Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7822
Gene name
LocationContig_9:36574..39753
Strand+
Gene length (bp)3179
Transcript length (bp)3012
Coding sequence length (bp)3012
Protein length (aa) 1004

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 1.8E-116 14 377
PF16796 Microtub_bd Microtubule binding 1.6E-25 81 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59751|KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp6 PE=1 SV=1 7 592 1.0E-159
sp|O14343|KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp5 PE=1 SV=1 6 488 4.0E-155
sp|P53086|KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP3 PE=1 SV=1 6 617 3.0E-149
sp|Q6PFD6|KI18B_MOUSE Kinesin-like protein KIF18B OS=Mus musculus GN=Kif18b PE=2 SV=2 46 428 1.0E-112
sp|Q4KLL9|KI18B_RAT Kinesin-like protein KIF18B OS=Rattus norvegicus GN=Kif18b PE=2 SV=1 46 430 2.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59751|KLP6_SCHPO Kinesin-like protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp6 PE=1 SV=1 7 592 1.0E-159
sp|O14343|KLP5_SCHPO Kinesin-like protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp5 PE=1 SV=1 6 488 4.0E-155
sp|P53086|KIP3_YEAST Kinesin-like protein KIP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP3 PE=1 SV=1 6 617 3.0E-149
sp|Q6PFD6|KI18B_MOUSE Kinesin-like protein KIF18B OS=Mus musculus GN=Kif18b PE=2 SV=2 46 428 1.0E-112
sp|Q4KLL9|KI18B_RAT Kinesin-like protein KIF18B OS=Rattus norvegicus GN=Kif18b PE=2 SV=1 46 430 2.0E-111
sp|Q8NI77|KI18A_HUMAN Kinesin-like protein KIF18A OS=Homo sapiens GN=KIF18A PE=1 SV=2 52 412 7.0E-110
sp|Q5ZLK6|KI18B_CHICK Kinesin-like protein KIF18B OS=Gallus gallus GN=KIF18B PE=2 SV=1 56 412 7.0E-110
sp|Q91WD7|KI18A_MOUSE Kinesin-like protein KIF18A OS=Mus musculus GN=Kif18a PE=2 SV=1 56 430 6.0E-109
sp|Q86Y91|KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens GN=KIF18B PE=1 SV=3 1 410 2.0E-106
sp|Q2TAC6|KIF19_HUMAN Kinesin-like protein KIF19 OS=Homo sapiens GN=KIF19 PE=2 SV=2 9 456 5.0E-101
sp|Q99PT9|KIF19_MOUSE Kinesin-like protein KIF19 OS=Mus musculus GN=Kif19 PE=1 SV=2 9 529 3.0E-99
sp|Q7ZXX2|KIF19_XENLA Kinesin-like protein KIF19 OS=Xenopus laevis GN=kif19 PE=2 SV=1 1 415 6.0E-98
sp|Q6S002|KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum GN=kif10 PE=3 SV=1 51 410 2.0E-86
sp|Q86VH2|KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens GN=KIF27 PE=2 SV=1 76 385 1.0E-72
sp|Q7M6Z4|KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus GN=Kif27 PE=1 SV=1 83 385 1.0E-71
sp|Q7M6Z5|KIF27_RAT Kinesin-like protein KIF27 OS=Rattus norvegicus GN=Kif27 PE=1 SV=1 83 385 2.0E-69
sp|O95239|KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens GN=KIF4A PE=1 SV=3 63 385 8.0E-68
sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=2 5 460 2.0E-67
sp|Q2VIQ3|KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens GN=KIF4B PE=2 SV=2 63 385 7.0E-67
sp|P46871|KRP95_STRPU Kinesin-II 95 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP95 PE=1 SV=1 94 408 9.0E-67
sp|Q91784|KIF4_XENLA Chromosome-associated kinesin KIF4 OS=Xenopus laevis GN=kif4 PE=2 SV=1 63 421 3.0E-66
sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 57 385 5.0E-66
sp|Q61771|KIF3B_MOUSE Kinesin-like protein KIF3B OS=Mus musculus GN=Kif3b PE=1 SV=1 92 431 1.0E-65
sp|O15066|KIF3B_HUMAN Kinesin-like protein KIF3B OS=Homo sapiens GN=KIF3B PE=1 SV=1 92 431 1.0E-65
sp|P46869|FLA10_CHLRE Kinesin-like protein FLA10 OS=Chlamydomonas reinhardtii GN=FLA10 PE=1 SV=1 92 408 2.0E-65
sp|P33174|KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus GN=Kif4 PE=1 SV=3 81 385 7.0E-65
sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 94 416 7.0E-64
sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 75 419 2.0E-63
sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 75 419 3.0E-63
sp|P28741|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2 75 419 4.0E-63
sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 75 419 4.0E-63
sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 94 409 1.0E-62
sp|B7ZNG0|KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus GN=Kif7 PE=1 SV=1 76 384 2.0E-62
sp|Q2M1P5|KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens GN=KIF7 PE=1 SV=2 76 384 9.0E-62
sp|Q6YUL8|BC2_ORYSJ Kinesin-like protein BC2 OS=Oryza sativa subsp. japonica GN=BC2 PE=1 SV=1 94 384 1.0E-61
sp|P35978|KINH_STRPU Kinesin heavy chain OS=Strongylocentrotus purpuratus PE=2 SV=1 57 385 2.0E-61
sp|O14782|KIF3C_HUMAN Kinesin-like protein KIF3C OS=Homo sapiens GN=KIF3C PE=1 SV=3 92 407 2.0E-61
sp|Q5R706|KIF3C_PONAB Kinesin-like protein KIF3C OS=Pongo abelii GN=KIF3C PE=2 SV=1 92 407 3.0E-61
sp|Q9P2E2|KIF17_HUMAN Kinesin-like protein KIF17 OS=Homo sapiens GN=KIF17 PE=2 SV=3 94 411 4.0E-61
sp|O35066|KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus GN=Kif3c PE=1 SV=3 92 407 8.0E-61
sp|O55165|KIF3C_RAT Kinesin-like protein KIF3C OS=Rattus norvegicus GN=Kif3c PE=2 SV=1 92 407 9.0E-61
sp|Q2PQA9|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN=Kif5b PE=1 SV=1 94 385 1.0E-60
sp|Q1MTQ1|TEA2_SCHPO Kinesin-like protein tea2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea2 PE=1 SV=1 77 435 1.0E-60
sp|Q61768|KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus GN=Kif5b PE=1 SV=3 94 385 1.0E-60
sp|P33176|KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens GN=KIF5B PE=1 SV=1 94 385 1.0E-60
sp|A0JN40|KIF3C_BOVIN Kinesin-like protein KIF3C OS=Bos taurus GN=KIF3C PE=2 SV=1 92 412 1.0E-60
sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 7 460 1.0E-60
sp|Q9EQW7|KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus GN=Kif13a PE=1 SV=1 7 419 2.0E-60
sp|Q8GS71|FRA1_ARATH Kinesin-like protein FRA1 OS=Arabidopsis thaliana GN=FRA1 PE=1 SV=1 94 407 3.0E-60
sp|P48467|KINH_NEUCR Kinesin heavy chain OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kin PE=1 SV=2 94 403 3.0E-60
sp|P28738|KIF5C_MOUSE Kinesin heavy chain isoform 5C OS=Mus musculus GN=Kif5c PE=1 SV=3 94 385 5.0E-60
sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1 94 385 5.0E-60
sp|Q99PW8|KIF17_MOUSE Kinesin-like protein KIF17 OS=Mus musculus GN=Kif17 PE=1 SV=1 94 413 1.0E-59
sp|Q7Z4S6|KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens GN=KIF21A PE=1 SV=2 81 384 2.0E-59
sp|Q28WQ1|KIF1A_DROPS Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura GN=unc-104 PE=3 SV=1 7 412 3.0E-59
sp|A1ZAJ2|KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster GN=unc-104 PE=1 SV=1 7 412 6.0E-59
sp|O43093|KINH_SYNRA Kinesin heavy chain OS=Syncephalastrum racemosum PE=2 SV=1 94 384 7.0E-59
sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum GN=kif4 PE=2 SV=1 94 407 2.0E-58
sp|P34540|KINH_CAEEL Kinesin heavy chain OS=Caenorhabditis elegans GN=unc-116 PE=2 SV=2 92 392 2.0E-58
sp|Q86Z98|KINH_GIBMO Kinesin heavy chain OS=Gibberella moniliformis GN=KLP1 PE=3 SV=1 94 384 2.0E-58
sp|Q12840|KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens GN=KIF5A PE=1 SV=2 94 385 2.0E-58
sp|Q9QXL2|KI21A_MOUSE Kinesin-like protein KIF21A OS=Mus musculus GN=Kif21a PE=1 SV=2 81 384 3.0E-58
sp|Q5R9K7|KIF5A_PONAB Kinesin heavy chain isoform 5A OS=Pongo abelii GN=KIF5A PE=2 SV=1 94 385 3.0E-58
sp|Q7PHR1|KIF1A_ANOGA Kinesin-like protein unc-104 OS=Anopheles gambiae GN=unc-104 PE=3 SV=3 7 409 3.0E-58
sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus GN=Kif21b PE=1 SV=2 81 411 4.0E-58
sp|Q58G59|KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio GN=kif7 PE=1 SV=1 69 384 4.0E-58
sp|P33175|KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus GN=Kif5a PE=1 SV=3 94 385 6.0E-58
sp|Q9NGQ2|KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum GN=kif1 PE=1 SV=1 8 465 1.0E-57
sp|Q86ZC1|KINH_BOTFU Kinesin heavy chain OS=Botryotinia fuckeliana GN=klp1 PE=3 SV=1 94 384 2.0E-57
sp|Q6QLM7|KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus GN=Kif5a PE=1 SV=1 94 385 3.0E-57
sp|Q5T7B8|KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens GN=KIF24 PE=1 SV=2 9 390 3.0E-57
sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens GN=KIF21B PE=1 SV=2 81 411 3.0E-57
sp|B1AVY7|KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus GN=Kif16b PE=1 SV=1 86 415 3.0E-57
sp|L0N7N1|KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus GN=Kif14 PE=1 SV=1 7 413 6.0E-57
sp|P17210|KINH_DROME Kinesin heavy chain OS=Drosophila melanogaster GN=Khc PE=1 SV=2 75 392 2.0E-56
sp|P21613|KINH_DORPE Kinesin heavy chain OS=Doryteuthis pealeii PE=2 SV=1 92 392 2.0E-56
sp|P46867|KLP68_DROME Kinesin-like protein Klp68D OS=Drosophila melanogaster GN=Klp68D PE=2 SV=2 92 418 3.0E-56
sp|Q17BU3|KIF1A_AEDAE Kinesin-like protein unc-104 OS=Aedes aegypti GN=unc-104 PE=3 SV=1 7 441 3.0E-56
sp|Q96L93|KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens GN=KIF16B PE=1 SV=2 86 415 8.0E-56
sp|Q15058|KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens GN=KIF14 PE=1 SV=1 7 412 1.0E-55
sp|Q6NWW5|KIF24_MOUSE Kinesin-like protein KIF24 OS=Mus musculus GN=Kif24 PE=1 SV=2 9 381 1.0E-55
sp|Q29DY1|KLP68_DROPS Kinesin-like protein Klp68D OS=Drosophila pseudoobscura pseudoobscura GN=Klp68D PE=3 SV=1 80 417 2.0E-55
sp|F8WLE0|KIF28_RAT Kinesin-like protein KIF28P OS=Rattus norvegicus GN=Kif28p PE=2 SV=1 8 384 3.0E-55
sp|Q54UC9|KIF3_DICDI Kinesin-related protein 3 OS=Dictyostelium discoideum GN=kif3 PE=1 SV=1 94 410 3.0E-55
sp|Q6S001|KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum GN=kif11 PE=3 SV=1 85 419 7.0E-55
sp|Q8T135|KIF5_DICDI Kinesin-related protein 5 OS=Dictyostelium discoideum GN=kif5 PE=1 SV=1 89 384 1.0E-54
sp|D3YXS5|KIF28_MOUSE Kinesin-like protein KIF28P OS=Mus musculus GN=Kif28p PE=3 SV=1 8 384 2.0E-54
sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 7 384 2.0E-54
sp|P23678|UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans GN=unc-104 PE=2 SV=4 7 384 8.0E-54
sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 7 384 8.0E-54
sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3 7 413 8.0E-54
sp|P28743|KIP2_YEAST Kinesin-like protein KIP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP2 PE=1 SV=1 94 419 9.0E-54
sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 7 384 1.0E-53
sp|Q9US60|KLP3_SCHPO Kinesin-like protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp3 PE=2 SV=1 66 384 2.0E-53
sp|Q02224|CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens GN=CENPE PE=1 SV=2 94 375 3.0E-53
sp|B7ZC32|KIF28_HUMAN Kinesin-like protein KIF28P OS=Homo sapiens GN=KIF28P PE=3 SV=2 12 390 4.0E-53
sp|Q6S004|KIF6_DICDI Kinesin-related protein 6 OS=Dictyostelium discoideum GN=kif6 PE=2 SV=1 1 379 4.0E-53
sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 7 395 5.0E-53
sp|Q96FN5|KIF12_HUMAN Kinesin-like protein KIF12 OS=Homo sapiens GN=KIF12 PE=1 SV=3 94 464 5.0E-53
sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus GN=Kif1c PE=1 SV=2 7 413 6.0E-53
sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 7 423 7.0E-53
sp|Q9BVG8|KIFC3_HUMAN Kinesin-like protein KIFC3 OS=Homo sapiens GN=KIFC3 PE=1 SV=4 65 378 8.0E-53
sp|O35231|KIFC3_MOUSE Kinesin-like protein KIFC3 OS=Mus musculus GN=Kifc3 PE=1 SV=4 65 378 1.0E-52
sp|O35787|KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus GN=Kif1c PE=1 SV=1 7 413 3.0E-52
sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 92 549 3.0E-52
sp|Q6P9P6|KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus GN=Kif11 PE=1 SV=1 41 380 4.0E-52
sp|Q9US03|KLP2_SCHPO Kinesin-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp2 PE=3 SV=1 89 385 7.0E-52
sp|Q54TL0|KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum GN=kif7 PE=2 SV=1 71 443 1.0E-51
sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus GN=Cenpe PE=1 SV=1 94 375 2.0E-51
sp|O81635|ATK4_ARATH Kinesin-4 OS=Arabidopsis thaliana GN=ATK4 PE=1 SV=2 94 431 2.0E-51
sp|O23826|K125_TOBAC 125 kDa kinesin-related protein OS=Nicotiana tabacum GN=TKRP125 PE=1 SV=1 91 380 3.0E-51
sp|Q8J1G1|KIP2_ASHGO Kinesin-like protein KIP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP2 PE=3 SV=1 94 410 3.0E-51
sp|Q9FHN8|KCBP_ARATH Kinesin-like calmodulin-binding protein OS=Arabidopsis thaliana GN=KCBP PE=1 SV=1 96 377 3.0E-51
sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 94 380 3.0E-51
sp|Q9D2Z8|KIF12_MOUSE Kinesin-like protein KIF12 OS=Mus musculus GN=Kif12 PE=1 SV=1 91 380 4.0E-51
sp|Q8S905|NACK1_ARATH Kinesin-like protein NACK1 OS=Arabidopsis thaliana GN=NACK1 PE=1 SV=1 94 451 5.0E-51
sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens GN=KIF11 PE=1 SV=2 92 380 5.0E-51
sp|Q940B8|KIN13_ARATH Kinesin-13A OS=Arabidopsis thaliana GN=KINESIN-13A PE=1 SV=1 9 377 6.0E-51
sp|P46870|KLP1_CHLRE Kinesin-like protein KLP1 OS=Chlamydomonas reinhardtii GN=KLP1 PE=2 SV=1 81 412 7.0E-51
sp|A8WFU8|KIF22_DANRE Kinesin-like protein KIF22 OS=Danio rerio GN=kif22 PE=2 SV=1 94 377 1.0E-50
sp|Q91783|KI11A_XENLA Kinesin-like protein KIF11-A OS=Xenopus laevis GN=kif11-a PE=1 SV=1 92 380 1.0E-50
sp|Q9LDN0|KN12A_ARATH Kinesin-like protein KIN12A OS=Arabidopsis thaliana GN=KIN12A PE=1 SV=1 72 384 2.0E-50
sp|Q9W1U4|KI59C_DROME Kinesin-like protein Klp59C OS=Drosophila melanogaster GN=Klp59C PE=3 SV=1 54 377 2.0E-50
sp|Q8L7Y8|KN12B_ARATH Kinesin-like protein KIN12B OS=Arabidopsis thaliana GN=KIN12B PE=1 SV=1 89 384 3.0E-50
sp|Q14807|KIF22_HUMAN Kinesin-like protein KIF22 OS=Homo sapiens GN=KIF22 PE=1 SV=5 94 377 3.0E-50
sp|Q9WV04|KIF9_MOUSE Kinesin-like protein KIF9 OS=Mus musculus GN=Kif9 PE=1 SV=2 91 408 3.0E-50
sp|Q27IK7|POK1_ARATH Phragmoplast orienting kinesin-1 OS=Arabidopsis thaliana GN=POK1 PE=1 SV=1 94 384 4.0E-50
sp|Q8LNZ2|NACK2_ARATH Kinesin-like protein NACK2 OS=Arabidopsis thaliana GN=NACK2 PE=1 SV=1 6 429 4.0E-50
sp|Q7XPJ0|KCBP_ORYSJ Kinesin-like calmodulin-binding protein homolog OS=Oryza sativa subsp. japonica GN=Os04g0666900 PE=2 SV=1 62 385 5.0E-50
sp|Q5REP4|KIF22_PONAB Kinesin-like protein KIF22 OS=Pongo abelii GN=KIF22 PE=2 SV=1 94 377 5.0E-50
sp|Q8S950|NACK1_TOBAC Kinesin-like protein NACK1 OS=Nicotiana tabacum GN=NACK1 PE=1 SV=1 58 429 1.0E-49
sp|Q6ZMV9|KIF6_HUMAN Kinesin-like protein KIF6 OS=Homo sapiens GN=KIF6 PE=1 SV=3 94 384 1.0E-49
sp|Q9GYZ0|KIF15_STRPU Kinesin-like protein KIF15 OS=Strongylocentrotus purpuratus GN=KIF15 PE=1 SV=1 92 384 1.0E-49
sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 92 549 1.0E-49
sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 91 380 2.0E-49
sp|A6QPL4|KIF22_BOVIN Kinesin-like protein KIF22 OS=Bos taurus GN=KIF22 PE=2 SV=2 94 377 2.0E-49
sp|Q8W1Y3|KP1_ARATH Kinesin KP1 OS=Arabidopsis thaliana GN=KP1 PE=1 SV=2 87 383 4.0E-49
sp|P46874|KLP2_BOMMO Kinesin-like protein KLP2 (Fragment) OS=Bombyx mori PE=2 SV=1 94 404 4.0E-49
sp|Q5I0E8|KIF22_RAT Kinesin-like protein KIF22 OS=Rattus norvegicus GN=Kif22 PE=2 SV=1 94 377 5.0E-49
sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 94 434 6.0E-49
sp|Q498L9|KI15B_XENLA Kinesin-like protein KIF15-B OS=Xenopus laevis GN=kif15-b PE=1 SV=1 92 384 1.0E-48
sp|P28739|KLPA_EMENI Kinesin-like protein klpA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=klpA PE=2 SV=3 68 376 1.0E-48
sp|Q9HAQ2|KIF9_HUMAN Kinesin-like protein KIF9 OS=Homo sapiens GN=KIF9 PE=1 SV=4 91 408 1.0E-48
sp|Q9P2P6|STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens GN=STARD9 PE=1 SV=3 7 422 2.0E-48
sp|Q8J1G4|KIP1_ASHGO Kinesin-like protein KIP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KIP1 PE=3 SV=1 91 527 2.0E-48
sp|P70096|KIF2C_CRIGR Kinesin-like protein KIF2C OS=Cricetulus griseus GN=KIF2C PE=1 SV=2 60 377 3.0E-48
sp|Q3V300|KIF22_MOUSE Kinesin-like protein KIF22 OS=Mus musculus GN=Kif22 PE=2 SV=2 94 377 3.0E-48
sp|Q8C0N1|KIF2B_MOUSE Kinesin-like protein KIF2B OS=Mus musculus GN=Kif2b PE=1 SV=1 75 377 4.0E-48
sp|Q5XI51|KIF2B_RAT Kinesin-like protein KIF2B OS=Rattus norvegicus GN=Kif2b PE=2 SV=2 75 377 5.0E-48
sp|Q8N4N8|KIF2B_HUMAN Kinesin-like protein KIF2B OS=Homo sapiens GN=KIF2B PE=1 SV=3 66 381 7.0E-48
sp|Q9BPU3|KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum GN=kif2 PE=2 SV=1 89 371 8.0E-48
sp|A6H750|KIF2B_BOVIN Kinesin-like protein KIF2B OS=Bos taurus GN=KIF2B PE=2 SV=1 70 377 9.0E-48
sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 89 569 1.0E-47
sp|Q91785|KI15A_XENLA Kinesin-like protein KIF15-A OS=Xenopus laevis GN=kif15-a PE=1 SV=1 92 384 2.0E-47
sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 OS=Xenopus laevis PE=2 SV=1 94 374 2.0E-47
sp|Q7ZYL5|KF22B_XENLA Kinesin-like protein KIF22-B OS=Xenopus laevis GN=kif22-b PE=2 SV=2 79 380 2.0E-47
sp|Q91637|KIF2A_XENLA Kinesin-like protein KIF2A OS=Xenopus laevis GN=kif2a PE=1 SV=2 83 377 2.0E-47
sp|Q922S8|KIF2C_MOUSE Kinesin-like protein KIF2C OS=Mus musculus GN=Kif2c PE=1 SV=1 83 377 2.0E-47
sp|Q9NS87|KIF15_HUMAN Kinesin-like protein KIF15 OS=Homo sapiens GN=KIF15 PE=1 SV=1 92 384 2.0E-47
sp|Q99661|KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens GN=KIF2C PE=1 SV=2 83 377 2.0E-47
sp|Q95LP1|KIF2C_MACFA Kinesin-like protein KIF2C OS=Macaca fascicularis GN=KIF2C PE=2 SV=1 83 377 3.0E-47
sp|Q9WV63|KIF2A_RAT Kinesin-like protein KIF2A OS=Rattus norvegicus GN=Kif2a PE=1 SV=2 83 377 3.0E-47
sp|P17119|KAR3_YEAST Kinesin-like protein KAR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR3 PE=1 SV=1 94 374 3.0E-47
sp|P24339|CUT7_SCHPO Kinesin-like protein cut7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut7 PE=3 SV=3 84 400 3.0E-47
sp|Q6P3R1|KIF22_XENTR Kinesin-like protein KIF22 OS=Xenopus tropicalis GN=kif22 PE=2 SV=1 79 380 4.0E-47
sp|O00139|KIF2A_HUMAN Kinesin-like protein KIF2A OS=Homo sapiens GN=KIF2A PE=1 SV=3 83 377 4.0E-47
sp|P28740|KIF2A_MOUSE Kinesin-like protein KIF2A OS=Mus musculus GN=Kif2a PE=1 SV=2 83 377 5.0E-47
sp|Q95LT1|KIF2B_MACFA Kinesin-like protein KIF2B OS=Macaca fascicularis GN=KIF2B PE=2 SV=1 66 377 5.0E-47
sp|Q5R9Y9|KIF2A_PONAB Kinesin-like protein KIF2A OS=Pongo abelii GN=KIF2A PE=2 SV=1 83 377 7.0E-47
sp|Q5ZKV8|KIF2A_CHICK Kinesin-like protein KIF2A OS=Gallus gallus GN=KIF2A PE=2 SV=2 83 377 2.0E-46
sp|Q9I869|KF22A_XENLA Kinesin-like protein KIF22-A OS=Xenopus laevis GN=kif22-a PE=1 SV=1 79 380 2.0E-46
sp|Q960Z0|KI10A_DROME Kinesin-like protein Klp10A OS=Drosophila melanogaster GN=Klp10A PE=1 SV=1 69 380 2.0E-46
sp|Q2NL05|KIF2A_BOVIN Kinesin-like protein KIF2A OS=Bos taurus GN=KIF2A PE=2 SV=1 83 377 2.0E-46
sp|Q6RZZ9|KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum GN=kif13 PE=1 SV=1 94 410 2.0E-46
sp|F9W301|KPSS1_ORYSJ Kinesin-1-like protein PSS1 OS=Oryza sativa subsp. japonica GN=PSS1 PE=1 SV=1 79 379 2.0E-46
sp|P45962|KLP3_CAEEL Kinesin-like protein klp-3 OS=Caenorhabditis elegans GN=klp-3 PE=1 SV=1 97 380 4.0E-46
sp|Q27IK6|POK2_ARATH Phragmoplast orienting kinesin 2 OS=Arabidopsis thaliana GN=POK2 PE=2 SV=1 94 384 4.0E-46
sp|P46875|ATK3_ARATH Kinesin-3 OS=Arabidopsis thaliana GN=ATK3 PE=2 SV=1 94 388 4.0E-46
sp|Q7TSP2|KIF15_RAT Kinesin-like protein KIF15 OS=Rattus norvegicus GN=Kif15 PE=2 SV=1 92 384 5.0E-46
sp|Q8S949|NACK2_TOBAC Kinesin-like protein NACK2 OS=Nicotiana tabacum GN=NACK2 PE=1 SV=1 94 398 5.0E-46
sp|Q6P9L6|KIF15_MOUSE Kinesin-like protein KIF15 OS=Mus musculus GN=Kif15 PE=1 SV=1 92 384 6.0E-46
sp|Q92376|KLP1_SCHPO Kinesin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp1 PE=2 SV=2 94 381 2.0E-45
sp|Q62909|KIF2C_RAT Kinesin-like protein KIF2C OS=Rattus norvegicus GN=Kif2c PE=2 SV=3 83 377 3.0E-45
sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 94 377 4.0E-45
sp|P46864|ATK2_ARATH Kinesin-2 OS=Arabidopsis thaliana GN=ATK2 PE=2 SV=1 94 374 5.0E-45
sp|Q80TF6|STAR9_MOUSE StAR-related lipid transfer protein 9 OS=Mus musculus GN=Stard9 PE=1 SV=2 7 421 1.0E-44
sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 84 377 2.0E-44
sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 84 404 2.0E-44
sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 84 417 3.0E-44
sp|P28742|KIP1_YEAST Kinesin-like protein KIP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIP1 PE=1 SV=1 92 423 4.0E-44
sp|P20480|NCD_DROME Protein claret segregational OS=Drosophila melanogaster GN=ncd PE=1 SV=1 88 386 6.0E-44
sp|Q07970|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1 70 383 8.0E-44
sp|Q91636|KIF2C_XENLA Kinesin-like protein KIF2C OS=Xenopus laevis GN=kif2c PE=1 SV=2 83 377 2.0E-43
sp|Q60443|KIFC1_CRIGR Kinesin-like protein KIFC1 OS=Cricetulus griseus PE=2 SV=1 68 373 2.0E-43
sp|F4JGP4|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1 94 383 3.0E-43
sp|Q9BW19|KIFC1_HUMAN Kinesin-like protein KIFC1 OS=Homo sapiens GN=KIFC1 PE=1 SV=2 94 373 1.0E-42
sp|Q39493|DSK1_CYLFU Diatom spindle kinesin-1 OS=Cylindrotheca fusiformis GN=DSK1 PE=2 SV=1 75 375 3.0E-42
sp|Q9QWT9|KIFC1_MOUSE Kinesin-like protein KIFC1 OS=Mus musculus GN=Kifc1 PE=1 SV=2 94 373 3.0E-42
sp|Q5XI63|KIFC1_RAT Kinesin-like protein KIFC1 OS=Rattus norvegicus GN=Kifc1 PE=2 SV=1 94 373 6.0E-42
sp|Q8J1G7|CIN8_ASHGO Kinesin-like protein CIN8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CIN8 PE=3 SV=1 83 407 1.0E-40
sp|P46865|KINL_LEICH Kinesin-like protein K39 (Fragment) OS=Leishmania chagasi GN=KIN PE=2 SV=1 85 554 1.0E-40
sp|Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens GN=KIFC2 PE=2 SV=1 82 354 2.0E-40
sp|O08672|KIFC2_MOUSE Kinesin-like protein KIFC2 OS=Mus musculus GN=Kifc2 PE=1 SV=1 82 378 2.0E-38
sp|P18105|NOD_DROME Kinesin-like protein Nod OS=Drosophila melanogaster GN=nod PE=1 SV=1 89 378 2.0E-34
sp|E9Q5G3|KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus GN=Kif23 PE=1 SV=1 154 378 5.0E-34
sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 154 378 7.0E-34
sp|Q9UIL4|KIF25_HUMAN Kinesin-like protein KIF25 OS=Homo sapiens GN=KIF25 PE=2 SV=2 93 378 1.0E-33
sp|P56536|KIF5C_RAT Kinesin heavy chain isoform 5C (Fragment) OS=Rattus norvegicus GN=Kif5c PE=1 SV=2 94 287 2.0E-33
sp|Q9FKP4|KCA2_ARATH Kinesin-like protein KCA2 OS=Arabidopsis thaliana GN=KCA2 PE=1 SV=1 94 376 6.0E-33
sp|P32364|SMY1_YEAST Kinesin-related protein SMY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMY1 PE=1 SV=1 50 412 7.0E-32
sp|Q555I8|KIF9_DICDI Kinesin-related protein 9 OS=Dictyostelium discoideum GN=kif9 PE=2 SV=1 92 385 2.0E-31
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 177 386 4.0E-31
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 177 377 6.0E-31
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 267 409 6.0E-30
sp|Q9UTL2|KLP8_SCHPO Kinesin-like protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp8 PE=1 SV=1 7 389 9.0E-30
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 177 377 2.0E-29
sp|Q1MTQ7|KLP9_SCHPO Kinesin-like motor protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klp9 PE=1 SV=2 56 377 5.0E-29
sp|Q6S003|KIF8_DICDI Kinesin-related protein 8 OS=Dictyostelium discoideum GN=kif8 PE=2 SV=1 91 268 1.0E-28
sp|Q9V877|SUB_DROME Kinesin-like protein subito OS=Drosophila melanogaster GN=sub PE=1 SV=1 168 380 3.0E-28
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 205 407 3.0E-28
sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 177 377 9.0E-28
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 205 407 1.0E-27
sp|Q9LX99|KCA1_ARATH Kinesin-like protein KCA1 OS=Arabidopsis thaliana GN=KCA1 PE=1 SV=1 94 480 2.0E-27
sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 177 377 8.0E-27
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 177 377 1.0E-26
sp|Q52KG5|KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus GN=Kif26a PE=1 SV=2 92 380 1.0E-25
sp|Q7TNC6|KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus GN=Kif26b PE=1 SV=3 86 373 2.0E-24
sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=2 SV=1 88 373 5.0E-23
sp|Q9ULI4|KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=2 SV=3 92 380 2.0E-22
sp|O16844|COS_DROME Kinesin-like protein costa OS=Drosophila melanogaster GN=cos PE=1 SV=2 103 387 7.0E-19
sp|Q292S8|COS_DROPS Kinesin-like protein costa OS=Drosophila pseudoobscura pseudoobscura GN=cos PE=3 SV=2 104 387 2.0E-15
sp|Q6FXI5|CIN8_CANGA Kinesin-like protein CIN8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIN8 PE=3 SV=1 65 191 3.0E-11
sp|Q6S000|KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum GN=kif12 PE=3 SV=1 94 172 3.0E-09
sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 9 167 2.0E-08
sp|P27895|CIN8_YEAST Kinesin-like protein CIN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN8 PE=1 SV=3 94 191 3.0E-08
sp|E9Q5G3|KIF23_MOUSE Kinesin-like protein KIF23 OS=Mus musculus GN=Kif23 PE=1 SV=1 90 164 5.0E-08
sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 92 167 5.0E-08
sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 90 164 1.0E-07
sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 45 165 2.0E-07
sp|Q60LV7|KI26L_CAEBR Kinesin-like protein vab-8 OS=Caenorhabditis briggsae GN=vab-8 PE=3 SV=3 96 342 3.0E-07
sp|Q21441|KI26L_CAEEL Kinesin-like protein vab-8 OS=Caenorhabditis elegans GN=vab-8 PE=1 SV=3 96 371 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008017 microtubule binding Yes
GO:0003777 microtubule motor activity Yes
GO:0005524 ATP binding Yes
GO:0007018 microtubule-based movement Yes
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003774 cytoskeletal motor activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0008092 cytoskeletal protein binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0007017 microtubule-based process No
GO:0005515 protein binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:0015631 tubulin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7822
MAAAGQSSITVAIRVRPFTIREAAQLQKNDDSTLFLGDGSLASAPPKLHQRGLRNVIKVVDDRCLVFDPPEDNPV
HKFSRSVVPTSKRVKDQVFAFDRVFDDNTTQTDVYEGTTKNLLDSVLDGYNATVFAYGATGCGKTHTITGTAQHP
GIIFLTMQELFEKIEERSQDKTTELSLSYLEIYNETIRDLLVPGGSKQGLTLREDSNQAVTVAGLSSHHPRDVQQ
VMDMIVQGNEYRTVSPTEANATSSRSHAVLQVNIAQKDRNADVNEPHTMATLSIIDLAGSERASVTKNRGERLAE
GANINKSLLALGSCINALCDRRQRAHVPYRNSKLTRLLKFSLGGNCKTVMIVCVSPSSAHFDETQNTLRYANRAK
NIQTKVTRNVFNVNRHVKDFLVKIDEQMALIKELKAQQNEAEAMFLAKLRKQCDKRDCVVVEGVQRLRAAYEHTA
GERQERVVSMKKLRAVERRISLLSGWMGAFDAVCDGRAGLSDSEDGAMPKSLAAIRGTAKGILAELENSRQHLHQ
RLDKTSWERAIDTALTHSLKQLEGVEGAEDPGNAASGLEREAELLKTGFGREAYREVLESEKGSDAAVVQMLLTA
QLDILASLTDLMAMDEQSAVAHAKQCLGRLLQTGHDAAVQVVKPDVSSVPLPVVEAFPPTRKGTPKRKKTASYAC
VGPVAPTVHNEHVFGSPIKSLSPRRRRVLGAASHLKKGVCFSPVRRVKGRGVRWRDDETEQGTLADYGGTPRRWE
SPIKGCMSPDKSMGGGVSRVSTNEPRQADGKSSPSTEVPAKAGGRFQAGFLSKSSRASSGSPQLQSPPKLDLRLA
TSSPDLKGSPLRMRSGGSPLAVIMDQPNRRLVHETGAPKQADGGRINDENTAPQQPRWPRQATPDGSSDSETIDA
RKVRSALQNMSKLSGRRSSGMSLAMAAKRAPSSSSGVTRLRRASPPPMPCASAAPSPMDHAGLTAGQARRMKIGG
SVRLAESPRDEARRVTVGTGPRRTVAWR*
Coding >OphauB2|7822
ATGGCGGCCGCGGGACAGTCGTCCATCACGGTGGCCATCAGAGTGAGGCCGTTTACGATTCGCGAAGCGGCTCAA
CTCCAAAAGAATGACGATAGCACGCTATTCCTGGGGGACGGCTCTCTGGCGAGCGCACCTCCCAAGCTGCATCAA
CGAGGGCTGAGAAATGTAATCAAAGTGGTGGACGACCGGTGCTTAGTGTTTGACCCGCCAGAAGACAACCCGGTT
CACAAGTTCTCGAGATCAGTGGTGCCGACTTCCAAGAGGGTCAAGGATCAGGTGTTTGCCTTTGACCGCGTGTTT
GACGACAACACAACGCAGACGGATGTGTACGAGGGCACAACGAAGAACCTGCTCGACAGTGTACTGGACGGATAT
AACGCGACGGTGTTTGCATACGGGGCAACGGGATGCGGCAAGACGCACACGATTACGGGGACGGCACAGCACCCA
GGCATCATCTTCCTGACGATGCAAGAGCTGTTTGAGAAGATTGAAGAGAGGAGTCAAGACAAGACGACGGAGCTG
AGCCTGAGCTACCTGGAGATCTACAACGAAACAATTCGCGATTTGCTGGTGCCAGGAGGGAGCAAGCAAGGGCTG
ACGCTGCGAGAAGACAGCAACCAGGCGGTGACGGTGGCAGGACTGAGCAGCCACCATCCGCGCGACGTGCAGCAA
GTCATGGACATGATTGTGCAGGGCAACGAGTACCGCACCGTGTCGCCAACCGAGGCCAACGCAACGTCTTCACGG
TCACATGCCGTGCTGCAGGTCAACATAGCGCAAAAGGACCGCAATGCCGACGTCAATGAGCCGCACACCATGGCG
ACGCTGAGCATCATCGACTTGGCGGGGTCTGAGCGCGCTTCAGTGACGAAGAATCGTGGAGAGCGGCTGGCCGAG
GGGGCAAACATCAACAAGTCTCTGCTAGCGCTGGGCAGCTGCATCAATGCGCTGTGCGACCGGCGACAGCGGGCA
CACGTTCCCTACCGTAACTCGAAGCTGACGCGTCTGCTCAAGTTCTCGCTGGGGGGCAACTGCAAGACGGTCATG
ATTGTTTGCGTGTCGCCGTCGAGCGCACACTTTGACGAGACGCAAAACACGCTCCGCTACGCAAACCGGGCCAAG
AATATTCAAACAAAGGTGACGCGCAATGTGTTCAATGTGAATAGACACGTCAAGGACTTTCTGGTCAAGATTGAC
GAGCAAATGGCGCTCATCAAGGAGCTCAAGGCGCAGCAAAACGAGGCAGAGGCCATGTTTTTGGCCAAGTTGCGC
AAGCAGTGCGACAAGCGCGACTGCGTAGTTGTAGAGGGGGTGCAGCGACTGCGAGCAGCATATGAGCACACGGCG
GGCGAGAGGCAGGAACGGGTGGTGAGCATGAAGAAGCTCCGGGCTGTGGAGCGGCGCATCAGCCTCTTAAGCGGA
TGGATGGGAGCGTTTGATGCGGTTTGCGACGGGCGCGCGGGCTTGTCTGACAGCGAGGATGGGGCCATGCCCAAG
AGCTTGGCTGCTATTCGTGGTACGGCCAAGGGCATATTGGCGGAGCTGGAGAATAGCAGACAGCACCTGCACCAG
AGGCTGGACAAGACGTCATGGGAGCGAGCGATTGATACGGCCCTGACACACAGTCTTAAGCAGCTCGAGGGTGTC
GAGGGAGCCGAAGACCCGGGCAATGCAGCCAGCGGGCTGGAGCGCGAAGCAGAGCTACTCAAGACGGGCTTCGGG
CGTGAAGCGTACCGCGAGGTGCTGGAGAGCGAAAAGGGAAGTGACGCGGCTGTTGTGCAGATGCTGCTTACTGCG
CAGCTGGATATTTTGGCGTCGCTGACGGATCTCATGGCCATGGACGAGCAGAGTGCAGTGGCACACGCCAAGCAG
TGTCTCGGCCGGTTGCTGCAGACTGGGCACGATGCTGCAGTGCAGGTGGTAAAGCCCGACGTCAGCTCGGTGCCA
TTGCCCGTTGTCGAGGCGTTTCCACCGACACGCAAAGGCACGCCCAAGCGAAAAAAGACGGCGTCGTATGCGTGT
GTGGGGCCCGTGGCACCCACGGTGCATAACGAGCACGTTTTTGGCAGTCCAATCAAGTCTCTGTCTCCGCGGCGG
CGTAGGGTGCTGGGAGCGGCGTCGCATCTCAAAAAGGGGGTTTGCTTTTCGCCGGTGCGCCGAGTCAAGGGCAGA
GGCGTGAGATGGCGAGATGACGAGACGGAGCAGGGCACCTTGGCCGACTATGGAGGGACGCCTAGGCGCTGGGAG
TCGCCCATCAAGGGATGCATGTCGCCAGACAAGAGCATGGGAGGAGGCGTGTCAAGAGTGAGCACAAATGAGCCG
AGACAGGCAGACGGCAAGTCAAGCCCGAGCACAGAAGTGCCTGCAAAGGCTGGTGGCAGGTTCCAAGCCGGCTTC
TTATCCAAGAGCTCGCGAGCCTCGAGTGGGTCGCCGCAGCTGCAGTCGCCGCCCAAGCTGGACCTCCGACTGGCC
ACAAGCTCCCCAGATCTCAAGGGATCGCCACTGCGGATGCGGAGTGGTGGCTCGCCGCTAGCGGTGATTATGGAC
CAACCGAATCGACGGCTGGTGCATGAGACGGGGGCGCCCAAGCAGGCGGATGGTGGCAGAATCAATGATGAGAAC
ACGGCGCCACAGCAACCACGGTGGCCGCGTCAAGCCACGCCAGATGGGTCGTCCGACTCTGAGACTATTGATGCG
CGCAAGGTGCGCAGTGCCCTGCAAAACATGTCCAAGCTGTCGGGGCGGCGTTCAAGCGGAATGTCGCTGGCCATG
GCGGCCAAGAGGGCTCCCAGCAGCAGCAGCGGCGTGACGCGGCTGAGGCGGGCTAGTCCACCACCAATGCCCTGT
GCCTCAGCTGCTCCATCCCCTATGGATCATGCAGGGCTGACGGCGGGCCAAGCACGGAGAATGAAGATTGGAGGC
AGCGTCAGGCTTGCAGAAAGTCCTCGGGACGAGGCCCGTCGCGTTACGGTTGGCACGGGTCCAAGAAGGACGGTG
GCGTGGCGCTGA
Transcript >OphauB2|7822
ATGGCGGCCGCGGGACAGTCGTCCATCACGGTGGCCATCAGAGTGAGGCCGTTTACGATTCGCGAAGCGGCTCAA
CTCCAAAAGAATGACGATAGCACGCTATTCCTGGGGGACGGCTCTCTGGCGAGCGCACCTCCCAAGCTGCATCAA
CGAGGGCTGAGAAATGTAATCAAAGTGGTGGACGACCGGTGCTTAGTGTTTGACCCGCCAGAAGACAACCCGGTT
CACAAGTTCTCGAGATCAGTGGTGCCGACTTCCAAGAGGGTCAAGGATCAGGTGTTTGCCTTTGACCGCGTGTTT
GACGACAACACAACGCAGACGGATGTGTACGAGGGCACAACGAAGAACCTGCTCGACAGTGTACTGGACGGATAT
AACGCGACGGTGTTTGCATACGGGGCAACGGGATGCGGCAAGACGCACACGATTACGGGGACGGCACAGCACCCA
GGCATCATCTTCCTGACGATGCAAGAGCTGTTTGAGAAGATTGAAGAGAGGAGTCAAGACAAGACGACGGAGCTG
AGCCTGAGCTACCTGGAGATCTACAACGAAACAATTCGCGATTTGCTGGTGCCAGGAGGGAGCAAGCAAGGGCTG
ACGCTGCGAGAAGACAGCAACCAGGCGGTGACGGTGGCAGGACTGAGCAGCCACCATCCGCGCGACGTGCAGCAA
GTCATGGACATGATTGTGCAGGGCAACGAGTACCGCACCGTGTCGCCAACCGAGGCCAACGCAACGTCTTCACGG
TCACATGCCGTGCTGCAGGTCAACATAGCGCAAAAGGACCGCAATGCCGACGTCAATGAGCCGCACACCATGGCG
ACGCTGAGCATCATCGACTTGGCGGGGTCTGAGCGCGCTTCAGTGACGAAGAATCGTGGAGAGCGGCTGGCCGAG
GGGGCAAACATCAACAAGTCTCTGCTAGCGCTGGGCAGCTGCATCAATGCGCTGTGCGACCGGCGACAGCGGGCA
CACGTTCCCTACCGTAACTCGAAGCTGACGCGTCTGCTCAAGTTCTCGCTGGGGGGCAACTGCAAGACGGTCATG
ATTGTTTGCGTGTCGCCGTCGAGCGCACACTTTGACGAGACGCAAAACACGCTCCGCTACGCAAACCGGGCCAAG
AATATTCAAACAAAGGTGACGCGCAATGTGTTCAATGTGAATAGACACGTCAAGGACTTTCTGGTCAAGATTGAC
GAGCAAATGGCGCTCATCAAGGAGCTCAAGGCGCAGCAAAACGAGGCAGAGGCCATGTTTTTGGCCAAGTTGCGC
AAGCAGTGCGACAAGCGCGACTGCGTAGTTGTAGAGGGGGTGCAGCGACTGCGAGCAGCATATGAGCACACGGCG
GGCGAGAGGCAGGAACGGGTGGTGAGCATGAAGAAGCTCCGGGCTGTGGAGCGGCGCATCAGCCTCTTAAGCGGA
TGGATGGGAGCGTTTGATGCGGTTTGCGACGGGCGCGCGGGCTTGTCTGACAGCGAGGATGGGGCCATGCCCAAG
AGCTTGGCTGCTATTCGTGGTACGGCCAAGGGCATATTGGCGGAGCTGGAGAATAGCAGACAGCACCTGCACCAG
AGGCTGGACAAGACGTCATGGGAGCGAGCGATTGATACGGCCCTGACACACAGTCTTAAGCAGCTCGAGGGTGTC
GAGGGAGCCGAAGACCCGGGCAATGCAGCCAGCGGGCTGGAGCGCGAAGCAGAGCTACTCAAGACGGGCTTCGGG
CGTGAAGCGTACCGCGAGGTGCTGGAGAGCGAAAAGGGAAGTGACGCGGCTGTTGTGCAGATGCTGCTTACTGCG
CAGCTGGATATTTTGGCGTCGCTGACGGATCTCATGGCCATGGACGAGCAGAGTGCAGTGGCACACGCCAAGCAG
TGTCTCGGCCGGTTGCTGCAGACTGGGCACGATGCTGCAGTGCAGGTGGTAAAGCCCGACGTCAGCTCGGTGCCA
TTGCCCGTTGTCGAGGCGTTTCCACCGACACGCAAAGGCACGCCCAAGCGAAAAAAGACGGCGTCGTATGCGTGT
GTGGGGCCCGTGGCACCCACGGTGCATAACGAGCACGTTTTTGGCAGTCCAATCAAGTCTCTGTCTCCGCGGCGG
CGTAGGGTGCTGGGAGCGGCGTCGCATCTCAAAAAGGGGGTTTGCTTTTCGCCGGTGCGCCGAGTCAAGGGCAGA
GGCGTGAGATGGCGAGATGACGAGACGGAGCAGGGCACCTTGGCCGACTATGGAGGGACGCCTAGGCGCTGGGAG
TCGCCCATCAAGGGATGCATGTCGCCAGACAAGAGCATGGGAGGAGGCGTGTCAAGAGTGAGCACAAATGAGCCG
AGACAGGCAGACGGCAAGTCAAGCCCGAGCACAGAAGTGCCTGCAAAGGCTGGTGGCAGGTTCCAAGCCGGCTTC
TTATCCAAGAGCTCGCGAGCCTCGAGTGGGTCGCCGCAGCTGCAGTCGCCGCCCAAGCTGGACCTCCGACTGGCC
ACAAGCTCCCCAGATCTCAAGGGATCGCCACTGCGGATGCGGAGTGGTGGCTCGCCGCTAGCGGTGATTATGGAC
CAACCGAATCGACGGCTGGTGCATGAGACGGGGGCGCCCAAGCAGGCGGATGGTGGCAGAATCAATGATGAGAAC
ACGGCGCCACAGCAACCACGGTGGCCGCGTCAAGCCACGCCAGATGGGTCGTCCGACTCTGAGACTATTGATGCG
CGCAAGGTGCGCAGTGCCCTGCAAAACATGTCCAAGCTGTCGGGGCGGCGTTCAAGCGGAATGTCGCTGGCCATG
GCGGCCAAGAGGGCTCCCAGCAGCAGCAGCGGCGTGACGCGGCTGAGGCGGGCTAGTCCACCACCAATGCCCTGT
GCCTCAGCTGCTCCATCCCCTATGGATCATGCAGGGCTGACGGCGGGCCAAGCACGGAGAATGAAGATTGGAGGC
AGCGTCAGGCTTGCAGAAAGTCCTCGGGACGAGGCCCGTCGCGTTACGGTTGGCACGGGTCCAAGAAGGACGGTG
GCGTGGCGCTGA
Gene >OphauB2|7822
ATGGCGGCCGCGGGACAGTCGTCCATCACGGTGGCCAGTAAGTCTTTTCGCATTGGTGAAGCTTTAACTCGCAGC
TAATGGAGTGATGTATAGTCAGAGTGAGGCCGTTTACGATTCGCGAAGCGGCTCAACTGTAGGTGGTGGATGCAG
CAGTTTAGCATGGTTGGGGCTTACTGACGCGACACAGCCAAAAGAATGACGATAGCACGCTATTCCTGGGGGACG
GCTCTCTGGCGAGCGCACCTCCCAAGCTGCATCAACGAGGGCTGAGAAATGTAATCAAAGTGGTGGACGACCGGT
GCTTGTAGGCAGACTGGAGAGCGTCGAGGCGTGTTGCAGGCATGGCTGACTGGTGATGCAGAGTGTTTGACCCGC
CAGAAGACAACCCGGTTCACAAGTTCTCGAGATCAGTGGTGCCGACTTCCAAGAGGGTCAAGGATCAGGTGTTTG
CCTTTGACCGCGTGTTTGACGACAACACAACGCAGACGGATGTGTACGAGGGCACAACGAAGAACCTGCTCGACA
GTGTACTGGACGGATATAACGCGACGGTGTTTGCATACGGGGCAACGGGATGCGGCAAGACGCACACGATTACGG
GGACGGCACAGCACCCAGGCATCATCTTCCTGACGATGCAAGAGCTGTTTGAGAAGATTGAAGAGAGGAGTCAAG
ACAAGACGACGGAGCTGAGCCTGAGCTACCTGGAGATCTACAACGAAACAATTCGCGATTTGCTGGTGCCAGGAG
GGAGCAAGCAAGGGCTGACGCTGCGAGAAGACAGCAACCAGGCGGTGACGGTGGCAGGACTGAGCAGCCACCATC
CGCGCGACGTGCAGCAAGTCATGGACATGATTGTGCAGGGCAACGAGTACCGCACCGTGTCGCCAACCGAGGCCA
ACGCAACGTCTTCACGGTCACATGCCGTGCTGCAGGTCAACATAGCGCAAAAGGACCGCAATGCCGACGTCAATG
AGCCGCACACCATGGCGACGCTGAGCATCATCGACTTGGCGGGGTCTGAGCGCGCTTCAGTGACGAAGAATCGTG
GAGAGCGGCTGGCCGAGGGGGCAAACATCAACAAGTCTCTGCTAGCGCTGGGCAGCTGCATCAATGCGCTGTGCG
ACCGGCGACAGCGGGCACACGTTCCCTACCGTAACTCGAAGCTGACGCGTCTGCTCAAGTTCTCGCTGGGGGGCA
ACTGCAAGACGGTCATGATTGTTTGCGTGTCGCCGTCGAGCGCACACTTTGACGAGACGCAAAACACGCTCCGCT
ACGCAAACCGGGCCAAGAATATTCAAACAAAGGTGACGCGCAATGTGTTCAATGTGAATAGACACGTCAAGGACT
TTCTGGTCAAGATTGACGAGCAAATGGCGCTCATCAAGGAGCTCAAGGCGCAGCAAAACGAGGCAGAGGCCATGT
TTTTGGCCAAGTTGCGCAAGCAGTGCGACAAGCGCGACTGCGTAGTTGTAGAGGGGGTGCAGCGACTGCGAGCAG
CATATGAGCACACGGCGGGCGAGAGGCAGGAACGGGTGGTGAGCATGAAGAAGCTCCGGGCTGTGGAGCGGCGCA
TCAGCCTCTTAAGCGGATGGATGGGAGCGTTTGATGCGGTTTGCGACGGGCGCGCGGGCTTGTCTGACAGCGAGG
ATGGGGCCATGCCCAAGAGCTTGGCTGCTATTCGTGGTACGGCCAAGGGCATATTGGCGGAGCTGGAGAATAGCA
GACAGCACCTGCACCAGAGGCTGGACAAGACGTCATGGGAGCGAGCGATTGATACGGCCCTGACACACAGTCTTA
AGCAGCTCGAGGGTGTCGAGGGAGCCGAAGACCCGGGCAATGCAGCCAGCGGGCTGGAGCGCGAAGCAGAGCTAC
TCAAGACGGGCTTCGGGCGTGAAGCGTACCGCGAGGTGCTGGAGAGCGAAAAGGGAAGTGACGCGGCTGTTGTGC
AGATGCTGCTTACTGCGCAGCTGGATATTTTGGCGTCGCTGACGGATCTCATGGCCATGGACGAGCAGAGTGCAG
TGGCACACGCCAAGCAGTGTCTCGGCCGGTTGCTGCAGACTGGGCACGATGCTGCAGTGCAGGTGGTAAAGCCCG
ACGTCAGCTCGGTGCCATTGCCCGTTGTCGAGGCGTTTCCACCGACACGCAAAGGCACGCCCAAGCGAAAAAAGA
CGGCGTCGTATGCGTGTGTGGGGCCCGTGGCACCCACGGTGCATAACGAGCACGTTTTTGGCAGTCCAATCAAGT
CTCTGTCTCCGCGGCGGCGTAGGGTGCTGGGAGCGGCGTCGCATCTCAAAAAGGGGGTTTGCTTTTCGCCGGTGC
GCCGAGTCAAGGGCAGAGGCGTGAGATGGCGAGATGACGAGACGGAGCAGGGCACCTTGGCCGACTATGGAGGGA
CGCCTAGGCGCTGGGAGTCGCCCATCAAGGGATGCATGTCGCCAGACAAGAGCATGGGAGGAGGCGTGTCAAGAG
TGAGCACAAATGAGCCGAGACAGGCAGACGGCAAGTCAAGCCCGAGCACAGAAGTGCCTGCAAAGGCTGGTGGCA
GGTTCCAAGCCGGCTTCTTATCCAAGAGCTCGCGAGCCTCGAGTGGGTCGCCGCAGCTGCAGTCGCCGCCCAAGC
TGGACCTCCGACTGGCCACAAGCTCCCCAGATCTCAAGGGATCGCCACTGCGGATGCGGAGTGGTGGCTCGCCGC
TAGCGGTGATTATGGACCAACCGAATCGACGGCTGGTGCATGAGACGGGGGCGCCCAAGCAGGCGGATGGTGGCA
GAATCAATGATGAGAACACGGCGCCACAGCAACCACGGTGGCCGCGTCAAGCCACGCCAGATGGGTCGTCCGACT
CTGAGACTATTGATGCGCGCAAGGTGCGCAGTGCCCTGCAAAACATGTCCAAGCTGTCGGGGCGGCGTTCAAGCG
GAATGTCGCTGGCCATGGCGGCCAAGAGGGCTCCCAGCAGCAGCAGCGGCGTGACGCGGCTGAGGCGGGCTAGTC
CACCACCAATGCCCTGTGCCTCAGCTGCTCCATCCCCTATGGATCATGCAGGGCTGACGGCGGGCCAAGCACGGA
GAATGAAGATTGGAGGCAGCGTCAGGCTTGCAGAAAGTCCTCGGGACGAGGCCCGTCGCGTTACGGTTGGCACGG
GTCCAAGAAGGACGGTGGCGTGGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail