Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7810
Gene name
LocationContig_9:6799..8248
Strand+
Gene length (bp)1449
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04652 Vta1 Vta1 like 7.2E-46 59 203
PF18097 Vta1_C Vta1 C-terminal domain 7.8E-16 375 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13703|VTA1_SCHPO Vacuolar protein sorting-associated protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vts1 PE=3 SV=2 56 410 3.0E-21
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein VTA1 homolog OS=Bos taurus GN=VTA1 PE=2 SV=1 75 412 4.0E-19
sp|Q9SZ15|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana GN=LIP5 PE=1 SV=1 63 222 3.0E-15
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein VTA1 homolog OS=Pongo abelii GN=VTA1 PE=2 SV=1 75 207 6.0E-12
sp|Q9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens GN=VTA1 PE=1 SV=1 75 207 6.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13703|VTA1_SCHPO Vacuolar protein sorting-associated protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vts1 PE=3 SV=2 56 410 3.0E-21
sp|Q32L63|VTA1_BOVIN Vacuolar protein sorting-associated protein VTA1 homolog OS=Bos taurus GN=VTA1 PE=2 SV=1 75 412 4.0E-19
sp|Q9SZ15|LIP5_ARATH Protein HOMOLOG OF MAMMALIAN LYST-INTERACTING PROTEIN 5 OS=Arabidopsis thaliana GN=LIP5 PE=1 SV=1 63 222 3.0E-15
sp|Q5R5W5|VTA1_PONAB Vacuolar protein sorting-associated protein VTA1 homolog OS=Pongo abelii GN=VTA1 PE=2 SV=1 75 207 6.0E-12
sp|Q9NP79|VTA1_HUMAN Vacuolar protein sorting-associated protein VTA1 homolog OS=Homo sapiens GN=VTA1 PE=1 SV=1 75 207 6.0E-12
sp|Q9CR26|VTA1_MOUSE Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus GN=Vta1 PE=1 SV=1 75 207 9.0E-12
sp|Q55B11|VTA1_DICDI Vacuolar protein sorting-associated protein VTA1 homolog OS=Dictyostelium discoideum GN=vta1 PE=3 SV=1 47 208 7.0E-11
sp|Q9CR26|VTA1_MOUSE Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus GN=Vta1 PE=1 SV=1 291 412 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1801
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4580
Ophiocordyceps australis map64 (Brazil) OphauB2|7810 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05904
Ophiocordyceps camponoti-rufipedis Ophun1|2165
Ophiocordyceps kimflemingae Ophio5|4847
Ophiocordyceps subramaniannii Hirsu2|1760

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7810
MQQALKENHTWRELSPSACRNDDFLPHAIIQRATPAPSYSPLHISQEMAELPASLKLPDISRFVNRANQLRIIKP
AIAYWCEYHAVNQIVSKSLHNADDEAFAFTRGLIERLESTKAARADDDAIVDNDAGRAYVEQFAEETFARAERTL
RANKVTRQTADTFDAAATFFELGREWGSLEDETAQRIRFAKWNAARILRAIREGTDPNETNPKPTTSLDDTTGEQ
ELRPGAGEGSGFRPLPASVEDVPETTGFPLESDGASLDSSKLDQDAILKPKATGPMDFGVIAQDSATPSAPDLPN
QAPPASGTQIPLQPSPHIPTKLPPEFQLSEEAPSDIALPPVAPVAQTPPPQQVIRPPPPPVAPAAPPAPEAVNLR
DIGQAQKHAKWAISALNFEDVPTAVNELRNALAALGTR*
Coding >OphauB2|7810
ATGCAGCAAGCGTTGAAGGAAAACCACACGTGGCGCGAGCTTTCTCCATCTGCCTGTCGCAATGACGACTTTCTG
CCGCATGCCATTATTCAACGTGCCACGCCAGCGCCCTCTTATTCACCTCTACACATTAGCCAGGAAATGGCGGAG
CTTCCAGCGTCGCTCAAGCTTCCAGACATTAGTCGCTTCGTCAACCGGGCAAATCAGCTGCGGATCATTAAGCCC
GCCATTGCCTATTGGTGCGAATACCATGCCGTGAATCAAATCGTCAGCAAAAGCCTACACAATGCCGATGATGAA
GCATTTGCCTTTACGAGGGGCCTTATCGAGCGGCTAGAGAGCACCAAGGCGGCGCGGGCAGATGATGATGCCATT
GTAGACAATGACGCTGGGCGGGCCTATGTTGAGCAATTCGCCGAAGAGACATTTGCGCGCGCGGAGCGAACGCTG
CGAGCAAATAAAGTAACGAGGCAGACGGCGGATACGTTTGATGCGGCGGCCACGTTTTTCGAACTCGGACGCGAA
TGGGGCAGCTTGGAGGATGAAACGGCGCAGAGAATCAGGTTTGCCAAATGGAATGCTGCGCGGATCCTGCGCGCT
ATTCGCGAGGGCACTGATCCGAATGAAACAAATCCGAAGCCTACGACAAGTCTTGACGATACTACAGGGGAGCAA
GAACTGAGGCCAGGCGCTGGCGAGGGATCGGGATTCAGGCCGTTGCCTGCTTCTGTCGAAGACGTCCCTGAGACG
ACGGGCTTTCCCCTAGAGTCTGATGGCGCATCTTTGGACTCGTCGAAACTAGATCAAGACGCTATTTTGAAGCCC
AAAGCAACTGGACCTATGGACTTTGGAGTCATAGCCCAAGATTCAGCGACTCCCTCTGCCCCAGACTTGCCAAAC
CAAGCTCCGCCGGCGTCGGGGACACAAATACCTTTACAACCTTCACCTCACATCCCGACAAAACTGCCTCCGGAA
TTTCAGCTATCAGAGGAAGCTCCCTCAGATATAGCCTTGCCTCCCGTGGCACCAGTGGCGCAAACCCCTCCTCCG
CAGCAAGTTATCCGCCCTCCGCCTCCCCCTGTCGCGCCAGCTGCGCCTCCAGCGCCGGAAGCAGTCAACCTTCGC
GATATTGGGCAAGCGCAAAAACACGCAAAGTGGGCCATATCGGCGCTGAATTTTGAGGACGTCCCTACAGCTGTC
AACGAACTGCGAAATGCACTGGCGGCGCTAGGAACCCGGTAG
Transcript >OphauB2|7810
ATGCAGCAAGCGTTGAAGGAAAACCACACGTGGCGCGAGCTTTCTCCATCTGCCTGTCGCAATGACGACTTTCTG
CCGCATGCCATTATTCAACGTGCCACGCCAGCGCCCTCTTATTCACCTCTACACATTAGCCAGGAAATGGCGGAG
CTTCCAGCGTCGCTCAAGCTTCCAGACATTAGTCGCTTCGTCAACCGGGCAAATCAGCTGCGGATCATTAAGCCC
GCCATTGCCTATTGGTGCGAATACCATGCCGTGAATCAAATCGTCAGCAAAAGCCTACACAATGCCGATGATGAA
GCATTTGCCTTTACGAGGGGCCTTATCGAGCGGCTAGAGAGCACCAAGGCGGCGCGGGCAGATGATGATGCCATT
GTAGACAATGACGCTGGGCGGGCCTATGTTGAGCAATTCGCCGAAGAGACATTTGCGCGCGCGGAGCGAACGCTG
CGAGCAAATAAAGTAACGAGGCAGACGGCGGATACGTTTGATGCGGCGGCCACGTTTTTCGAACTCGGACGCGAA
TGGGGCAGCTTGGAGGATGAAACGGCGCAGAGAATCAGGTTTGCCAAATGGAATGCTGCGCGGATCCTGCGCGCT
ATTCGCGAGGGCACTGATCCGAATGAAACAAATCCGAAGCCTACGACAAGTCTTGACGATACTACAGGGGAGCAA
GAACTGAGGCCAGGCGCTGGCGAGGGATCGGGATTCAGGCCGTTGCCTGCTTCTGTCGAAGACGTCCCTGAGACG
ACGGGCTTTCCCCTAGAGTCTGATGGCGCATCTTTGGACTCGTCGAAACTAGATCAAGACGCTATTTTGAAGCCC
AAAGCAACTGGACCTATGGACTTTGGAGTCATAGCCCAAGATTCAGCGACTCCCTCTGCCCCAGACTTGCCAAAC
CAAGCTCCGCCGGCGTCGGGGACACAAATACCTTTACAACCTTCACCTCACATCCCGACAAAACTGCCTCCGGAA
TTTCAGCTATCAGAGGAAGCTCCCTCAGATATAGCCTTGCCTCCCGTGGCACCAGTGGCGCAAACCCCTCCTCCG
CAGCAAGTTATCCGCCCTCCGCCTCCCCCTGTCGCGCCAGCTGCGCCTCCAGCGCCGGAAGCAGTCAACCTTCGC
GATATTGGGCAAGCGCAAAAACACGCAAAGTGGGCCATATCGGCGCTGAATTTTGAGGACGTCCCTACAGCTGTC
AACGAACTGCGAAATGCACTGGCGGCGCTAGGAACCCGGTAG
Gene >OphauB2|7810
ATGCAGCAAGCGTTGAAGGAAAAGTACGCCAAGCTTAGCTAGCTGTTGAAGCCACTGTGGTGTGACATCGTATTC
GTATCTCTAGCCACACGTGGCGCGAGCTTTCTCCATCTGCCTGTCGCAATGACGACTTTCTGCCGCATGCCATTA
TTCAACGTGCCACGCCAGCGCCCTCTTATTCACCTCTACACATTAGCCAGGAAATGGCGGAGCTTCCAGCGTCGC
TCAAGCTTCCAGACATTAGTCGCTTCGTCAACCGGGCAAATCAGCTGCGGATCATTAAGCCCGCCATTGCCTATT
GGTGTCTGTGAAACCCCCCAGCCAAAACCTCCCCGAAAAAGAGAAGCAGAGACACGAAACAAGTTTTGTTGCTCA
CGCGTTGGGCCATAGGCGAATACCATGCCGTGAATCAAATCGTCAGCAAAAGCCTACACAATGCCGATGATGAAG
CATTTGCCTTTACGAGGGGCCTTATCGAGCGGCTAGAGAGCACCAAGGCGGCGCGGGCAGATGATGATGCCATTG
TAGACAATGACGCTGGGCGGGCCTATGTTGAGCAATTCGCCGAAGAGACATTTGCGCGCGCGGAGCGAACGCTGC
GAGCAAATAAAGTAACGAGGTAAATGTTGTCATCTTGTGGTCGCGAGCGAAGGAGCGGAAAGCTCATGTGTGGAT
AGGCAGACGGCGGATACGTTTGATGCGGCGGCCACGTTTTTCGAACTCGGACGCGAATGGGGCAGCTTGGAGGAT
GAAACGGCGCAGAGAATCAGGTTTGCCAAATGGAATGCTGCGCGGATCCTGCGCGCTATTCGCGAGGGCACTGAT
CCGAATGAAACAAATCCGAAGCCTACGACAAGTCTTGACGATACTACAGGGGAGCAAGAACTGAGGCCAGGCGCT
GGCGAGGGATCGGGATTCAGGCCGTTGCCTGCTTCTGTCGAAGACGTCCCTGAGACGACGGGCTTTCCCCTAGAG
TCTGATGGCGCATCTTTGGACTCGTCGAAACTAGATCAAGACGCTATTTTGAAGCCCAAAGCAACTGGACCTATG
GACTTTGGAGTCATAGCCCAAGATTCAGCGACTCCCTCTGCCCCAGACTTGCCAAACCAAGCTCCGCCGGCGTCG
GGGACACAAATACCTTTACAACCTTCACCTCACATCCCGACAAAACTGCCTCCGGAATTTCAGCTATCAGAGGAA
GCTCCCTCAGATATAGCCTTGCCTCCCGTGGCACCAGTGGCGCAAACCCCTCCTCCGCAGCAAGTTATCCGCCCT
CCGCCTCCCCCTGTCGCGCCAGCTGCGCCTCCAGCGCCGGAAGCAGTCAACCTTCGCGATATTGGGCAAGCGCAA
AAACACGCAAAGTGGGCCATATCGGCGCTGAATTTTGAGGACGTCCCTACAGCTGTCAACGAACTGCGAAATGCA
CTGGCGGCGCTAGGAACCCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail