Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7837
Gene name
LocationContig_9:79998..82161
Strand-
Gene length (bp)2163
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03062 MBOAT MBOAT, membrane-bound O-acyltransferase family 3.0E-44 256 559

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53154|GUP1_YEAST Glycerol uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP1 PE=1 SV=1 43 614 4.0E-166
sp|Q08929|GUP2_YEAST Glycerol uptake protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP2 PE=3 SV=1 36 614 1.0E-134
sp|Q09758|YA71_SCHPO Putative membrane-bound O-acyltransferase C24H6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.01c PE=3 SV=4 52 614 2.0E-134
sp|Q5VTY9|HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens GN=HHAT PE=1 SV=1 308 498 7.0E-12
sp|Q8BMT9|HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus GN=Hhat PE=2 SV=1 295 507 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53154|GUP1_YEAST Glycerol uptake protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP1 PE=1 SV=1 43 614 4.0E-166
sp|Q08929|GUP2_YEAST Glycerol uptake protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUP2 PE=3 SV=1 36 614 1.0E-134
sp|Q09758|YA71_SCHPO Putative membrane-bound O-acyltransferase C24H6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.01c PE=3 SV=4 52 614 2.0E-134
sp|Q5VTY9|HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens GN=HHAT PE=1 SV=1 308 498 7.0E-12
sp|Q8BMT9|HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus GN=Hhat PE=2 SV=1 295 507 1.0E-11
sp|Q9HCP6|HHATL_HUMAN Protein-cysteine N-palmitoyltransferase HHAT-like protein OS=Homo sapiens GN=HHATL PE=2 SV=1 216 473 2.0E-07
sp|Q9D1G3|HHATL_MOUSE Protein-cysteine N-palmitoyltransferase HHAT-like protein OS=Mus musculus GN=Hhatl PE=1 SV=2 213 473 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 64 83 19
2 170 192 22
3 212 234 22
4 320 342 22
5 361 383 22
6 398 420 22
7 459 481 22
8 505 527 22
9 540 562 22
10 577 599 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7837
MGAVSQLAKVYDLDTLDTRFTSSSSVPYQTVIDARSDAAACSEAESKAQARRLAQPPKWQTPEFYFYRAAFLVVV
PYMFWIAYDVSRASDPRYDKYKEFLSPGWIPGRLVDVSDAQYHTFRGNLPYMLVLLLLHPLLRRAWQSVYAVPAL
AASVAARGAARLEQRASFDFVFGLVFLFALHGVSAAKVLAILRINYLIATRVSRRYMPAATWIFNVATLFANELC
QGYRLAVLAGWLAPGSALVHWGEWLDGYGGLVSRWEVLFNITILRLVSFNLDYYWSVNGRHASSVEKKQLDLANL
SERDRITISAAVVDFGFRNYIAYAIYAPLYLAGPILTFNDYICQLKFRAPSIEPARTARYALRFALALLAMELVL
HFDYVGAISKAAPLWSSYSPAQLSLLSFFNLHIIWLKLLLPWRLFRLWALADDIDPPENMVRCVSNNYSTQLFWR
AWHRSYNRWLIRYIYVPLGGGGSFASWLDAARSIVTYLLVFTFVALWHDIQLRLLLWGWLIVLFMLPEWIATWLF
PARRWKGRPTAYRMLCCVGAIANVLMMMAANLVGFAVGLDGLQSIVAGILHDWAGFIFLIVACSCLFIGIQVMFE
IREMEKRKGITLKC*
Coding >OphauB2|7837
ATGGGTGCCGTCTCGCAGCTAGCCAAGGTCTATGACCTGGACACGCTCGACACGCGCTTCACGAGCTCGTCGTCT
GTGCCTTACCAGACGGTGATTGATGCGCGGAGCGACGCCGCGGCGTGCAGCGAGGCAGAGAGCAAGGCACAGGCA
CGCAGGCTTGCGCAGCCGCCAAAATGGCAGACGCCAGAGTTTTACTTTTACAGAGCGGCCTTTTTGGTGGTGGTG
CCGTATATGTTTTGGATAGCATATGACGTGTCGAGAGCTTCGGATCCGCGCTACGACAAGTACAAGGAGTTTCTC
TCGCCGGGCTGGATTCCAGGGCGCTTGGTGGACGTGTCGGATGCGCAGTATCATACGTTTCGGGGAAATCTGCCG
TATATGCTTGTGCTGCTGCTGCTGCATCCCTTGTTGAGACGAGCGTGGCAGTCTGTCTATGCCGTGCCAGCTTTG
GCGGCGAGCGTAGCGGCAAGGGGCGCGGCACGGCTGGAGCAGCGCGCATCGTTTGACTTTGTCTTTGGCCTCGTC
TTCCTCTTTGCCTTGCACGGCGTGTCGGCGGCCAAGGTGCTGGCTATTTTGCGCATCAATTACCTCATTGCCACT
AGAGTCTCGCGGCGCTACATGCCTGCTGCCACGTGGATCTTCAACGTTGCCACGCTTTTTGCCAATGAGCTTTGC
CAAGGGTACAGGCTTGCTGTGCTGGCTGGCTGGCTTGCGCCCGGCTCGGCGCTTGTGCACTGGGGGGAGTGGCTG
GATGGCTATGGCGGGCTCGTGTCGCGCTGGGAAGTGCTCTTCAACATTACCATTCTTCGCCTCGTCAGCTTCAAC
CTCGACTACTACTGGAGCGTCAATGGCCGCCACGCGAGCTCAGTCGAGAAGAAGCAGCTCGACCTGGCCAACTTG
TCGGAACGCGACCGCATCACTATTTCCGCCGCTGTCGTTGACTTTGGCTTCCGCAACTACATTGCCTACGCCATC
TACGCACCCCTCTACCTTGCTGGCCCCATCCTCACCTTCAACGACTACATTTGCCAGCTCAAGTTTCGCGCTCCC
AGCATCGAGCCCGCCCGCACCGCCCGCTACGCCCTGCGCTTCGCCCTCGCCCTGCTCGCCATGGAACTCGTCCTG
CATTTTGACTATGTCGGAGCCATTTCCAAGGCGGCGCCCCTCTGGTCTTCGTACTCGCCAGCCCAGCTCAGCCTC
CTCTCCTTCTTCAACCTGCACATCATCTGGCTCAAGCTCCTCCTGCCCTGGCGCCTCTTTCGCCTCTGGGCCCTG
GCCGACGACATTGACCCGCCCGAAAACATGGTGCGCTGCGTCAGCAATAATTACAGCACCCAGCTCTTTTGGCGC
GCCTGGCATCGCTCATACAACCGCTGGCTCATTCGCTATATTTACGTGCCTCTTGGCGGCGGCGGGTCGTTTGCC
TCGTGGCTGGATGCCGCCCGCTCCATTGTCACATACCTGCTTGTCTTTACCTTTGTTGCCCTGTGGCATGATATT
CAGCTGCGACTCTTGCTTTGGGGCTGGCTCATTGTCTTGTTTATGCTGCCAGAGTGGATTGCCACTTGGCTTTTT
CCCGCTCGACGATGGAAGGGACGCCCCACGGCGTATCGGATGCTGTGCTGCGTGGGTGCCATTGCCAATGTTCTC
ATGATGATGGCGGCCAATCTCGTTGGCTTTGCTGTTGGGCTTGATGGCTTACAGAGCATCGTGGCTGGCATTCTG
CATGACTGGGCAGGCTTCATCTTCTTGATTGTTGCCTGCTCATGTCTTTTTATTGGAATACAAGTCATGTTTGAG
ATTCGCGAGATGGAGAAGCGCAAGGGCATAACGCTAAAGTGCTGA
Transcript >OphauB2|7837
ATGGGTGCCGTCTCGCAGCTAGCCAAGGTCTATGACCTGGACACGCTCGACACGCGCTTCACGAGCTCGTCGTCT
GTGCCTTACCAGACGGTGATTGATGCGCGGAGCGACGCCGCGGCGTGCAGCGAGGCAGAGAGCAAGGCACAGGCA
CGCAGGCTTGCGCAGCCGCCAAAATGGCAGACGCCAGAGTTTTACTTTTACAGAGCGGCCTTTTTGGTGGTGGTG
CCGTATATGTTTTGGATAGCATATGACGTGTCGAGAGCTTCGGATCCGCGCTACGACAAGTACAAGGAGTTTCTC
TCGCCGGGCTGGATTCCAGGGCGCTTGGTGGACGTGTCGGATGCGCAGTATCATACGTTTCGGGGAAATCTGCCG
TATATGCTTGTGCTGCTGCTGCTGCATCCCTTGTTGAGACGAGCGTGGCAGTCTGTCTATGCCGTGCCAGCTTTG
GCGGCGAGCGTAGCGGCAAGGGGCGCGGCACGGCTGGAGCAGCGCGCATCGTTTGACTTTGTCTTTGGCCTCGTC
TTCCTCTTTGCCTTGCACGGCGTGTCGGCGGCCAAGGTGCTGGCTATTTTGCGCATCAATTACCTCATTGCCACT
AGAGTCTCGCGGCGCTACATGCCTGCTGCCACGTGGATCTTCAACGTTGCCACGCTTTTTGCCAATGAGCTTTGC
CAAGGGTACAGGCTTGCTGTGCTGGCTGGCTGGCTTGCGCCCGGCTCGGCGCTTGTGCACTGGGGGGAGTGGCTG
GATGGCTATGGCGGGCTCGTGTCGCGCTGGGAAGTGCTCTTCAACATTACCATTCTTCGCCTCGTCAGCTTCAAC
CTCGACTACTACTGGAGCGTCAATGGCCGCCACGCGAGCTCAGTCGAGAAGAAGCAGCTCGACCTGGCCAACTTG
TCGGAACGCGACCGCATCACTATTTCCGCCGCTGTCGTTGACTTTGGCTTCCGCAACTACATTGCCTACGCCATC
TACGCACCCCTCTACCTTGCTGGCCCCATCCTCACCTTCAACGACTACATTTGCCAGCTCAAGTTTCGCGCTCCC
AGCATCGAGCCCGCCCGCACCGCCCGCTACGCCCTGCGCTTCGCCCTCGCCCTGCTCGCCATGGAACTCGTCCTG
CATTTTGACTATGTCGGAGCCATTTCCAAGGCGGCGCCCCTCTGGTCTTCGTACTCGCCAGCCCAGCTCAGCCTC
CTCTCCTTCTTCAACCTGCACATCATCTGGCTCAAGCTCCTCCTGCCCTGGCGCCTCTTTCGCCTCTGGGCCCTG
GCCGACGACATTGACCCGCCCGAAAACATGGTGCGCTGCGTCAGCAATAATTACAGCACCCAGCTCTTTTGGCGC
GCCTGGCATCGCTCATACAACCGCTGGCTCATTCGCTATATTTACGTGCCTCTTGGCGGCGGCGGGTCGTTTGCC
TCGTGGCTGGATGCCGCCCGCTCCATTGTCACATACCTGCTTGTCTTTACCTTTGTTGCCCTGTGGCATGATATT
CAGCTGCGACTCTTGCTTTGGGGCTGGCTCATTGTCTTGTTTATGCTGCCAGAGTGGATTGCCACTTGGCTTTTT
CCCGCTCGACGATGGAAGGGACGCCCCACGGCGTATCGGATGCTGTGCTGCGTGGGTGCCATTGCCAATGTTCTC
ATGATGATGGCGGCCAATCTCGTTGGCTTTGCTGTTGGGCTTGATGGCTTACAGAGCATCGTGGCTGGCATTCTG
CATGACTGGGCAGGCTTCATCTTCTTGATTGTTGCCTGCTCATGTCTTTTTATTGGAATACAAGTCATGTTTGAG
ATTCGCGAGATGGAGAAGCGCAAGGGCATAACGCTAAAGTGCTGA
Gene >OphauB2|7837
ATGGGTGCCGTCTCGCAGCTAGCCAAGGTCTATGACCTGGACACGCTCGACACGCGCTTCACGAGCTCGTCGTCT
GTGCCTTACCAGACGGTGATTGATGCGCGGAGCGACGCCGCGGCGTGCAGCGAGGCAGAGAGCAAGGCACAGGCA
CGCAGGCTTGCGCAGCCGCCAAAATGGCAGACGCCAGAGTTTTACTTTTACAGAGCGGCCTTTTTGGTGGTGGTG
CCGTATATGTTTTGGATAGCATATGACGTGTCGAGAGGTGCGTGAGAACCTTTCTCTCTCTCTTTTTTTTTTCTT
CTTGTTTTTTTCTCTACCTTCACCTTCTCCTTGGTTTTGGAGGGCTTTGGCTGATTTGTGGGCGCAGCTTCGGAT
CCGCGCTACGACAAGTACAAGGAGTTTCTCTCGCCGGGCTGGATTCCAGGGCGCTTGGTGGACGTGTCGGATGCG
CAGTATCATACGTTTCGGGGAAATCTGCCGTATATGCTTGTGCTGCTGCTGCTGCATCCCTTGTTGAGACGAGCG
TGGCAGTCTGTCTATGCCGTGCCAGCTTTGGCGGCGAGCGTAGCGGCAAGGGGCGCGGCACGGCTGGAGCAGCGC
GCATCGTTTGACTTTGTCTTTGGCCTCGTCTTCCTCTTTGCCTTGCACGGCGTGTCGGCGGCCAAGGTGCTGGCT
ATTTTGCGCATCAATTACCTCATTGCCACTAGAGTCTCGCGGCGCTACATGCCTGCTGCCACGTGGATCTTCAAC
GTTGCCACGCTTTTTGCCAATGAGCTTTGCCAAGGGTACAGGCTTGCTGTGCTGGCTGGCTGGCTTGCGCCCGGC
TCGGCGCTTGTGCACTGGGGGGAGTGGCTGGATGGCTATGGCGGGCTCGTGTCGCGCTGGGAAGTGCTCTTCAAC
ATTACCATTCTTCGCCTCGTCAGCTTCAACCTCGACTACTACTGGAGCGTCAATGGCCGCCACGCGAGCTCAGTC
GAGGTATGCTCCTCCTTGCTTCACTCGAGGCCTCGCAAGGCGTCAGTCAATGTCTAGAGCTAAGTCGTCCAAGAA
GAAGCAGCTCGACCTGGCCAACTTGTCGGAACGCGACCGCATCACTATTTCCGCCGCTGTCGTTGACTTTGGCTT
CCGCAACTACATTGCCTACGCCATCTACGCACCCCTCTACCTTGCTGGCCCCATCCTCACCTTCAACGACTACAT
TTGCCAGCTCAAGTTTCGCGCTCCCAGCATCGAGCCCGCCCGCACCGCCCGCTACGCCCTGCGCTTCGCCCTCGC
CCTGCTCGCCATGGAACTCGTCCTGCATTTTGACTATGTCGGAGCCATTTCCAAGGCGGCGCCCCTCTGGTCTTC
GTACTCGCCAGCCCAGCTCAGCCTCCTCTCCTTCTTCAACCTGCACATCATCTGGCTCAAGCTCCTCCTGCCCTG
GCGCCTCTTTCGCCTCTGGGCCCTGGCCGACGACATTGACCCGCCCGAAAACATGGTGCGCTGCGTCAGCAATAA
TTACAGCACCCAGCTCTTTTGGCGCGCCTGGCATCGCTCATACAACCGCTGGCTCATTCGCTATATTTACGTGCC
TCTTGGCGGCGGCGGGTCGTTTGCCTCGTGGCTGGATGCCGCCCGCTCCATTGTCACATACCTGCTTGTCTTTAC
CTTTGTTGCCCTGTGGCATGATATTCAGCTGCGACTCTTGCTTTGGGGCTGGCTCATTGTCTTGTTTATGCTGCC
AGAGTGGATTGCCACTTGGCTTTTTCCCGCTCGACGATGGAAGGGACGCCCCACGGCGTATCGGATGCTGTGCTG
CGTGGGTGCCATTGCCAATGTTCTCATGATGATGGCGGCCAATCTCGTTGGCTTTGCTGTTGGGCTTGATGGCTT
ACAGAGCATCGTGGCTGGCATTCTGCATGACTGGGCAGGTGAGCTTCATCCCCTGCTTTTTTCTTCTTCTTCTTC
TCTAGAGCCCTTTGCCCATTTTCACTCTTTTGTGCCCGCATGAATTATGAAACGTTGGCAAGCCAAAAGACATTT
TGCTTGTGTGCTAACTCTTGATTACTCATAGGCTTCATCTTCTTGATTGTTGCCTGCTCATGTCTTTTTATTGGA
ATACAAGTCATGTTTGAGATTCGCGAGATGGAGAAGCGCAAGGGCATAACGCTAAAGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail