Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|783
Gene name
LocationContig_117:211..2267
Strand+
Gene length (bp)2056
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 1.2E-23 134 609
PF07687 M20_dimer Peptidase dimerisation domain 6.1E-10 260 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 61 423 4.0E-71
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 31 420 1.0E-67
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 31 385 2.0E-59
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 52 412 4.0E-38
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 7 415 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 61 423 4.0E-71
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 31 420 1.0E-67
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 31 385 2.0E-59
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 52 412 4.0E-38
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 7 415 2.0E-37
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 52 417 4.0E-36
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 52 386 3.0E-31
sp|Q08BB2|P2012_DANRE Probable carboxypeptidase PM20D1.2 OS=Danio rerio GN=pm20d1.2 PE=2 SV=1 62 421 1.0E-30
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 1 388 2.0E-30
sp|Q6GTS8|P20D1_HUMAN Probable carboxypeptidase PM20D1 OS=Homo sapiens GN=PM20D1 PE=2 SV=3 52 388 2.0E-28
sp|Q32LT9|P2011_DANRE Probable carboxypeptidase PM20D1.1 OS=Danio rerio GN=pm20d1.1 PE=2 SV=1 62 421 1.0E-27
sp|Q55DL1|CBPS1_DICDI Probable carboxypeptidase S-like 1 OS=Dictyostelium discoideum GN=DDB_G0270582 PE=3 SV=1 65 303 2.0E-25
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 506 613 2.0E-16
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 506 611 3.0E-14
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 515 609 2.0E-10
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 507 609 2.0E-10
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 507 613 3.0E-10
sp|Q55DL1|CBPS1_DICDI Probable carboxypeptidase S-like 1 OS=Dictyostelium discoideum GN=DDB_G0270582 PE=3 SV=1 507 610 3.0E-10
sp|Q6GTS8|P20D1_HUMAN Probable carboxypeptidase PM20D1 OS=Homo sapiens GN=PM20D1 PE=2 SV=3 515 613 7.0E-10
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 503 607 4.0E-09
sp|B8F824|DAPE_HAEPS Succinyl-diaminopimelate desuccinylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dapE PE=3 SV=1 117 228 2.0E-08
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 519 609 4.0E-08
sp|B0BTF3|DAPE_ACTPJ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapE PE=3 SV=1 117 228 4.0E-08
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 507 613 7.0E-08
sp|B0UT10|DAPE_HISS2 Succinyl-diaminopimelate desuccinylase OS=Histophilus somni (strain 2336) GN=dapE PE=3 SV=1 117 228 1.0E-07
sp|A9NCE9|DAPE_COXBR Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapE PE=3 SV=1 117 412 1.0E-07
sp|B6J929|DAPE_COXB1 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuK_Q154) GN=dapE PE=3 SV=1 117 412 1.0E-07
sp|B6J120|DAPE_COXB2 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuG_Q212) GN=dapE PE=3 SV=1 117 412 1.0E-07
sp|Q83DN2|DAPE_COXBU Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapE PE=3 SV=1 117 412 1.0E-07
sp|A9KC82|DAPE_COXBN Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapE PE=3 SV=1 117 412 1.0E-07
sp|Q28VJ1|DAPE_JANSC Succinyl-diaminopimelate desuccinylase OS=Jannaschia sp. (strain CCS1) GN=dapE PE=3 SV=1 120 278 2.0E-07
sp|Q99JW2|ACY1_MOUSE Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1 111 364 3.0E-07
sp|Q1R039|DAPE_CHRSD Succinyl-diaminopimelate desuccinylase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapE PE=3 SV=1 117 228 3.0E-07
sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 120 364 3.0E-07
sp|Q65US9|DAPE_MANSM Succinyl-diaminopimelate desuccinylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dapE PE=3 SV=1 133 228 3.0E-07
sp|A5CXE9|DAPE_VESOH Succinyl-diaminopimelate desuccinylase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dapE PE=3 SV=1 117 227 3.0E-07
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 117 228 4.0E-07
sp|P37111|ACY1_PIG Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2 120 364 5.0E-07
sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 120 364 6.0E-07
sp|Q3IL20|DAPE_PSEHT Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dapE PE=3 SV=1 137 280 6.0E-07
sp|Q1H051|DAPE_METFK Succinyl-diaminopimelate desuccinylase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dapE PE=3 SV=1 117 228 1.0E-06
sp|Q7VRT2|DAPE_BLOFL Succinyl-diaminopimelate desuccinylase OS=Blochmannia floridanus GN=dapE PE=3 SV=1 124 413 1.0E-06
sp|Q9CM22|DAPE_PASMU Succinyl-diaminopimelate desuccinylase OS=Pasteurella multocida (strain Pm70) GN=dapE PE=3 SV=1 133 228 1.0E-06
sp|Q4QP83|DAPE_HAEI8 Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain 86-028NP) GN=dapE PE=3 SV=1 133 228 1.0E-06
sp|A5UB44|DAPE_HAEIE Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittEE) GN=dapE PE=3 SV=1 133 228 2.0E-06
sp|A4VMY9|DAPE_PSEU5 Succinyl-diaminopimelate desuccinylase OS=Pseudomonas stutzeri (strain A1501) GN=dapE PE=3 SV=1 120 228 3.0E-06
sp|Q9PH30|DAPE_XYLFA Succinyl-diaminopimelate desuccinylase OS=Xylella fastidiosa (strain 9a5c) GN=dapE PE=3 SV=1 117 280 5.0E-06
sp|P44514|DAPE_HAEIN Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dapE PE=1 SV=1 133 228 6.0E-06
sp|A5UFQ7|DAPE_HAEIG Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain PittGG) GN=dapE PE=3 SV=1 133 228 6.0E-06
sp|Q08BB2|P2012_DANRE Probable carboxypeptidase PM20D1.2 OS=Danio rerio GN=pm20d1.2 PE=2 SV=1 502 609 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|783
MAPPSTNKMAGTLLLALLASSAVLAFDHGFQCDLPDAVDPYGDGLPSAAQLFSSDEALKLQIERLRASVQVSTVC
YDDMGDYDKDERWEPFVHHQDMLQRSYPNIYNQATIDVVNTFGLVYTFYGTDDSLQPILLTAHQDVVPVDNETLQ
SWDYPPFSGQYDSDGGWLYGRGAADKSSLTALMTAFESLLTQDTSWKPDRTMVLALGFDQECAGMRGAPSIAELL
QQRYGQDGLSLILDEGDPGLRHLDDAILALPAVYEKGYLDVWFDLDVVGGHSSTPTPNTAIGIMSEIVVSLQDNP
FEPQILRDGPIHHQLICQARYSPNAVPQLTKAIYKSDLGLAANLMANVSRDTQWAVQSSQAIDFIAGGSRVNALP
QFVTLGINHRFAPQDNKFAIMRRLADKTRAALSKYHIALEAYKGDDDYHEWVKAQGLESSSWPPRYPDHPFPGRP
DPGHPYPGHPYPGHPYPGHPPPQYPYPGHPPFQPPHQRPYPPPSPEIPHWTADYHGKVTLTNKRSFDASPVSPTQ
GPVWDLFAGTIRHSFGGRPETVVPAAGTMAGNTDTRHFSTLSKNIYRFAPILPNQVKGIYAVNEAINMEAHINTV
RFYYDLVRNFSHDVKKRRPFSVPQEL*
Coding >OphauB2|783
ATGGCTCCTCCCTCGACTAACAAAATGGCCGGGACCTTGCTTCTTGCTCTGCTGGCCAGCAGTGCCGTCTTGGCC
TTTGACCATGGCTTCCAGTGCGACTTGCCAGACGCAGTCGACCCCTATGGCGACGGCCTCCCGTCTGCCGCCCAG
CTCTTCTCCTCGGACGAGGCCCTCAAGCTCCAGATTGAGCGTCTGCGCGCCTCGGTCCAAGTGTCCACCGTGTGC
TACGACGACATGGGCGACTACGACAAGGACGAGCGCTGGGAGCCCTTTGTTCACCACCAGGACATGCTGCAGCGC
TCCTATCCCAACATATACAACCAGGCCACCATTGACGTGGTTAATACATTCGGCCTCGTCTACACCTTTTATGGC
ACTGACGACAGCCTCCAGCCCATCCTCCTCACCGCCCATCAGGATGTAGTCCCCGTGGATAATGAAACGCTGCAG
TCGTGGGACTATCCTCCCTTTAGTGGCCAGTACGACTCCGACGGCGGCTGGCTCTACGGCCGTGGCGCCGCCGAC
AAGTCGAGTCTGACGGCACTCATGACGGCCTTTGAGTCCCTCCTCACGCAAGACACCAGCTGGAAGCCCGACCGC
ACCATGGTCTTGGCCCTTGGCTTTGACCAAGAGTGCGCCGGCATGCGCGGCGCGCCCTCCATTGCTGAGCTCCTC
CAGCAGCGCTACGGCCAAGACGGCCTTTCCCTCATCCTCGACGAGGGCGACCCTGGACTGCGCCACCTCGACGAC
GCCATTTTGGCCTTGCCCGCCGTCTACGAAAAGGGCTATCTCGACGTCTGGTTCGACCTTGATGTGGTCGGCGGC
CACAGCAGCACCCCCACGCCAAACACCGCCATTGGAATCATGTCGGAAATCGTCGTCAGCCTCCAAGACAATCCC
TTTGAGCCCCAGATTCTTCGCGACGGCCCCATTCATCACCAGCTCATCTGCCAGGCCCGCTACTCCCCCAACGCC
GTCCCCCAGCTCACAAAGGCAATCTACAAGAGCGACCTCGGCCTCGCTGCCAACCTCATGGCCAATGTCAGCCGC
GACACTCAGTGGGCCGTCCAATCCTCTCAGGCCATTGACTTTATCGCTGGCGGCTCTAGAGTCAACGCCCTGCCC
CAATTCGTCACCCTTGGCATCAACCATCGCTTTGCGCCCCAGGACAACAAGTTTGCCATTATGCGTCGCCTGGCT
GACAAGACGCGCGCCGCTCTTTCAAAGTACCACATTGCCCTCGAGGCCTATAAAGGCGACGACGACTACCATGAA
TGGGTCAAGGCCCAGGGCCTCGAATCCTCCTCCTGGCCCCCACGATATCCCGACCACCCTTTTCCCGGCCGTCCA
GATCCAGGCCATCCATACCCCGGCCATCCATATCCAGGCCATCCATACCCAGGCCACCCCCCGCCCCAGTATCCC
TATCCTGGCCATCCGCCCTTCCAGCCGCCCCATCAACGCCCGTATCCGCCCCCGAGTCCCGAGATCCCCCACTGG
ACCGCCGACTACCACGGCAAAGTCACCCTGACCAACAAGAGAAGTTTCGACGCGTCCCCCGTTTCGCCTACACAG
GGCCCCGTCTGGGACTTGTTTGCCGGCACCATTCGCCATTCCTTTGGAGGCCGCCCTGAAACAGTCGTGCCAGCG
GCAGGCACCATGGCCGGAAACACTGACACGAGGCATTTTTCGACCCTCAGCAAAAACATCTACCGCTTTGCCCCC
ATCTTGCCCAACCAAGTCAAGGGTATTTACGCAGTCAACGAAGCCATCAACATGGAGGCCCACATCAACACTGTT
CGCTTCTACTATGACCTTGTCCGCAACTTTTCCCACGACGTCAAAAAGAGGCGCCCATTTTCCGTCCCCCAGGAG
CTTTGA
Transcript >OphauB2|783
ATGGCTCCTCCCTCGACTAACAAAATGGCCGGGACCTTGCTTCTTGCTCTGCTGGCCAGCAGTGCCGTCTTGGCC
TTTGACCATGGCTTCCAGTGCGACTTGCCAGACGCAGTCGACCCCTATGGCGACGGCCTCCCGTCTGCCGCCCAG
CTCTTCTCCTCGGACGAGGCCCTCAAGCTCCAGATTGAGCGTCTGCGCGCCTCGGTCCAAGTGTCCACCGTGTGC
TACGACGACATGGGCGACTACGACAAGGACGAGCGCTGGGAGCCCTTTGTTCACCACCAGGACATGCTGCAGCGC
TCCTATCCCAACATATACAACCAGGCCACCATTGACGTGGTTAATACATTCGGCCTCGTCTACACCTTTTATGGC
ACTGACGACAGCCTCCAGCCCATCCTCCTCACCGCCCATCAGGATGTAGTCCCCGTGGATAATGAAACGCTGCAG
TCGTGGGACTATCCTCCCTTTAGTGGCCAGTACGACTCCGACGGCGGCTGGCTCTACGGCCGTGGCGCCGCCGAC
AAGTCGAGTCTGACGGCACTCATGACGGCCTTTGAGTCCCTCCTCACGCAAGACACCAGCTGGAAGCCCGACCGC
ACCATGGTCTTGGCCCTTGGCTTTGACCAAGAGTGCGCCGGCATGCGCGGCGCGCCCTCCATTGCTGAGCTCCTC
CAGCAGCGCTACGGCCAAGACGGCCTTTCCCTCATCCTCGACGAGGGCGACCCTGGACTGCGCCACCTCGACGAC
GCCATTTTGGCCTTGCCCGCCGTCTACGAAAAGGGCTATCTCGACGTCTGGTTCGACCTTGATGTGGTCGGCGGC
CACAGCAGCACCCCCACGCCAAACACCGCCATTGGAATCATGTCGGAAATCGTCGTCAGCCTCCAAGACAATCCC
TTTGAGCCCCAGATTCTTCGCGACGGCCCCATTCATCACCAGCTCATCTGCCAGGCCCGCTACTCCCCCAACGCC
GTCCCCCAGCTCACAAAGGCAATCTACAAGAGCGACCTCGGCCTCGCTGCCAACCTCATGGCCAATGTCAGCCGC
GACACTCAGTGGGCCGTCCAATCCTCTCAGGCCATTGACTTTATCGCTGGCGGCTCTAGAGTCAACGCCCTGCCC
CAATTCGTCACCCTTGGCATCAACCATCGCTTTGCGCCCCAGGACAACAAGTTTGCCATTATGCGTCGCCTGGCT
GACAAGACGCGCGCCGCTCTTTCAAAGTACCACATTGCCCTCGAGGCCTATAAAGGCGACGACGACTACCATGAA
TGGGTCAAGGCCCAGGGCCTCGAATCCTCCTCCTGGCCCCCACGATATCCCGACCACCCTTTTCCCGGCCGTCCA
GATCCAGGCCATCCATACCCCGGCCATCCATATCCAGGCCATCCATACCCAGGCCACCCCCCGCCCCAGTATCCC
TATCCTGGCCATCCGCCCTTCCAGCCGCCCCATCAACGCCCGTATCCGCCCCCGAGTCCCGAGATCCCCCACTGG
ACCGCCGACTACCACGGCAAAGTCACCCTGACCAACAAGAGAAGTTTCGACGCGTCCCCCGTTTCGCCTACACAG
GGCCCCGTCTGGGACTTGTTTGCCGGCACCATTCGCCATTCCTTTGGAGGCCGCCCTGAAACAGTCGTGCCAGCG
GCAGGCACCATGGCCGGAAACACTGACACGAGGCATTTTTCGACCCTCAGCAAAAACATCTACCGCTTTGCCCCC
ATCTTGCCCAACCAAGTCAAGGGTATTTACGCAGTCAACGAAGCCATCAACATGGAGGCCCACATCAACACTGTT
CGCTTCTACTATGACCTTGTCCGCAACTTTTCCCACGACGTCAAAAAGAGGCGCCCATTTTCCGTCCCCCAGGAG
CTTTGA
Gene >OphauB2|783
ATGGCTCCTCCCTCGACTAACAAAATGGCCGGGACCTTGCTTCTTGCTCTGCTGGCCAGCAGTGCCGTCTTGGCC
TTTGACCATGGCTTCCAGTGCGACTTGCCAGACGCAGTCGACCCCTATGGCGACGGCCTCCCGTCTGCCGCCCAG
CTCTTCTCCTCGGACGAGGCCCTCAAGCTCCAGATTGAGCGTCTGCGCGCCTCGGTCCAAGTGTCCACCGTGTGC
TACGACGACATGGGCGACTACGACAAGGACGAGCGCTGGGAGCCCTTTGTTCACCACCAGGACATGCTGCAGCGC
TCCTATCCCAACATGTGCCTCGTTCCCCCTCCCCAGGCAGTCTCTTGGCCAAGCCGCTGACGGGCCACAGATACA
ACCAGGCCACCATTGACGTGGTTAATACATTCGGCCTCGTCTACACCTTTTATGGCACTGACGACAGCCTCCAGC
CCATCCTCCTCACCGCCCATCAGGATGTAGTCCCCGTGGATAATGAAACGCTGCAGTCGTGGGACTATCCTCCCT
TTAGTGGCCAGTACGACTCCGACGGCGGCTGGCTCTACGGCCGTGGCGCCGCCGACAAGTCGAGTCTGACGGCAC
TCATGACGGCCTTTGAGTCCCTCCTCACGCAAGACACCAGCTGGAAGCCCGACCGCACCATGGTCTTGGCCCTTG
GCTTTGACCAAGAGTGCGCCGGCATGCGCGGCGCGCCCTCCATTGCTGAGCTCCTCCAGCAGCGCTACGGCCAAG
ACGGCCTTTCCCTCATCCTCGACGAGGGCGACCCTGGACTGCGCCACCTCGACGACGCCATTTTGGCCTTGCCCG
CCGTCTACGAAAAGGGCTATCTCGACGTCTGGTTCGACCTTGATGTGGTCGGCGGCCACAGCAGCACCCCCACGC
CAAACACCGCCATTGGAATCATGTCGGAAATCGTCGTCAGCCTCCAAGACAATCCCTTTGAGCCCCAGATTCTTC
GCGACGGCCCCATTCATCACCAGCTCATCTGCCAGGCCCGCTACTCCCCCAACGCCGTCCCCCAGCTCACAAAGG
CAATCTACAAGAGCGACCTCGGCCTCGCTGCCAACCTCATGGCCAATGTCAGCCGCGACACTCAGTGGGCCGTCC
AATCCTCTCAGGCCATTGACTTTATCGCTGGCGGCTCTAGAGTCAACGCCCTGCCCCAATTCGTCACCCTTGGCA
TCAACCATCGCTTTGCGCCCCAGGACAACAAGTTTGCCATTATGCGTCGCCTGGCTGACAAGACGCGCGCCGCTC
TTTCAAAGTACCACATTGCCCTCGAGGCCTATAAAGGCGACGACGACTACCATGAATGGGTCAAGGCCCAGGGCC
TCGAATCCTCCTCCTGGCCCCCACGATATCCCGACCACCCTTTTCCCGGCCGTCCAGATCCAGGCCATCCATACC
CCGGCCATCCATATCCAGGCCATCCATACCCAGGCCACCCCCCGCCCCAGTATCCCTATCCTGGCCATCCGCCCT
TCCAGCCGCCCCATCAACGCCCGTATCCGCCCCCGAGTCCCGAGATCCCCCACTGGACCGCCGACTACCACGGCA
AAGTCACCCTGACCAACAAGAGAAGTTTCGACGCGTCCCCCGTTTCGCCTACACAGGGCCCCGTCTGGGACTTGT
TTGCCGGCACCATTCGCCATTCCTTTGGAGGCCGCCCTGAAACAGTCGTGCCAGCGGCAGGCACCATGGCCGGAA
ACACTGACACGAGGCATTTTTCGAGTGCGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCCTCTTGTCTCTCT
CCAAGCCTCTCCTCTCCAAACTCCCTCGTCTCCTTCTTCCCTTCACCCTCGCTAACAAGCATTCCCAGCCCTCAG
CAAAAACATCTACCGCTTTGCCCCCATCTTGCCCAACCAAGTCAAGGGTATTTACGCAGTCAACGAAGCCATCAA
CATGGAGGCCCACATCAACACTGTTCGCTTCTACTATGACCTTGTCCGCAACTTTTCCCACGACGTCAAAAAGAG
GCGCCCATTTTCCGTCCCCCAGGAGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail