Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|782
Gene name
LocationContig_116:64258..65402
Strand+
Gene length (bp)1144
Transcript length (bp)1083
Coding sequence length (bp)1083
Protein length (aa) 361

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20179 MSS51_C MSS51 C-terminal domain 1.3E-43 102 331
PF13824 zf-Mss51 Zinc-finger of mitochondrial splicing suppressor 51 5.9E-25 3 48

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P32335|MSS51_YEAST Protein MSS51, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS51 PE=1 SV=2 6 358 1.0E-83
sp|Q9UTB4|MSS51_SCHPO Protein mss51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mss51 PE=3 SV=1 6 355 7.0E-65

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6925
Ophiocordyceps australis map64 (Brazil) OphauB2|782 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04503
Ophiocordyceps camponoti-rufipedis Ophun1|5647
Ophiocordyceps kimflemingae Ophio5|5809
Ophiocordyceps subramaniannii Hirsu2|37

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|782
MAPVHVDFECPDCGLAVYCSKGHWMDDYEKHLEICDTLRQINEDDHDLRSGRVFREGNMPGSQMDEAKINMTNWD
TFMYTREFEAVNSERAMRQVTRLLTYPITIGSVIHELSPYTIRRKGRLTVEGLKSFSALRYNLHRPKTGNGMDIE
HLRPEPPAVRVFVLGARAESSLPRATWVQLAHMFPDTMLHLIMIGPESMANRDDEFPLPPRTASNPWGAVVEDRV
WYKMKISTIVDYYHTIHKTGYFAPYDPYFDCFVLFHPGLGHPASSHEWEETLPMLLETKLPIISTGYTQFDMERD
VNWVAQKSRGEFDVLLEPGENTFRSLRWDLNDMDPQDVSCGNWGVWAFRGKRYETTTKGE*
Coding >OphauB2|782
ATGGCACCGGTGCACGTCGACTTTGAATGTCCGGACTGCGGCCTTGCAGTCTATTGCAGCAAGGGACACTGGATG
GACGACTATGAAAAGCATCTCGAGATATGCGACACGCTGCGGCAGATCAATGAAGACGACCATGATCTTCGCTCG
GGACGAGTTTTCCGCGAAGGCAACATGCCGGGGTCGCAAATGGACGAGGCCAAGATCAACATGACCAACTGGGAC
ACGTTTATGTACACGCGAGAATTCGAGGCTGTCAACTCGGAGCGGGCGATGCGCCAGGTGACGCGGCTGCTCACG
TATCCAATAACGATTGGCAGCGTAATCCACGAACTGAGCCCCTATACGATTCGGAGAAAGGGCAGGTTAACGGTG
GAGGGACTCAAGAGTTTTAGCGCTCTGAGATACAACTTGCACCGGCCAAAGACGGGAAATGGCATGGACATTGAG
CATTTGCGACCAGAGCCGCCAGCGGTCAGAGTGTTTGTGTTGGGGGCCAGAGCCGAGTCGTCGTTGCCGCGAGCA
ACGTGGGTGCAGTTGGCGCACATGTTTCCCGACACGATGCTGCACCTCATCATGATTGGGCCTGAAAGCATGGCC
AACCGAGACGACGAGTTTCCGCTGCCGCCACGAACAGCGTCGAATCCATGGGGCGCCGTGGTGGAGGACCGGGTT
TGGTACAAGATGAAGATTAGCACCATTGTGGACTACTACCACACGATTCACAAGACGGGCTACTTTGCCCCCTAC
GACCCCTATTTTGACTGCTTTGTATTATTCCACCCGGGGCTTGGACACCCAGCCAGCAGCCATGAGTGGGAGGAG
ACGCTGCCGATGCTGCTCGAGACAAAGTTGCCCATTATCAGCACTGGGTACACGCAGTTTGACATGGAGCGCGAT
GTGAATTGGGTTGCGCAAAAGTCGAGGGGCGAATTCGACGTGTTGCTAGAGCCGGGGGAAAACACTTTTAGGAGC
TTGCGGTGGGACTTGAACGACATGGATCCGCAAGATGTAAGCTGCGGCAACTGGGGAGTATGGGCATTTAGAGGA
AAGAGATATGAGACGACGACCAAGGGCGAGTAG
Transcript >OphauB2|782
ATGGCACCGGTGCACGTCGACTTTGAATGTCCGGACTGCGGCCTTGCAGTCTATTGCAGCAAGGGACACTGGATG
GACGACTATGAAAAGCATCTCGAGATATGCGACACGCTGCGGCAGATCAATGAAGACGACCATGATCTTCGCTCG
GGACGAGTTTTCCGCGAAGGCAACATGCCGGGGTCGCAAATGGACGAGGCCAAGATCAACATGACCAACTGGGAC
ACGTTTATGTACACGCGAGAATTCGAGGCTGTCAACTCGGAGCGGGCGATGCGCCAGGTGACGCGGCTGCTCACG
TATCCAATAACGATTGGCAGCGTAATCCACGAACTGAGCCCCTATACGATTCGGAGAAAGGGCAGGTTAACGGTG
GAGGGACTCAAGAGTTTTAGCGCTCTGAGATACAACTTGCACCGGCCAAAGACGGGAAATGGCATGGACATTGAG
CATTTGCGACCAGAGCCGCCAGCGGTCAGAGTGTTTGTGTTGGGGGCCAGAGCCGAGTCGTCGTTGCCGCGAGCA
ACGTGGGTGCAGTTGGCGCACATGTTTCCCGACACGATGCTGCACCTCATCATGATTGGGCCTGAAAGCATGGCC
AACCGAGACGACGAGTTTCCGCTGCCGCCACGAACAGCGTCGAATCCATGGGGCGCCGTGGTGGAGGACCGGGTT
TGGTACAAGATGAAGATTAGCACCATTGTGGACTACTACCACACGATTCACAAGACGGGCTACTTTGCCCCCTAC
GACCCCTATTTTGACTGCTTTGTATTATTCCACCCGGGGCTTGGACACCCAGCCAGCAGCCATGAGTGGGAGGAG
ACGCTGCCGATGCTGCTCGAGACAAAGTTGCCCATTATCAGCACTGGGTACACGCAGTTTGACATGGAGCGCGAT
GTGAATTGGGTTGCGCAAAAGTCGAGGGGCGAATTCGACGTGTTGCTAGAGCCGGGGGAAAACACTTTTAGGAGC
TTGCGGTGGGACTTGAACGACATGGATCCGCAAGATGTAAGCTGCGGCAACTGGGGAGTATGGGCATTTAGAGGA
AAGAGATATGAGACGACGACCAAGGGCGAGTAG
Gene >OphauB2|782
ATGGCACCGGTGCACGTCGACTTTGAATGTCCGGACTGCGGCCTTGCAGTCTATTGCAGCAAGGGACACTGGATG
GACGACTATGAAAAGCATCTCGAGATATGCGACACGCTGCGGCAGATCAATGAAGACGACCATGATCTTCGCTCG
GGACGAGTTTTCCGCGAAGGCAACATGCCGGGGTCGCAAATGGACGAGGCCAAGATCAACATGACCAACTGGGAC
ACGTTTATGTACACGCGAGAATTCGAGGCTGTCAACTCGGAGCGGGCGATGCGCCAGGTGACGCGGCTGCTCACG
TATCCAATAACGATTGGCAGCGTAATCCACGAACTGAGCCCCTATACGATTCGGAGAAAGGGCAGGTTAACGGTG
GAGGGACTCAAGAGTTTTAGCGGTGGGTAGATTGACAAGAGTGTTGTTGCGGGTGCCAAGACTTGACTGCTGACA
AGGCAAAGCTCTGAGATACAACTTGCACCGGCCAAAGACGGGAAATGGCATGGACATTGAGCATTTGCGACCAGA
GCCGCCAGCGGTCAGAGTGTTTGTGTTGGGGGCCAGAGCCGAGTCGTCGTTGCCGCGAGCAACGTGGGTGCAGTT
GGCGCACATGTTTCCCGACACGATGCTGCACCTCATCATGATTGGGCCTGAAAGCATGGCCAACCGAGACGACGA
GTTTCCGCTGCCGCCACGAACAGCGTCGAATCCATGGGGCGCCGTGGTGGAGGACCGGGTTTGGTACAAGATGAA
GATTAGCACCATTGTGGACTACTACCACACGATTCACAAGACGGGCTACTTTGCCCCCTACGACCCCTATTTTGA
CTGCTTTGTATTATTCCACCCGGGGCTTGGACACCCAGCCAGCAGCCATGAGTGGGAGGAGACGCTGCCGATGCT
GCTCGAGACAAAGTTGCCCATTATCAGCACTGGGTACACGCAGTTTGACATGGAGCGCGATGTGAATTGGGTTGC
GCAAAAGTCGAGGGGCGAATTCGACGTGTTGCTAGAGCCGGGGGAAAACACTTTTAGGAGCTTGCGGTGGGACTT
GAACGACATGGATCCGCAAGATGTAAGCTGCGGCAACTGGGGAGTATGGGCATTTAGAGGAAAGAGATATGAGAC
GACGACCAAGGGCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail