Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7795
Gene name
LocationContig_89:52944..54334
Strand+
Gene length (bp)1390
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.3E-51 21 415

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38680|MTR_NEUCR N amino acid transport system protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mtr PE=3 SV=2 5 436 4.0E-155

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 52 74 22
3 101 123 22
4 133 155 22
5 160 182 22
6 202 221 19
7 242 264 22
8 284 306 22
9 327 349 22
10 354 376 22
11 397 419 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7795
MSQIGQVCEINLEKQQDTTHRLGWKRLTFALVVESVALGSLSLPAAFATLGMVASIICCIGLGLVAIYTGFLVGK
VKLRYPHVSHYADSGRLLMGNFGYELFGAMFTLSIVFVIASHVLTGTIAFVNITNSGVCSAIFGFISTLILLILA
IPPSFADIAILGYIDFVSILAAIALTMIATGIQASKDSGLLASNWSAWPKPGITFIEAFVAIANIVFAYTFCVGQ
FSFMDEMHTPRDFMKSIWLLGGLEISIYTLTGAIIYSFVGVDVKSPALLSAGDQISKIAFGIALPVIFISGSINT
TVLGRYIHGRFFDKNSPGYYVKTPKGWAVWLTIVTCISFAAFLIAELIPFFNPLLSLLSSLFVSGFCFYLPAIMW
YRLLREGSWYARKNIANSLMSLLSFIVGVIVLICGTYASVANIIQLFQEGDIGQVFTCKPVG*
Coding >OphauB2|7795
ATGTCTCAGATCGGCCAAGTCTGCGAGATAAACCTTGAGAAGCAACAAGACACAACACATCGCCTTGGTTGGAAG
CGTCTGACCTTTGCCCTCGTTGTCGAGAGCGTTGCTCTCGGCAGCCTCAGTCTACCCGCCGCCTTTGCTACCCTG
GGAATGGTGGCAAGCATTATTTGCTGCATTGGCCTGGGCCTCGTCGCCATCTACACCGGCTTCCTCGTCGGCAAA
GTCAAGCTGCGATATCCACACGTTTCCCACTATGCTGACAGCGGCCGCTTGCTCATGGGCAACTTTGGCTATGAG
CTCTTTGGCGCCATGTTTACCCTCTCAATCGTCTTCGTCATTGCCTCTCATGTCCTTACTGGCACCATCGCCTTT
GTGAATATTACCAACAGTGGCGTATGTTCGGCTATATTCGGCTTCATCTCTACCCTCATTCTCCTTATTCTCGCT
ATTCCGCCCTCTTTTGCAGACATAGCTATCCTAGGCTATATTGACTTTGTTTCCATCCTGGCTGCCATTGCACTG
ACCATGATTGCCACTGGCATTCAGGCCAGTAAAGACTCTGGTCTTTTGGCTAGCAACTGGTCTGCCTGGCCAAAG
CCGGGCATTACCTTTATCGAGGCCTTTGTTGCTATTGCTAATATTGTATTTGCCTATACATTTTGCGTCGGCCAG
TTTTCATTTATGGATGAAATGCATACGCCCAGAGATTTTATGAAATCCATATGGTTGCTCGGTGGCCTTGAGATT
TCAATCTACACTCTCACGGGCGCCATTATATACTCTTTTGTCGGTGTCGACGTCAAATCACCAGCTCTTCTCTCG
GCCGGCGACCAGATATCCAAGATAGCTTTTGGTATCGCTTTACCCGTTATTTTTATTTCTGGCTCCATCAACACT
ACTGTTCTTGGTCGATATATTCATGGACGCTTCTTCGACAAGAACTCGCCCGGCTACTACGTCAAGACGCCCAAG
GGCTGGGCTGTCTGGCTGACCATTGTCACTTGTATCTCTTTTGCAGCTTTTCTCATTGCCGAGCTAATTCCCTTT
TTCAACCCGTTGCTTTCTCTGCTTTCGTCGCTCTTTGTTTCTGGTTTTTGCTTCTACTTGCCAGCCATTATGTGG
TATCGACTACTACGCGAGGGCAGCTGGTATGCGAGAAAGAACATTGCAAACAGTCTCATGAGTCTTCTTTCTTTT
ATTGTTGGTGTCATAGTCCTTATATGTGGGACTTATGCAAGCGTGGCCAATATTATACAATTATTTCAAGAAGGC
GACATTGGCCAAGTTTTTACCTGCAAGCCTGTTGGATAA
Transcript >OphauB2|7795
ATGTCTCAGATCGGCCAAGTCTGCGAGATAAACCTTGAGAAGCAACAAGACACAACACATCGCCTTGGTTGGAAG
CGTCTGACCTTTGCCCTCGTTGTCGAGAGCGTTGCTCTCGGCAGCCTCAGTCTACCCGCCGCCTTTGCTACCCTG
GGAATGGTGGCAAGCATTATTTGCTGCATTGGCCTGGGCCTCGTCGCCATCTACACCGGCTTCCTCGTCGGCAAA
GTCAAGCTGCGATATCCACACGTTTCCCACTATGCTGACAGCGGCCGCTTGCTCATGGGCAACTTTGGCTATGAG
CTCTTTGGCGCCATGTTTACCCTCTCAATCGTCTTCGTCATTGCCTCTCATGTCCTTACTGGCACCATCGCCTTT
GTGAATATTACCAACAGTGGCGTATGTTCGGCTATATTCGGCTTCATCTCTACCCTCATTCTCCTTATTCTCGCT
ATTCCGCCCTCTTTTGCAGACATAGCTATCCTAGGCTATATTGACTTTGTTTCCATCCTGGCTGCCATTGCACTG
ACCATGATTGCCACTGGCATTCAGGCCAGTAAAGACTCTGGTCTTTTGGCTAGCAACTGGTCTGCCTGGCCAAAG
CCGGGCATTACCTTTATCGAGGCCTTTGTTGCTATTGCTAATATTGTATTTGCCTATACATTTTGCGTCGGCCAG
TTTTCATTTATGGATGAAATGCATACGCCCAGAGATTTTATGAAATCCATATGGTTGCTCGGTGGCCTTGAGATT
TCAATCTACACTCTCACGGGCGCCATTATATACTCTTTTGTCGGTGTCGACGTCAAATCACCAGCTCTTCTCTCG
GCCGGCGACCAGATATCCAAGATAGCTTTTGGTATCGCTTTACCCGTTATTTTTATTTCTGGCTCCATCAACACT
ACTGTTCTTGGTCGATATATTCATGGACGCTTCTTCGACAAGAACTCGCCCGGCTACTACGTCAAGACGCCCAAG
GGCTGGGCTGTCTGGCTGACCATTGTCACTTGTATCTCTTTTGCAGCTTTTCTCATTGCCGAGCTAATTCCCTTT
TTCAACCCGTTGCTTTCTCTGCTTTCGTCGCTCTTTGTTTCTGGTTTTTGCTTCTACTTGCCAGCCATTATGTGG
TATCGACTACTACGCGAGGGCAGCTGGTATGCGAGAAAGAACATTGCAAACAGTCTCATGAGTCTTCTTTCTTTT
ATTGTTGGTGTCATAGTCCTTATATGTGGGACTTATGCAAGCGTGGCCAATATTATACAATTATTTCAAGAAGGC
GACATTGGCCAAGTTTTTACCTGCAAGCCTGTTGGATAA
Gene >OphauB2|7795
ATGTCTCAGATCGGCCAAGTCTGCGAGATAAACCTTGAGAAGCAACAAGACACAACACATCGCCTTGGTTGGAAG
CGTCTGACCTTTGCCCTCGTTGTCGAGAGCGTTGCTCTCGGCAGCCTCAGTCTACCCGCCGCCTTTGCTACCCTG
GGAATGGTGGCAAGCATTATTTGCTGCATTGGCCTGGGCCTCGTCGCCATCTACACCGGCTTCCTCGTCGGCAAA
GTCAAGCTGCGATATCCACACGTTTCCCACTATGCTGACAGCGGCCGCTTGCTCATGGGCAACTTTGGCTATGAG
CTCTTTGGCGCCATGTTTACCCTCTCAATCGTCTTCGTCATTGCCTCTCATGTCCTTACTGGCACCATCGCCTTT
GTGAATATTACCAACAGTGGCGTATGTTCGGCTATATTCGGCTTCATCTCTACCCTCATTCTCCTTATTCTCGCT
ATTCCGCCCTCTTTTGCAGACATAGCTATCCTAGGCTATATTGACTTTGTTTCCATCCTGGCTGCCATTGCACTG
ACCATGATTGCCACTGGCATTCAGGCCAGTAAAGACTCTGGTCTTTTGGCTAGCAACTGGTCTGCCTGGCCAAAG
CCGGGCATTACCTTTATCGAGGCCTTTGTTGCTATTGCTAATATTGTATTTGCCTATACATTTTGCGTCGGCCAG
TTTTCATTTATGGATGAAATGCATACGCCCAGAGATTTTATGAAATCCATATGGTTGCTCGGTGGCCTTGAGATT
TCAATCTACACTCTCACGGGCGCCATTATATACTCTTTTGTCGGTGTCGACGTCAAATCACCAGCTCTTCTCTCG
GCCGGCGACCAGATATCCAAGATAGCTTTTGGTATCGCTTTACCCGTTATTTTTATTTCTGGCTCCATCAACACT
ACTGTTCTTGGTCGATATATTCATGGACGCTTCTTCGACAAGAACTCGCCCGGCTACTACGTCAAGACGCCCAAG
GGCTGGGCTGTCTGGCTGACCATTGTCACTTGTATCTCTTTTGCAGCTTTTCTCATTGCCGAGCTAATTCCCTTT
TTCAACCCGTTGCTTTCTCTGCTTTCGTCGCTCTTTGTTTCTGGTTTTTGCTTCTACTTGCCAGCCATTATGTGG
TATCGACTACTACGCGAGGGCAGCTGGTATGCGAGAAAGAACATTGCAAACAGTCTCATGAGTCTTCTTTCTTTT
ATTGTTGGTGTCATAGTCCTTATATGTGGGACTTATGCAAGCGTGGCCAATATTGTGAGTCTTGAATCTCTCCTC
GTTCTTCAACTGAGTTTGGTTGGTTCATTGCGACGCTAACAAACTTTACCCATAGATACAATTATTTCAAGAAGG
CGACATTGGCCAAGTTTTTACCTGCAAGCCTGTTGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail