Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|784
Gene name
LocationContig_117:3144..5934
Strand-
Gene length (bp)2790
Transcript length (bp)2790
Coding sequence length (bp)2790
Protein length (aa) 930

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 1.7E-70 438 681
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 1.2E-06 704 771

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FT92|PRM10_CANGA Pheromone-regulated membrane protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G04433g PE=3 SV=1 301 929 1.0E-146
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 391 929 8.0E-146
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 306 775 2.0E-137
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 410 771 4.0E-136
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 410 771 4.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FT92|PRM10_CANGA Pheromone-regulated membrane protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G04433g PE=3 SV=1 301 929 1.0E-146
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 391 929 8.0E-146
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 306 775 2.0E-137
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 410 771 4.0E-136
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 410 771 4.0E-136
sp|Q754J7|PRM10_ASHGO Pheromone-regulated membrane protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR075C PE=3 SV=1 278 771 2.0E-130
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 294 771 1.0E-129
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 302 772 5.0E-127
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 301 771 2.0E-123
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 423 772 3.0E-123
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 301 771 6.0E-123
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 278 771 8.0E-122
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 421 771 6.0E-83
sp|P42946|PRM10_YEAST Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM10 PE=1 SV=1 480 771 3.0E-80
sp|P42947|YJK7_YEAST Uncharacterized UPF0442 protein YJL107C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL107C PE=1 SV=1 278 473 2.0E-23
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 829 929 3.0E-19
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 829 929 5.0E-18
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 825 929 7.0E-18
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 825 929 2.0E-17
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 825 929 2.0E-17
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 825 929 4.0E-16
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 829 929 5.0E-16
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 825 929 1.0E-14
sp|P42946|PRM10_YEAST Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM10 PE=1 SV=1 825 928 2.0E-14
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 837 926 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 544 563 19
2 570 588 18
3 592 614 22
4 621 643 22
5 658 680 22
6 701 720 19
7 725 747 22
8 830 852 22
9 898 920 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup838
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6178
Ophiocordyceps australis map64 (Brazil) OphauB2|784 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03591
Ophiocordyceps camponoti-rufipedis Ophun1|1390
Ophiocordyceps kimflemingae Ophio5|3345
Ophiocordyceps subramaniannii Hirsu2|4359
Ophiocordyceps subramaniannii Hirsu2|5572

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|784
MATEPSNELPGQGSDLSTPTRKPKKRVGWHSSSNSGGGGSGAVDDSLRPTHSPPLASPRLIPGITPPGAPDAREL
RLALTKVLSDVREQKEQQAAQHYEQQEQILLLQKQQQQQQQQQQQGVQLQIPVISEPAPAATSSSKPPRPALRRN
TSYDAPEEREKADWAEQRTSQRQLRSMTDARQRADRLAMSVGSYSAQGSRRNSDELDTSFQPLMDDSDDRGRGHD
DDGVMGSDDNLDPDRIKRRAPHRRRGQDRSLHIDHAAAESLVKSHTLRDRNRDFYHREVAPTASGTQTPILQPQE
YIPRPSKFHGGILASLLKLYNDDHRATGSSSSSGYNTPLGTATPLMSPRASPSSSRPTSSLGGGFKTRTGHGLFS
SSRAQSSTTSLTELIKSSSMFAAPGASEIHDQWAEKIKKPHKPKKEQIRITVHIAGIISRHRYLLKLCRALMMYG
APTHRLEEYMVMSSRVLEIEGQFLYIPSCMIISFDDSSTHTTEVKLVRVPQGIDLGKLRDVHNVYKDVVHDKIGV
EEATRRLDEVMKCRPKFHTWFRVPMYGIASACVAPFAFEGRFIDLPVAFFLGCIVGLLQLVFAPSNELYAHIFEV
SAAVITSFLARLFGSLYGGQLFCFSALAQSSIALILPGYMVLCSSLELQSHNLVAGSVRMVHAMIYTLFLGYGIT
IGTSLYGMLDKEATSAIHCSKPLARGWYFLFVPGFALCLCVINQAKWKQTPVMLVMALAGFCVNSYCSQFFAQNS
QISNMLGALTIGILANLYSRLGSHVENMWLDLVEWWQFRMRPRFQKKNKTTADAWSPPSMSDVEAQPASADKPKR
LPRKVGYSLAAAAMLPAIFVQVPSGLAASGSLLAGITSADAINGNTTSPDVTLAAVKGLGSLDGTAFNVLFSVIQ
VAIGISVGLFMSALIVYPLGKRRSGLFSF*
Coding >OphauB2|784
ATGGCCACGGAGCCCAGTAACGAGCTTCCCGGCCAAGGCAGCGACTTGTCGACGCCAACGCGGAAGCCTAAGAAG
CGTGTGGGCTGGCATTCGAGCAGCAACAGCGGCGGAGGAGGATCAGGCGCTGTCGATGACTCTCTAAGACCTACT
CACTCTCCACCACTTGCTTCACCACGCCTCATTCCCGGCATTACTCCTCCCGGGGCGCCAGATGCTAGAGAACTG
CGACTTGCTTTGACCAAGGTGTTGTCTGATGTAAGGGAGCAAAAGGAGCAACAAGCAGCACAGCATTATGAGCAG
CAGGAACAAATCTTGCTGCTACAGAAACAGCAGCAACAGCAACAGCAACAGCAACAGCAAGGCGTGCAGCTGCAA
ATCCCCGTCATTTCTGAGCCGGCGCCGGCTGCCACGTCGTCATCCAAGCCTCCGAGGCCTGCTCTGAGACGCAAC
ACGAGCTACGATGCACCAGAGGAACGTGAAAAAGCAGATTGGGCGGAGCAGCGCACCAGCCAGCGTCAATTGCGC
TCCATGACGGACGCCCGCCAGCGCGCGGATCGCCTGGCAATGTCTGTCGGCAGCTACTCCGCCCAAGGCTCAAGA
CGTAACTCGGACGAGCTTGACACCTCATTCCAGCCCCTGATGGATGATTCAGACGATCGTGGCCGGGGCCACGAC
GACGATGGCGTCATGGGTTCCGACGATAATTTAGACCCAGACCGCATCAAGCGTCGCGCCCCCCACCGTCGCCGT
GGCCAAGATCGCTCGCTGCATATTGATCACGCTGCTGCTGAGTCTTTGGTCAAGTCGCACACTCTCCGTGATCGG
AACAGAGACTTTTACCATCGTGAAGTTGCGCCCACGGCCTCGGGCACGCAGACGCCCATTCTCCAGCCTCAAGAG
TACATACCTCGCCCGTCAAAGTTTCACGGCGGAATCCTGGCCTCTCTGCTCAAGCTCTACAACGATGATCATCGA
GCAACCGGCAGCAGCAGCAGCAGTGGTTACAACACGCCTCTCGGCACTGCAACTCCTCTCATGTCGCCTCGAGCC
TCACCTTCATCTTCAAGACCTACTTCGTCTCTCGGAGGAGGATTCAAAACCCGTACTGGTCACGGTTTGTTCAGC
AGCAGCCGTGCGCAAAGCTCCACCACATCCCTAACAGAGCTCATCAAGTCGTCCTCCATGTTCGCCGCACCGGGC
GCCAGCGAGATTCACGACCAATGGGCCGAGAAGATTAAGAAGCCGCACAAGCCCAAGAAGGAGCAGATTCGCATC
ACGGTCCACATTGCCGGCATCATTTCTCGCCATCGCTACCTCCTCAAGTTATGCCGTGCCCTTATGATGTACGGC
GCCCCGACGCACCGTCTCGAAGAATACATGGTCATGTCGTCGCGCGTCCTCGAGATTGAGGGACAATTTCTTTAT
ATTCCCTCGTGCATGATTATCAGCTTTGACGACAGCTCGACGCACACGACTGAAGTCAAGCTGGTGCGCGTGCCC
CAGGGCATTGATTTGGGAAAGCTCCGCGACGTGCACAATGTCTACAAGGATGTTGTTCACGACAAGATTGGCGTC
GAGGAGGCAACGCGTCGCCTCGACGAAGTCATGAAGTGTAGGCCCAAGTTTCATACATGGTTCCGCGTGCCCATG
TATGGAATCGCGTCGGCCTGCGTTGCTCCGTTTGCCTTTGAGGGCCGCTTTATTGACTTGCCCGTGGCCTTTTTT
CTCGGCTGTATTGTCGGGCTGTTGCAGCTCGTCTTTGCGCCCAGCAACGAGCTCTATGCACACATTTTTGAAGTG
TCGGCTGCAGTCATTACTTCGTTTCTCGCCCGTCTGTTTGGCTCACTCTACGGCGGCCAGCTGTTTTGCTTCAGC
GCCCTGGCCCAGAGCAGCATCGCCCTCATCCTCCCAGGCTACATGGTGTTGTGCAGTTCCCTTGAGCTGCAGAGC
CACAACTTGGTGGCTGGCAGCGTAAGAATGGTGCACGCCATGATTTACACCTTGTTCTTGGGCTACGGCATCACC
ATTGGTACTTCTCTGTACGGCATGCTGGACAAGGAGGCAACGAGCGCCATTCACTGCAGCAAGCCTCTGGCCCGC
GGATGGTACTTTTTGTTTGTGCCTGGATTCGCTCTCTGCCTGTGTGTCATCAACCAGGCCAAGTGGAAGCAGACA
CCCGTCATGTTGGTCATGGCGCTCGCCGGCTTTTGCGTCAACAGCTACTGCAGCCAATTCTTTGCACAAAACAGC
CAGATTTCCAATATGCTGGGCGCCCTGACGATTGGCATCCTGGCCAACCTTTATTCGAGGCTGGGCAGCCACGTG
GAAAACATGTGGCTCGACCTTGTCGAGTGGTGGCAATTCCGGATGCGCCCTCGCTTCCAAAAGAAGAACAAGACG
ACTGCCGACGCCTGGTCTCCGCCGTCCATGTCTGATGTTGAGGCACAGCCCGCATCAGCCGATAAGCCCAAGCGG
CTGCCGCGCAAGGTTGGCTACAGCCTCGCAGCAGCGGCCATGCTGCCGGCCATTTTTGTCCAAGTGCCATCGGGG
CTGGCGGCCAGTGGCTCGCTACTGGCAGGCATCACATCGGCCGATGCCATTAATGGCAATACGACATCGCCAGAT
GTAACGCTAGCGGCCGTCAAGGGCCTGGGCAGCTTGGACGGAACGGCATTTAATGTCTTGTTTAGCGTCATCCAG
GTTGCCATTGGCATTAGCGTTGGTTTGTTTATGAGCGCGCTCATTGTCTACCCGCTGGGCAAGCGGCGCAGTGGA
CTCTTTAGCTTTTGA
Transcript >OphauB2|784
ATGGCCACGGAGCCCAGTAACGAGCTTCCCGGCCAAGGCAGCGACTTGTCGACGCCAACGCGGAAGCCTAAGAAG
CGTGTGGGCTGGCATTCGAGCAGCAACAGCGGCGGAGGAGGATCAGGCGCTGTCGATGACTCTCTAAGACCTACT
CACTCTCCACCACTTGCTTCACCACGCCTCATTCCCGGCATTACTCCTCCCGGGGCGCCAGATGCTAGAGAACTG
CGACTTGCTTTGACCAAGGTGTTGTCTGATGTAAGGGAGCAAAAGGAGCAACAAGCAGCACAGCATTATGAGCAG
CAGGAACAAATCTTGCTGCTACAGAAACAGCAGCAACAGCAACAGCAACAGCAACAGCAAGGCGTGCAGCTGCAA
ATCCCCGTCATTTCTGAGCCGGCGCCGGCTGCCACGTCGTCATCCAAGCCTCCGAGGCCTGCTCTGAGACGCAAC
ACGAGCTACGATGCACCAGAGGAACGTGAAAAAGCAGATTGGGCGGAGCAGCGCACCAGCCAGCGTCAATTGCGC
TCCATGACGGACGCCCGCCAGCGCGCGGATCGCCTGGCAATGTCTGTCGGCAGCTACTCCGCCCAAGGCTCAAGA
CGTAACTCGGACGAGCTTGACACCTCATTCCAGCCCCTGATGGATGATTCAGACGATCGTGGCCGGGGCCACGAC
GACGATGGCGTCATGGGTTCCGACGATAATTTAGACCCAGACCGCATCAAGCGTCGCGCCCCCCACCGTCGCCGT
GGCCAAGATCGCTCGCTGCATATTGATCACGCTGCTGCTGAGTCTTTGGTCAAGTCGCACACTCTCCGTGATCGG
AACAGAGACTTTTACCATCGTGAAGTTGCGCCCACGGCCTCGGGCACGCAGACGCCCATTCTCCAGCCTCAAGAG
TACATACCTCGCCCGTCAAAGTTTCACGGCGGAATCCTGGCCTCTCTGCTCAAGCTCTACAACGATGATCATCGA
GCAACCGGCAGCAGCAGCAGCAGTGGTTACAACACGCCTCTCGGCACTGCAACTCCTCTCATGTCGCCTCGAGCC
TCACCTTCATCTTCAAGACCTACTTCGTCTCTCGGAGGAGGATTCAAAACCCGTACTGGTCACGGTTTGTTCAGC
AGCAGCCGTGCGCAAAGCTCCACCACATCCCTAACAGAGCTCATCAAGTCGTCCTCCATGTTCGCCGCACCGGGC
GCCAGCGAGATTCACGACCAATGGGCCGAGAAGATTAAGAAGCCGCACAAGCCCAAGAAGGAGCAGATTCGCATC
ACGGTCCACATTGCCGGCATCATTTCTCGCCATCGCTACCTCCTCAAGTTATGCCGTGCCCTTATGATGTACGGC
GCCCCGACGCACCGTCTCGAAGAATACATGGTCATGTCGTCGCGCGTCCTCGAGATTGAGGGACAATTTCTTTAT
ATTCCCTCGTGCATGATTATCAGCTTTGACGACAGCTCGACGCACACGACTGAAGTCAAGCTGGTGCGCGTGCCC
CAGGGCATTGATTTGGGAAAGCTCCGCGACGTGCACAATGTCTACAAGGATGTTGTTCACGACAAGATTGGCGTC
GAGGAGGCAACGCGTCGCCTCGACGAAGTCATGAAGTGTAGGCCCAAGTTTCATACATGGTTCCGCGTGCCCATG
TATGGAATCGCGTCGGCCTGCGTTGCTCCGTTTGCCTTTGAGGGCCGCTTTATTGACTTGCCCGTGGCCTTTTTT
CTCGGCTGTATTGTCGGGCTGTTGCAGCTCGTCTTTGCGCCCAGCAACGAGCTCTATGCACACATTTTTGAAGTG
TCGGCTGCAGTCATTACTTCGTTTCTCGCCCGTCTGTTTGGCTCACTCTACGGCGGCCAGCTGTTTTGCTTCAGC
GCCCTGGCCCAGAGCAGCATCGCCCTCATCCTCCCAGGCTACATGGTGTTGTGCAGTTCCCTTGAGCTGCAGAGC
CACAACTTGGTGGCTGGCAGCGTAAGAATGGTGCACGCCATGATTTACACCTTGTTCTTGGGCTACGGCATCACC
ATTGGTACTTCTCTGTACGGCATGCTGGACAAGGAGGCAACGAGCGCCATTCACTGCAGCAAGCCTCTGGCCCGC
GGATGGTACTTTTTGTTTGTGCCTGGATTCGCTCTCTGCCTGTGTGTCATCAACCAGGCCAAGTGGAAGCAGACA
CCCGTCATGTTGGTCATGGCGCTCGCCGGCTTTTGCGTCAACAGCTACTGCAGCCAATTCTTTGCACAAAACAGC
CAGATTTCCAATATGCTGGGCGCCCTGACGATTGGCATCCTGGCCAACCTTTATTCGAGGCTGGGCAGCCACGTG
GAAAACATGTGGCTCGACCTTGTCGAGTGGTGGCAATTCCGGATGCGCCCTCGCTTCCAAAAGAAGAACAAGACG
ACTGCCGACGCCTGGTCTCCGCCGTCCATGTCTGATGTTGAGGCACAGCCCGCATCAGCCGATAAGCCCAAGCGG
CTGCCGCGCAAGGTTGGCTACAGCCTCGCAGCAGCGGCCATGCTGCCGGCCATTTTTGTCCAAGTGCCATCGGGG
CTGGCGGCCAGTGGCTCGCTACTGGCAGGCATCACATCGGCCGATGCCATTAATGGCAATACGACATCGCCAGAT
GTAACGCTAGCGGCCGTCAAGGGCCTGGGCAGCTTGGACGGAACGGCATTTAATGTCTTGTTTAGCGTCATCCAG
GTTGCCATTGGCATTAGCGTTGGTTTGTTTATGAGCGCGCTCATTGTCTACCCGCTGGGCAAGCGGCGCAGTGGA
CTCTTTAGCTTTTGA
Gene >OphauB2|784
ATGGCCACGGAGCCCAGTAACGAGCTTCCCGGCCAAGGCAGCGACTTGTCGACGCCAACGCGGAAGCCTAAGAAG
CGTGTGGGCTGGCATTCGAGCAGCAACAGCGGCGGAGGAGGATCAGGCGCTGTCGATGACTCTCTAAGACCTACT
CACTCTCCACCACTTGCTTCACCACGCCTCATTCCCGGCATTACTCCTCCCGGGGCGCCAGATGCTAGAGAACTG
CGACTTGCTTTGACCAAGGTGTTGTCTGATGTAAGGGAGCAAAAGGAGCAACAAGCAGCACAGCATTATGAGCAG
CAGGAACAAATCTTGCTGCTACAGAAACAGCAGCAACAGCAACAGCAACAGCAACAGCAAGGCGTGCAGCTGCAA
ATCCCCGTCATTTCTGAGCCGGCGCCGGCTGCCACGTCGTCATCCAAGCCTCCGAGGCCTGCTCTGAGACGCAAC
ACGAGCTACGATGCACCAGAGGAACGTGAAAAAGCAGATTGGGCGGAGCAGCGCACCAGCCAGCGTCAATTGCGC
TCCATGACGGACGCCCGCCAGCGCGCGGATCGCCTGGCAATGTCTGTCGGCAGCTACTCCGCCCAAGGCTCAAGA
CGTAACTCGGACGAGCTTGACACCTCATTCCAGCCCCTGATGGATGATTCAGACGATCGTGGCCGGGGCCACGAC
GACGATGGCGTCATGGGTTCCGACGATAATTTAGACCCAGACCGCATCAAGCGTCGCGCCCCCCACCGTCGCCGT
GGCCAAGATCGCTCGCTGCATATTGATCACGCTGCTGCTGAGTCTTTGGTCAAGTCGCACACTCTCCGTGATCGG
AACAGAGACTTTTACCATCGTGAAGTTGCGCCCACGGCCTCGGGCACGCAGACGCCCATTCTCCAGCCTCAAGAG
TACATACCTCGCCCGTCAAAGTTTCACGGCGGAATCCTGGCCTCTCTGCTCAAGCTCTACAACGATGATCATCGA
GCAACCGGCAGCAGCAGCAGCAGTGGTTACAACACGCCTCTCGGCACTGCAACTCCTCTCATGTCGCCTCGAGCC
TCACCTTCATCTTCAAGACCTACTTCGTCTCTCGGAGGAGGATTCAAAACCCGTACTGGTCACGGTTTGTTCAGC
AGCAGCCGTGCGCAAAGCTCCACCACATCCCTAACAGAGCTCATCAAGTCGTCCTCCATGTTCGCCGCACCGGGC
GCCAGCGAGATTCACGACCAATGGGCCGAGAAGATTAAGAAGCCGCACAAGCCCAAGAAGGAGCAGATTCGCATC
ACGGTCCACATTGCCGGCATCATTTCTCGCCATCGCTACCTCCTCAAGTTATGCCGTGCCCTTATGATGTACGGC
GCCCCGACGCACCGTCTCGAAGAATACATGGTCATGTCGTCGCGCGTCCTCGAGATTGAGGGACAATTTCTTTAT
ATTCCCTCGTGCATGATTATCAGCTTTGACGACAGCTCGACGCACACGACTGAAGTCAAGCTGGTGCGCGTGCCC
CAGGGCATTGATTTGGGAAAGCTCCGCGACGTGCACAATGTCTACAAGGATGTTGTTCACGACAAGATTGGCGTC
GAGGAGGCAACGCGTCGCCTCGACGAAGTCATGAAGTGTAGGCCCAAGTTTCATACATGGTTCCGCGTGCCCATG
TATGGAATCGCGTCGGCCTGCGTTGCTCCGTTTGCCTTTGAGGGCCGCTTTATTGACTTGCCCGTGGCCTTTTTT
CTCGGCTGTATTGTCGGGCTGTTGCAGCTCGTCTTTGCGCCCAGCAACGAGCTCTATGCACACATTTTTGAAGTG
TCGGCTGCAGTCATTACTTCGTTTCTCGCCCGTCTGTTTGGCTCACTCTACGGCGGCCAGCTGTTTTGCTTCAGC
GCCCTGGCCCAGAGCAGCATCGCCCTCATCCTCCCAGGCTACATGGTGTTGTGCAGTTCCCTTGAGCTGCAGAGC
CACAACTTGGTGGCTGGCAGCGTAAGAATGGTGCACGCCATGATTTACACCTTGTTCTTGGGCTACGGCATCACC
ATTGGTACTTCTCTGTACGGCATGCTGGACAAGGAGGCAACGAGCGCCATTCACTGCAGCAAGCCTCTGGCCCGC
GGATGGTACTTTTTGTTTGTGCCTGGATTCGCTCTCTGCCTGTGTGTCATCAACCAGGCCAAGTGGAAGCAGACA
CCCGTCATGTTGGTCATGGCGCTCGCCGGCTTTTGCGTCAACAGCTACTGCAGCCAATTCTTTGCACAAAACAGC
CAGATTTCCAATATGCTGGGCGCCCTGACGATTGGCATCCTGGCCAACCTTTATTCGAGGCTGGGCAGCCACGTG
GAAAACATGTGGCTCGACCTTGTCGAGTGGTGGCAATTCCGGATGCGCCCTCGCTTCCAAAAGAAGAACAAGACG
ACTGCCGACGCCTGGTCTCCGCCGTCCATGTCTGATGTTGAGGCACAGCCCGCATCAGCCGATAAGCCCAAGCGG
CTGCCGCGCAAGGTTGGCTACAGCCTCGCAGCAGCGGCCATGCTGCCGGCCATTTTTGTCCAAGTGCCATCGGGG
CTGGCGGCCAGTGGCTCGCTACTGGCAGGCATCACATCGGCCGATGCCATTAATGGCAATACGACATCGCCAGAT
GTAACGCTAGCGGCCGTCAAGGGCCTGGGCAGCTTGGACGGAACGGCATTTAATGTCTTGTTTAGCGTCATCCAG
GTTGCCATTGGCATTAGCGTTGGTTTGTTTATGAGCGCGCTCATTGTCTACCCGCTGGGCAAGCGGCGCAGTGGA
CTCTTTAGCTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail