Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7803
Gene name
LocationContig_89:68315..71930
Strand-
Gene length (bp)3615
Transcript length (bp)3504
Coding sequence length (bp)3504
Protein length (aa) 1168

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11715 Nup160 Nucleoporin Nup120/160 3.1E-141 46 572

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0E7|NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP120 PE=3 SV=1 10 1122 0.0E+00
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 50 1166 2.0E-26
sp|Q9VKJ3|NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster GN=Nup160 PE=1 SV=1 905 1159 4.0E-12
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 758 1141 2.0E-11
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 270 574 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0E7|NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP120 PE=3 SV=1 10 1122 0.0E+00
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 50 1166 2.0E-26
sp|Q9VKJ3|NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster GN=Nup160 PE=1 SV=1 905 1159 4.0E-12
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 758 1141 2.0E-11
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 270 574 2.0E-09
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 758 1110 2.0E-09
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 270 574 3.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1997
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6492
Ophiocordyceps australis map64 (Brazil) OphauB2|7803 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07377
Ophiocordyceps camponoti-rufipedis Ophun1|3213
Ophiocordyceps kimflemingae Ophio5|5144
Ophiocordyceps subramaniannii Hirsu2|2234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7803
MDSGEGSYRFKETRLNLEPPALASVVVIRVPSKVTNPRSLRRVTNDPSIEDEALFRLKNLAVASSIFHRKWHDAP
RSFLWRVLDHGTVLSVRAVDVCKRDKKPDASLVLNFTFAVPIQPGCVAFADPQEHDALCVFVLDQASQLYTFTLR
PDLFRRKTAIDAGLSELGKVQSPANLGFRSPHRLVAVSTNVILVTVNDGGIIRLDKTRSEDSSDRIWTESFFNVQ
GWAQNLRSLLPFHGKHTIKYGNSRMEYSAATSIQVTDFGLDDGLFAITVCIDHKMRIWNLEDGQIIYTSDILGAE
RPPQEMGKWTIEPSQANLVQLVGKGHGSRICATYSPIGLGEFKFWKISVSDMHTVVVEDLFPQNNLYPPTPSSLD
IWTLADFVLASPTEGIIHIWTLWKNNMTYRVQRMELDRKQMARPWEESWDGVFSDTGITAAQTSGPCDPIDVTEK
WLQTLFQPGRFTKATLETALSIYERGLGSVRDGTKGRSLAESICSILGSTISLERDSSGIMNYEQFRASSEAQWR
RFYRLLIELDRLRGEAIGLSVDPETDLVWVVCTDLISAITECNELELLYHNLSSPEEDKGQLASLVSTALSFVDG
FADSFVQMCNAALKRQLFEESSKTNAERILLFSENSGFWRGVTDEDCSQVETAFGTNFQMVTDDLYQNLLDLMAA
PQEARRRHLRNPLTEFGNRLIMKSVQDSIELQWKVCLSQLILLVHMELEFDNEDEALHKRVKVGLIFQKLVHALK
RLELLRWLARTELSVPLFKQERGTPPVLSKKGTEETQVVTALEANVGHLLGFDSAKNEPMTLSIMELVANLCAPD
SDIEVSPALIQCSLVKRERADLALELAPFCDQSPFSVYIQGRVLLALRDLEAAAISFGKAAIGMSSANATTDRHS
CGLLDDTEWNLLHSGVAKYYAHIVALYEGHRAHSYVLEFSRLALQFATCSKEHESIRTEMLSPLFNAALATAQFE
LAHTSLLSIADETMRLNFVRKLVDKMCETFHNTELVSLPFPGMQQEVEHILTQRCKNTMDVLHGFPYHHVLYAWR
IKRNNYRGAASVILDRIHKLKRAGEGDRVGDEDALNTPVTRQYLLLINALSCVDAKQAWIFDEGVPQISDEGEVT
CDKRTMVSLADIRRQYQGELDRISAIHKNQFGFEMDDVMDIA*
Coding >OphauB2|7803
ATGGACTCTGGTGAGGGAAGTTACCGCTTCAAAGAGACGCGTCTAAATCTCGAGCCTCCCGCCTTGGCGTCTGTT
GTGGTGATTCGAGTCCCTTCCAAAGTCACAAACCCCAGAAGCCTACGGCGTGTGACGAACGACCCGTCCATTGAA
GATGAAGCACTGTTCCGGCTCAAGAACTTGGCTGTTGCGTCGTCCATCTTCCACCGCAAGTGGCATGATGCACCG
CGCAGTTTTCTGTGGCGCGTTCTTGATCACGGCACAGTGCTGAGTGTTCGAGCAGTCGACGTCTGCAAACGGGAT
AAGAAGCCGGACGCGTCGCTGGTGCTCAACTTTACCTTTGCTGTGCCCATACAGCCGGGCTGTGTTGCATTTGCG
GATCCACAGGAGCATGACGCCCTCTGTGTCTTTGTCTTGGACCAAGCCTCGCAGCTCTACACCTTTACGCTTCGG
CCTGATTTGTTCCGCAGGAAGACTGCCATTGATGCTGGCCTGTCGGAGTTGGGCAAGGTTCAATCGCCAGCAAAT
TTGGGATTTAGGAGTCCACATCGGCTGGTGGCTGTCTCGACCAATGTGATTCTGGTAACGGTAAATGATGGAGGC
ATAATTCGCCTCGACAAGACACGCTCTGAAGACTCGTCGGACAGAATATGGACAGAATCCTTCTTCAATGTACAA
GGCTGGGCGCAAAATCTTCGAAGCTTGCTCCCATTCCATGGCAAGCATACAATCAAATATGGAAACTCGAGGATG
GAATACAGCGCAGCAACATCAATACAGGTCACAGACTTTGGACTTGACGACGGCCTGTTCGCCATCACAGTGTGC
ATCGATCACAAGATGCGCATCTGGAATCTCGAAGACGGACAGATTATATACACATCCGATATACTGGGCGCCGAA
AGGCCTCCACAAGAAATGGGCAAGTGGACAATCGAACCGTCCCAAGCAAATCTTGTACAGCTTGTTGGTAAGGGT
CACGGCTCGCGTATTTGTGCGACATATTCGCCAATTGGTCTGGGCGAGTTCAAATTCTGGAAGATTTCCGTGAGC
GACATGCACACAGTCGTTGTAGAGGACCTATTTCCCCAGAATAATTTATACCCTCCCACACCATCATCGTTGGAC
ATCTGGACCCTGGCCGACTTTGTCCTGGCTTCTCCTACAGAAGGCATTATTCATATCTGGACTCTGTGGAAGAAC
AACATGACATATCGAGTGCAGCGTATGGAACTCGATAGAAAACAAATGGCACGACCCTGGGAGGAGAGTTGGGAT
GGCGTCTTTTCGGATACGGGCATCACAGCTGCTCAAACCTCAGGTCCGTGTGATCCTATTGATGTCACCGAAAAA
TGGCTACAGACACTTTTTCAGCCTGGCCGCTTCACCAAGGCAACTCTGGAGACAGCACTGTCCATATACGAGCGC
GGATTGGGGTCAGTTCGTGATGGCACCAAGGGACGAAGCCTGGCAGAATCCATCTGTTCAATCCTGGGCTCTACC
ATCTCTTTGGAACGCGATTCTTCTGGAATAATGAATTATGAGCAATTTCGCGCTTCAAGCGAAGCGCAATGGCGA
AGATTTTATCGACTACTCATCGAGCTCGATAGGCTGCGAGGAGAAGCTATTGGACTATCGGTTGATCCAGAGACA
GATTTGGTGTGGGTTGTGTGCACTGACTTGATATCTGCCATTACAGAATGCAACGAGCTCGAGCTACTATACCAC
AACTTGTCATCTCCCGAGGAGGATAAAGGGCAACTTGCCTCGTTGGTCAGCACTGCCCTCTCGTTTGTTGATGGA
TTCGCGGATAGCTTTGTACAAATGTGCAACGCTGCTCTCAAACGTCAACTTTTTGAAGAATCATCCAAGACAAAC
GCTGAGAGGATTCTGCTCTTCTCTGAAAACTCAGGCTTTTGGCGCGGAGTCACGGACGAAGACTGTTCACAAGTC
GAAACTGCGTTTGGGACAAATTTTCAGATGGTGACGGATGACTTGTATCAAAACCTCTTGGACTTAATGGCCGCC
CCGCAAGAGGCACGACGCCGCCATCTGCGCAATCCCTTGACCGAGTTTGGAAACAGGCTCATCATGAAGAGCGTT
CAGGACAGCATTGAGCTTCAGTGGAAAGTTTGCCTGTCACAGCTGATTCTTCTCGTCCACATGGAGCTTGAATTT
GATAATGAAGATGAGGCTCTGCACAAGCGTGTCAAGGTCGGCCTCATTTTCCAGAAGCTTGTCCACGCGCTTAAA
AGACTTGAGCTACTCAGATGGCTCGCCCGTACAGAACTATCGGTGCCTCTGTTTAAGCAGGAAAGAGGCACGCCT
CCAGTGCTATCAAAGAAGGGCACCGAGGAGACGCAGGTTGTGACGGCTTTGGAAGCAAACGTGGGACATCTGCTG
GGCTTTGACAGCGCTAAAAATGAACCCATGACGCTGAGCATTATGGAGCTCGTTGCCAATCTGTGTGCGCCAGAC
AGCGACATTGAGGTATCACCTGCGCTAATACAGTGTTCGCTGGTCAAGCGAGAGCGGGCGGATCTAGCGCTCGAG
TTGGCCCCGTTTTGCGATCAGAGTCCCTTTTCGGTATACATTCAAGGACGAGTGCTGCTGGCACTCCGAGACTTG
GAGGCAGCGGCCATCAGTTTCGGAAAAGCGGCTATTGGAATGAGCTCTGCTAATGCGACAACAGACCGACACAGC
TGCGGCCTCCTCGATGACACGGAATGGAATCTTCTGCACAGCGGTGTGGCCAAGTACTACGCGCATATCGTGGCT
CTGTATGAAGGACACAGAGCGCACTCGTACGTGCTCGAGTTTTCACGCCTGGCGTTGCAGTTTGCGACGTGTTCC
AAGGAGCACGAGAGCATTAGGACGGAAATGCTGAGCCCACTCTTTAATGCAGCTTTGGCAACGGCGCAGTTTGAG
CTTGCTCACACGAGTCTGTTGTCCATTGCGGACGAGACTATGAGGCTGAACTTTGTGCGCAAGCTGGTGGACAAG
ATGTGCGAGACGTTCCACAACACGGAGCTCGTGTCTCTGCCCTTTCCAGGTATGCAGCAAGAAGTGGAGCATATC
CTGACGCAGCGGTGTAAAAACACCATGGACGTTTTACACGGGTTTCCCTATCACCACGTGCTATATGCGTGGCGC
ATCAAGCGCAACAACTATCGCGGCGCGGCCTCGGTCATCCTGGACCGTATTCACAAGCTGAAGCGCGCGGGCGAG
GGCGACAGAGTGGGCGATGAAGATGCGCTCAACACGCCCGTTACGCGCCAGTACCTGCTGCTCATCAATGCCTTG
AGCTGTGTCGACGCTAAGCAGGCCTGGATCTTTGACGAGGGCGTTCCGCAGATAAGCGACGAGGGCGAAGTCACA
TGCGACAAGCGCACCATGGTTTCGCTGGCCGATATCCGAAGGCAGTATCAGGGCGAACTCGACCGAATCTCGGCC
ATTCACAAGAACCAGTTTGGATTCGAGATGGATGATGTCATGGATATTGCATGA
Transcript >OphauB2|7803
ATGGACTCTGGTGAGGGAAGTTACCGCTTCAAAGAGACGCGTCTAAATCTCGAGCCTCCCGCCTTGGCGTCTGTT
GTGGTGATTCGAGTCCCTTCCAAAGTCACAAACCCCAGAAGCCTACGGCGTGTGACGAACGACCCGTCCATTGAA
GATGAAGCACTGTTCCGGCTCAAGAACTTGGCTGTTGCGTCGTCCATCTTCCACCGCAAGTGGCATGATGCACCG
CGCAGTTTTCTGTGGCGCGTTCTTGATCACGGCACAGTGCTGAGTGTTCGAGCAGTCGACGTCTGCAAACGGGAT
AAGAAGCCGGACGCGTCGCTGGTGCTCAACTTTACCTTTGCTGTGCCCATACAGCCGGGCTGTGTTGCATTTGCG
GATCCACAGGAGCATGACGCCCTCTGTGTCTTTGTCTTGGACCAAGCCTCGCAGCTCTACACCTTTACGCTTCGG
CCTGATTTGTTCCGCAGGAAGACTGCCATTGATGCTGGCCTGTCGGAGTTGGGCAAGGTTCAATCGCCAGCAAAT
TTGGGATTTAGGAGTCCACATCGGCTGGTGGCTGTCTCGACCAATGTGATTCTGGTAACGGTAAATGATGGAGGC
ATAATTCGCCTCGACAAGACACGCTCTGAAGACTCGTCGGACAGAATATGGACAGAATCCTTCTTCAATGTACAA
GGCTGGGCGCAAAATCTTCGAAGCTTGCTCCCATTCCATGGCAAGCATACAATCAAATATGGAAACTCGAGGATG
GAATACAGCGCAGCAACATCAATACAGGTCACAGACTTTGGACTTGACGACGGCCTGTTCGCCATCACAGTGTGC
ATCGATCACAAGATGCGCATCTGGAATCTCGAAGACGGACAGATTATATACACATCCGATATACTGGGCGCCGAA
AGGCCTCCACAAGAAATGGGCAAGTGGACAATCGAACCGTCCCAAGCAAATCTTGTACAGCTTGTTGGTAAGGGT
CACGGCTCGCGTATTTGTGCGACATATTCGCCAATTGGTCTGGGCGAGTTCAAATTCTGGAAGATTTCCGTGAGC
GACATGCACACAGTCGTTGTAGAGGACCTATTTCCCCAGAATAATTTATACCCTCCCACACCATCATCGTTGGAC
ATCTGGACCCTGGCCGACTTTGTCCTGGCTTCTCCTACAGAAGGCATTATTCATATCTGGACTCTGTGGAAGAAC
AACATGACATATCGAGTGCAGCGTATGGAACTCGATAGAAAACAAATGGCACGACCCTGGGAGGAGAGTTGGGAT
GGCGTCTTTTCGGATACGGGCATCACAGCTGCTCAAACCTCAGGTCCGTGTGATCCTATTGATGTCACCGAAAAA
TGGCTACAGACACTTTTTCAGCCTGGCCGCTTCACCAAGGCAACTCTGGAGACAGCACTGTCCATATACGAGCGC
GGATTGGGGTCAGTTCGTGATGGCACCAAGGGACGAAGCCTGGCAGAATCCATCTGTTCAATCCTGGGCTCTACC
ATCTCTTTGGAACGCGATTCTTCTGGAATAATGAATTATGAGCAATTTCGCGCTTCAAGCGAAGCGCAATGGCGA
AGATTTTATCGACTACTCATCGAGCTCGATAGGCTGCGAGGAGAAGCTATTGGACTATCGGTTGATCCAGAGACA
GATTTGGTGTGGGTTGTGTGCACTGACTTGATATCTGCCATTACAGAATGCAACGAGCTCGAGCTACTATACCAC
AACTTGTCATCTCCCGAGGAGGATAAAGGGCAACTTGCCTCGTTGGTCAGCACTGCCCTCTCGTTTGTTGATGGA
TTCGCGGATAGCTTTGTACAAATGTGCAACGCTGCTCTCAAACGTCAACTTTTTGAAGAATCATCCAAGACAAAC
GCTGAGAGGATTCTGCTCTTCTCTGAAAACTCAGGCTTTTGGCGCGGAGTCACGGACGAAGACTGTTCACAAGTC
GAAACTGCGTTTGGGACAAATTTTCAGATGGTGACGGATGACTTGTATCAAAACCTCTTGGACTTAATGGCCGCC
CCGCAAGAGGCACGACGCCGCCATCTGCGCAATCCCTTGACCGAGTTTGGAAACAGGCTCATCATGAAGAGCGTT
CAGGACAGCATTGAGCTTCAGTGGAAAGTTTGCCTGTCACAGCTGATTCTTCTCGTCCACATGGAGCTTGAATTT
GATAATGAAGATGAGGCTCTGCACAAGCGTGTCAAGGTCGGCCTCATTTTCCAGAAGCTTGTCCACGCGCTTAAA
AGACTTGAGCTACTCAGATGGCTCGCCCGTACAGAACTATCGGTGCCTCTGTTTAAGCAGGAAAGAGGCACGCCT
CCAGTGCTATCAAAGAAGGGCACCGAGGAGACGCAGGTTGTGACGGCTTTGGAAGCAAACGTGGGACATCTGCTG
GGCTTTGACAGCGCTAAAAATGAACCCATGACGCTGAGCATTATGGAGCTCGTTGCCAATCTGTGTGCGCCAGAC
AGCGACATTGAGGTATCACCTGCGCTAATACAGTGTTCGCTGGTCAAGCGAGAGCGGGCGGATCTAGCGCTCGAG
TTGGCCCCGTTTTGCGATCAGAGTCCCTTTTCGGTATACATTCAAGGACGAGTGCTGCTGGCACTCCGAGACTTG
GAGGCAGCGGCCATCAGTTTCGGAAAAGCGGCTATTGGAATGAGCTCTGCTAATGCGACAACAGACCGACACAGC
TGCGGCCTCCTCGATGACACGGAATGGAATCTTCTGCACAGCGGTGTGGCCAAGTACTACGCGCATATCGTGGCT
CTGTATGAAGGACACAGAGCGCACTCGTACGTGCTCGAGTTTTCACGCCTGGCGTTGCAGTTTGCGACGTGTTCC
AAGGAGCACGAGAGCATTAGGACGGAAATGCTGAGCCCACTCTTTAATGCAGCTTTGGCAACGGCGCAGTTTGAG
CTTGCTCACACGAGTCTGTTGTCCATTGCGGACGAGACTATGAGGCTGAACTTTGTGCGCAAGCTGGTGGACAAG
ATGTGCGAGACGTTCCACAACACGGAGCTCGTGTCTCTGCCCTTTCCAGGTATGCAGCAAGAAGTGGAGCATATC
CTGACGCAGCGGTGTAAAAACACCATGGACGTTTTACACGGGTTTCCCTATCACCACGTGCTATATGCGTGGCGC
ATCAAGCGCAACAACTATCGCGGCGCGGCCTCGGTCATCCTGGACCGTATTCACAAGCTGAAGCGCGCGGGCGAG
GGCGACAGAGTGGGCGATGAAGATGCGCTCAACACGCCCGTTACGCGCCAGTACCTGCTGCTCATCAATGCCTTG
AGCTGTGTCGACGCTAAGCAGGCCTGGATCTTTGACGAGGGCGTTCCGCAGATAAGCGACGAGGGCGAAGTCACA
TGCGACAAGCGCACCATGGTTTCGCTGGCCGATATCCGAAGGCAGTATCAGGGCGAACTCGACCGAATCTCGGCC
ATTCACAAGAACCAGTTTGGATTCGAGATGGATGATGTCATGGATATTGCATGA
Gene >OphauB2|7803
ATGGACTCTGGTGAGGGAAGTTACCGCTTCAAAGAGACGCGTCTAAATCTCGAGCCTCCCGCCTTGGCGTCTGTT
GTGGTGATTCGAGTCCCTTCCAAAGTCACAAACCCCAGAAGCCTACGGCGTGTGACGAACGACCCGTCCATTGAA
GATGAAGCACTGTTCCGGCTCAAGAACTTGGCTGTTGCGTCGTCCATCTTCCACCGCAAGTGGCATGATGCACCG
CGCAGTTTTCTGTGGCGCGTTCTTGATCACGGCACAGTGCTGAGTGTTCGAGCAGTCGACGTCTGCAAACGGGAT
AAGAAGCCGGACGCGTCGCTGGTGCTCAACTTTACCTTTGCTGTGCCCATACAGCCGGGCTGTGTTGCATTTGCG
GATCCACAGGAGCATGACGCCCTCTGTGTCTTTGTCTTGGACCAAGCCTCGCAGCTCTACACCTTTACGCTTCGG
CCTGATTTGTTCCGCAGGAAGACTGCCATTGATGCTGGCCTGTCGGAGTTGGGCAAGGTTCAATCGCCAGCAAAT
TTGGGATTTAGGAGTCCACATCGGCTGGTGGCTGTCTCGACCAATGTGATTCTGGTAACGGTAAATGATGGAGGC
ATAATTCGCCTCGACAAGACACGCTCTGAAGACTGTGAGTTTGTTGTATGCTTCTTGCTACAGCATCGCGTTCGC
TAATTATGTTTGTCAGCGTCGGACAGAATATGGACAGAATCCTTCTTCAATGTACAAGGCTGGGCGCAAAATCTT
CGAAGCTTGCTCCCATTCCATGGCAAGCATACAATCAAATATGGAAACTCGAGGATGGAATACAGCGCAGCAACA
TCAATACAGGTCACAGACTTTGGACTTGACGACGGCCTGTTCGCCATCACAGTGTGCATCGATCACAAGATGCGC
ATCTGGAATCTCGAAGACGGACAGATTATATACACATCCGATATACTGGGCGCCGAAAGGCCTCCACAAGAAATG
GGCAAGTGGACAATCGAACCGTCCCAAGCAAATCTTGTACAGCTTGTTGGTAAGGGTCACGGCTCGCGTATTTGT
GCGACATATTCGCCAATTGGTCTGGGCGAGTTCAAATTCTGGAAGATTTCCGTGAGCGACATGCACACAGTCGTT
GTAGAGGACCTATTTCCCCAGAATAATTTATACCCTCCCACACCATCATCGTTGGACATCTGGACCCTGGCCGAC
TTTGTCCTGGCTTCTCCTACAGAAGGCATTATTCATATCTGGACTCTGTGGAAGAACAACATGACATATCGAGTG
CAGCGTATGGAACTCGATAGAAAACAAATGGCACGACCCTGGGAGGAGAGTTGGGATGGCGTCTTTTCGGATACG
GGCATCACAGCTGCTCAAACCTCAGGTCCGTGTGATCCTATTGATGTCACCGAAAAATGGCTACAGACACTTTTT
CAGCCTGGCCGCTTCACCAAGGCAACTCTGGAGACAGCACTGTCCATATACGAGCGCGGATTGGGGTCAGTTCGT
GATGGCACCAAGGGACGAAGCCTGGCAGAATCCATCTGTTCAATCCTGGGCTCTACCATCTCTTTGGAACGCGAT
TCTTCTGGAATAATGAATTATGAGCAATTTCGCGCTTCAAGCGAAGCGCAATGGCGAAGATTTTATCGACTACTC
ATCGAGCTCGATAGGCTGCGAGGAGAAGCTATTGGACTATCGGTTGATCCAGAGACAGATTTGGTGTGGGTTGTG
TGCACTGACTTGATATCTGCCATTACAGAATGCAACGAGCTCGAGCTACTATACCACAACTTGTCATCTCCCGAG
GAGGATAAAGGGCAACTTGCCTCGTTGGTCAGCACTGCCCTCTCGTTTGTTGATGGATTCGCGGATAGCTTTGTA
CAAATGTGCAACGCTGCTCTCAAACGTCAACTTTTTGAAGAATCATCCAAGACAAACGCTGAGAGGATTCTGCTC
TTCTCTGAAAACTCAGGCTTTTGGCGCGGAGTCACGGACGAAGACTGTTCACAAGTCGAAACTGCGTTTGGGACA
AATTTTCAGATGGTGACGGATGACTTGTATCAAAACCTCTTGGACTTAATGGCCGCCCCGCAAGAGGCACGACGC
CGCCATCTGCGCAATCCCTTGACCGAGTTTGGAAACAGGCTCATCATGAAGAGCGTTCAGGACAGCATTGAGCTT
CAGTGGAAAGTTTGCCTGTCACAGCTGATTCTTCTCGTCCACATGGAGCTTGAATTTGATAATGAAGATGAGGCT
CTGCACAAGCGTGTCAAGGTCGGCCTCATTTTCCAGAAGCTTGTCCACGCGCTTAAAAGACTTGAGCTACTCAGA
TGGCTCGCCCGTACAGAACTATCGGTGCCTCTGTTTAAGCAGGAAAGAGGCACGCCTCCAGTGCTATCAAAGAAG
GGCACCGAGGAGACGCAGGTTGTGACGGCTTTGGAAGCAAACGTGGGACATCTGCTGGGCTTTGACAGCGCTAAA
AATGAACCCATGACGCTGAGCATTATGGAGCTCGTTGCCAATCTGTGTGCGCCAGACAGCGACATTGAGGTATCA
CCTGCGCTAATACAGTGTTCGCTGGTCAAGCGAGAGCGGGCGGATCTAGCGCTCGAGTTGGCCCCGTTTTGCGAT
CAGAGTCCCTTTTCGGTATACATTCAAGGACGAGTGCTGCTGGCACTCCGAGACTTGGAGGCAGCGGCCATCAGT
TTCGGAAAAGCGGCTATTGGAATGAGTGAGGCAGCGTGCGCTGAGCCGAATTGAAGGAGATGATGCTAACAGGCT
TTAGGCTCTGCTAATGCGACAACAGACCGACACAGCTGCGGCCTCCTCGATGACACGGAATGGAATCTTCTGCAC
AGCGGTGTGGCCAAGTACTACGCGCATATCGTGGCTCTGTATGAAGGACACAGAGCGCACTCGTACGTGCTCGAG
TTTTCACGCCTGGCGTTGCAGTTTGCGACGTGTTCCAAGGAGCACGAGAGCATTAGGACGGAAATGCTGAGCCCA
CTCTTTAATGCAGCTTTGGCAACGGCGCAGTTTGAGCTTGCTCACACGAGTCTGTTGTCCATTGCGGACGAGACT
ATGAGGCTGAACTTTGTGCGCAAGCTGGTGGACAAGATGTGCGAGACGTTCCACAACACGGAGCTCGTGTCTCTG
CCCTTTCCAGGTATGCAGCAAGAAGTGGAGCATATCCTGACGCAGCGGTGTAAAAACACCATGGACGTTTTACAC
GGGTTTCCCTATCACCACGTGCTATATGCGTGGCGCATCAAGCGCAACAACTATCGCGGCGCGGCCTCGGTCATC
CTGGACCGTATTCACAAGCTGAAGCGCGCGGGCGAGGGCGACAGAGTGGGCGATGAAGATGCGCTCAACACGCCC
GTTACGCGCCAGTACCTGCTGCTCATCAATGCCTTGAGCTGTGTCGACGCTAAGCAGGCCTGGATCTTTGACGAG
GGCGTTCCGCAGATAAGCGACGAGGGCGAAGTCACATGCGACAAGCGCACCATGGTTTCGCTGGCCGATATCCGA
AGGCAGTATCAGGGCGAACTCGACCGAATCTCGGCCATTCACAAGAACCAGTTTGGATTCGAGATGGATGATGTC
ATGGATATTGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail