAACTCAAAATCTTTTCACCAACGATCCCCGGGATCCCAATTTCCTGGATATAAGC
ACACGATGTGCCAAAATTGAACAGTTCATCGAGACGCTATACCCTAGGCAGGATCCCAAGATACTCGCCGCTGAA
AATGCAAAGCGGCAGAGAAAGGAGCCTACATCAGATCCAAGTGAAGGTTTGATCATGTTCGGCATTGTCACGCTC
TGTCTCATCTTTATTTCCGCCATCATGCTCGGAACAGCTTGGGCCATGGGGGCCAAGTTTCCCGCCATTTCTGAT
CTCCTCAACGAACCCAAGACGGCGATGCCGATACCAGAAGCCGTTCCTATAGGACGCGATGAACTTTAG
Gene >OphauB2|7857
ATGGGCGCCTTATACTACATACTTCACCCTAATCAGCTGCGGTCAATTGTACAATGGTTTGTCTCTTCTCCATTC
TGTATTTGTCTCCGTCATGCTGACCCAAGACTTGGTATTCAGGAAGCTCTGGCACGACCCTGTACACACGCGCGA
TGTCTCGAGCGAGCCTGAGACGCTCAAAGAATGCTACCGCTTACTCAACATGACTAGCCGTAGCTTTGCCTCAGT
GATACAGGAGCTCACCAGTGAAATCCGCGTTCCAGTCGTCCTCTTCTACCTGGTCCTGCGCGGCCTTGATACCAT
CGAGGATGACATGACCATCCCTATCGACAAGAAGGTGTCAATGCTGTGCAACTTCTACAAGACTATGGAAACAGA
TGGCTGGCAATTCCACGAAAGCAACGAAAAGGACCGCGAACTCCTGGAGAAGTTCGATGTTGTCATTACAGAGCT
CAAAAGGATCAAGAAGCCTTCCTACGAAATCATACATGACTTGACACAAAAAATGGGCAAAGGAATGGCCGACTA
TGCTCAGAACACAGACTTTATCGAAAATGGCGTTCAAACCGTTAAAGACTACGAGCTCTACTGTCACTACGTTGC
AGGTCTCGTTGGCGAAGGGTTGACGCGGCTATTCGTCGTAACAGAGCTAGGCAACCCCAAGCTTTCTGAGCGACC
AAGTTTGACAGAGTCTATGGGCCAAATTCTACAAAAAACCAACATCATCCGCGATATTCACGAAGACTGGCTAGA
TGGCAGACGATGGTACCCAAAGGAGATCTGGAGCAAATACGTCGACCGCTGGGAGGATTTGTTCGACGTCAAGTA
TCGCGATCAAGCCCTTAATTGTATTTCGGAAATGGTTCTCGATGCGCTCAAACATGTCGAGGAATGCCTCTTTTA
CATGGCAGCCATGCGGGAACAAAGCGTCTTCAACTTTGTCGCCATTCCCCAGACCATGGCAATTGCCACACTCGA
ACTAACATTTCGCAATCCAGCCGTGTTGGAGAGAAACGTCAAGATTACCAAAGGCGATGCCTGCCAGATTATGAT
GGAATCAACTCAAAATCTTTTCACCGTCTGTGAAGTTTATAGGCGGTACTGTCGACGTATCCATGCCAAGAACGA
TCCCCGGGATCCCAATTTCCTGGATATAAGCACACGATGTGCCAAAGTAGGCGTCTCAAAAACTTTTCATCTGTG
CATCCTGCTGACGCGGCCAACATAGATTGAACAGTTCATCGAGACGCTATACCCTAGGCAGGATCCCAAGATACT
CGCCGCTGAAAATGCAAAGCGGCAGAGAAAGGAGCCTACATCAGATCCAAGTGAAGGTTTGATCATGTTCGGCAT
TGTCACGCTCTGTCTCATCTTTATTTCCGCCATCATGGTAAGTGAAACCCGTTGTTGCCACATGTCTCAACTCAT
GTCTGACAACATGGCGTTTGACCAGCTCGGAACAGCTTGGGCCATGGGGGCCAAGTTTCCCGCCATTTCTGATCT
CCTCAACGAACCCAAGACGGCGATGCCGATACCAGAAGCCGTTCCTATAGGACGCGATGAACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail