Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7794
Gene name
LocationContig_89:48486..50631
Strand-
Gene length (bp)2145
Transcript length (bp)2043
Coding sequence length (bp)2043
Protein length (aa) 681

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epp-1 PE=3 SV=3 5 605 0.0E+00
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 57 600 1.0E-104
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 57 598 2.0E-93
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 56 598 2.0E-93
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 7 444 8.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3S1|PPN1_NEUCR Endopolyphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=epp-1 PE=3 SV=3 5 605 0.0E+00
sp|Q6BKG0|PPN1_DEBHA Endopolyphosphatase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PPN1 PE=3 SV=3 57 600 1.0E-104
sp|Q756F2|PPN1_ASHGO Endopolyphosphatase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPN1 PE=3 SV=2 57 598 2.0E-93
sp|Q04119|PPN1_YEAST Endopolyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPN1 PE=1 SV=1 56 598 2.0E-93
sp|Q6CEE7|PPN1_YARLI Endopolyphosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PPN1 PE=3 SV=1 7 444 8.0E-93
sp|Q6FMQ0|PPN1_CANGA Endopolyphosphatase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPN1 PE=3 SV=1 56 600 5.0E-90
sp|Q5KH67|PPN1_CRYNJ Endopolyphosphatase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PPN1 PE=3 SV=1 57 455 2.0E-81
sp|Q6CWT7|PPN1_KLULA Endopolyphosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPN1 PE=3 SV=1 57 445 2.0E-79
sp|Q9C1W8|PPN1_SCHPO Endopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppn1 PE=3 SV=1 57 603 4.0E-73
sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 55 331 8.0E-25
sp|Q3ZC91|ASM3A_BOVIN Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus GN=SMPDL3A PE=2 SV=1 59 336 3.0E-22
sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 55 336 1.0E-21
sp|Q92485|ASM3B_HUMAN Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens GN=SMPDL3B PE=2 SV=2 59 359 2.0E-21
sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 60 350 5.0E-21
sp|P58242|ASM3B_MOUSE Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus GN=Smpdl3b PE=1 SV=1 59 329 3.0E-20
sp|P70158|ASM3A_MOUSE Acid sphingomyelinase-like phosphodiesterase 3a OS=Mus musculus GN=Smpdl3a PE=1 SV=2 59 336 4.0E-19
sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 59 329 2.0E-18
sp|Q641Z7|ASM3A_RAT Acid sphingomyelinase-like phosphodiesterase 3a OS=Rattus norvegicus GN=Smpdl3a PE=2 SV=1 59 336 5.0E-18
sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 60 329 4.0E-17
sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 60 329 3.0E-15
sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 60 329 4.0E-15
sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 60 331 3.0E-12
sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=3 SV=2 60 331 7.0E-10
sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 62 331 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7794
MARAGDVCLWLQLALALAGGVASASPLFAPPSGSSSLASTEPFGAQRQSDAQLQPRLHGRFLHITDFHPDDYYKV
HSSSESGMACHGGRGMAGTYGAEKTDCDSPFSLVNATFDWIADNLRDKIDFVVWTGDSARHDSDEKHPRHQDEVL
DSNRAIANKFVHTFSSPKGKLSLPIVPTFGNNDFLPHNIMLPGPNKWFQAYADIWRRFIPEEQRHSFEFGGWFYV
EVIPNKLAVFSLNTMFFFDRNAAVDGCAEPSEPGYKHMEWLRVHLQLIRQRGMKAILMGHVPPARTDSKQNWDET
CWQRYTLWLRQYRDVVSASLFGHMNIDHFLLQDTKKLYITQNAEQHHDDPPLMVRSKENYLQELRDEWADLPDPI
ISILDSDQPDDSDVHDDVQGSKKKKKNKDKFAKIGGKYAERYQLSLVSPSMVPNYFPTLRVFEYNITGLEGAAVW
RDSYDSRALPTSWLQQESQHVELRRHLHVDKKKKKKKKDKHRRPDAPEIVPEDPADEALPGPAYSAQPLTLTGYV
QYYANLTHLNNDMPEPNMDTSKWRAGNPHKKPKHSPPRPLPFRFDVEYSTFDDKIYRLRDLTVKSYLHLAYRMGK
KEKMGLVDHVKDDNDEDLADSLEQEQELSDGVDADKKKKKKKGKKRRKKKERQRDANKTWLHFLSHAFVKTVPKK
DLKKM*
Coding >OphauB2|7794
ATGGCTCGCGCAGGCGACGTCTGTCTCTGGCTTCAGCTGGCCCTCGCTCTAGCCGGCGGCGTCGCCTCTGCATCA
CCCTTGTTTGCACCACCCTCGGGCTCGTCCTCGCTCGCCTCGACAGAGCCCTTTGGAGCCCAGCGGCAGTCGGAT
GCACAGCTGCAGCCCAGGTTACATGGCCGCTTTCTGCATATTACCGATTTCCATCCCGATGATTACTACAAGGTG
CATTCGTCGTCCGAGAGCGGAATGGCCTGCCATGGCGGCCGGGGCATGGCCGGCACCTACGGGGCCGAAAAGACG
GATTGCGACTCGCCCTTTTCGCTCGTCAACGCCACCTTTGACTGGATCGCCGACAATTTGCGCGACAAGATTGAC
TTTGTCGTGTGGACCGGCGATTCCGCCCGCCACGATAGCGACGAAAAACATCCCCGTCACCAAGACGAGGTGCTC
GACTCGAACCGCGCCATTGCCAACAAATTTGTCCATACTTTTTCTTCCCCCAAGGGCAAGCTGTCCCTGCCAATT
GTCCCCACCTTTGGAAACAATGATTTCCTCCCGCACAATATCATGCTCCCGGGCCCCAACAAGTGGTTCCAGGCC
TATGCTGACATTTGGAGACGCTTCATCCCCGAGGAGCAGCGTCACTCGTTTGAATTTGGAGGATGGTTCTATGTC
GAGGTGATTCCCAACAAGCTTGCCGTCTTTAGCCTCAACACAATGTTTTTCTTCGACCGCAATGCTGCCGTTGAC
GGCTGTGCCGAGCCTTCGGAGCCCGGCTATAAGCACATGGAATGGCTTCGCGTGCACCTGCAGCTTATTCGCCAA
CGCGGCATGAAGGCAATCCTCATGGGCCATGTCCCTCCGGCCCGCACAGACAGCAAGCAAAACTGGGATGAAACG
TGCTGGCAGCGCTACACGCTGTGGCTTCGCCAGTATCGCGACGTTGTTTCCGCCTCGCTCTTTGGACACATGAAC
ATTGATCACTTTTTACTCCAAGACACCAAAAAACTATACATTACCCAAAATGCAGAGCAGCATCACGACGACCCG
CCCTTGATGGTTCGTTCCAAAGAGAACTATTTACAAGAGCTGCGTGATGAATGGGCCGACTTGCCCGATCCAATC
ATCAGCATTCTCGACAGTGACCAGCCAGACGACTCTGATGTCCATGATGACGTCCAAGGCTCCAAAAAGAAGAAG
AAGAACAAGGATAAATTTGCCAAGATTGGTGGAAAGTATGCCGAGCGCTATCAACTGTCACTTGTTAGCCCCAGT
ATGGTTCCCAACTACTTTCCAACATTGCGCGTATTTGAATACAATATTACGGGTCTCGAGGGGGCAGCCGTTTGG
AGGGACTCGTATGACTCCAGGGCGTTGCCGACATCATGGCTCCAACAAGAGTCCCAACACGTGGAGCTTCGGCGG
CATCTCCATGTCGACAAGAAGAAGAAGAAGAAGAAGAAGGACAAGCACAGACGGCCAGATGCTCCTGAGATTGTG
CCTGAAGATCCGGCAGATGAGGCGCTTCCAGGACCGGCCTACAGCGCTCAGCCTCTGACGTTGACAGGCTATGTT
CAGTACTACGCCAACCTGACACATCTCAACAATGATATGCCTGAGCCAAATATGGATACGAGCAAGTGGCGCGCG
GGGAACCCGCATAAGAAGCCTAAACACTCGCCGCCTCGGCCTCTCCCGTTTCGGTTCGATGTCGAATACAGCACC
TTTGACGATAAGATATATAGATTACGAGATCTGACAGTCAAAAGTTACCTACACTTGGCGTACCGCATGGGCAAA
AAGGAAAAGATGGGATTGGTCGACCATGTCAAGGACGACAATGATGAAGATTTGGCCGACAGCTTGGAGCAAGAG
CAAGAGCTTTCAGACGGAGTGGATGCAGACAAGAAGAAGAAGAAGAAGAAGGGAAAGAAGAGAAGAAAGAAGAAG
GAGCGGCAGCGCGATGCAAACAAGACGTGGCTCCATTTTCTCAGTCATGCGTTTGTCAAGACGGTGCCGAAAAAA
GACCTGAAAAAGATGTGA
Transcript >OphauB2|7794
ATGGCTCGCGCAGGCGACGTCTGTCTCTGGCTTCAGCTGGCCCTCGCTCTAGCCGGCGGCGTCGCCTCTGCATCA
CCCTTGTTTGCACCACCCTCGGGCTCGTCCTCGCTCGCCTCGACAGAGCCCTTTGGAGCCCAGCGGCAGTCGGAT
GCACAGCTGCAGCCCAGGTTACATGGCCGCTTTCTGCATATTACCGATTTCCATCCCGATGATTACTACAAGGTG
CATTCGTCGTCCGAGAGCGGAATGGCCTGCCATGGCGGCCGGGGCATGGCCGGCACCTACGGGGCCGAAAAGACG
GATTGCGACTCGCCCTTTTCGCTCGTCAACGCCACCTTTGACTGGATCGCCGACAATTTGCGCGACAAGATTGAC
TTTGTCGTGTGGACCGGCGATTCCGCCCGCCACGATAGCGACGAAAAACATCCCCGTCACCAAGACGAGGTGCTC
GACTCGAACCGCGCCATTGCCAACAAATTTGTCCATACTTTTTCTTCCCCCAAGGGCAAGCTGTCCCTGCCAATT
GTCCCCACCTTTGGAAACAATGATTTCCTCCCGCACAATATCATGCTCCCGGGCCCCAACAAGTGGTTCCAGGCC
TATGCTGACATTTGGAGACGCTTCATCCCCGAGGAGCAGCGTCACTCGTTTGAATTTGGAGGATGGTTCTATGTC
GAGGTGATTCCCAACAAGCTTGCCGTCTTTAGCCTCAACACAATGTTTTTCTTCGACCGCAATGCTGCCGTTGAC
GGCTGTGCCGAGCCTTCGGAGCCCGGCTATAAGCACATGGAATGGCTTCGCGTGCACCTGCAGCTTATTCGCCAA
CGCGGCATGAAGGCAATCCTCATGGGCCATGTCCCTCCGGCCCGCACAGACAGCAAGCAAAACTGGGATGAAACG
TGCTGGCAGCGCTACACGCTGTGGCTTCGCCAGTATCGCGACGTTGTTTCCGCCTCGCTCTTTGGACACATGAAC
ATTGATCACTTTTTACTCCAAGACACCAAAAAACTATACATTACCCAAAATGCAGAGCAGCATCACGACGACCCG
CCCTTGATGGTTCGTTCCAAAGAGAACTATTTACAAGAGCTGCGTGATGAATGGGCCGACTTGCCCGATCCAATC
ATCAGCATTCTCGACAGTGACCAGCCAGACGACTCTGATGTCCATGATGACGTCCAAGGCTCCAAAAAGAAGAAG
AAGAACAAGGATAAATTTGCCAAGATTGGTGGAAAGTATGCCGAGCGCTATCAACTGTCACTTGTTAGCCCCAGT
ATGGTTCCCAACTACTTTCCAACATTGCGCGTATTTGAATACAATATTACGGGTCTCGAGGGGGCAGCCGTTTGG
AGGGACTCGTATGACTCCAGGGCGTTGCCGACATCATGGCTCCAACAAGAGTCCCAACACGTGGAGCTTCGGCGG
CATCTCCATGTCGACAAGAAGAAGAAGAAGAAGAAGAAGGACAAGCACAGACGGCCAGATGCTCCTGAGATTGTG
CCTGAAGATCCGGCAGATGAGGCGCTTCCAGGACCGGCCTACAGCGCTCAGCCTCTGACGTTGACAGGCTATGTT
CAGTACTACGCCAACCTGACACATCTCAACAATGATATGCCTGAGCCAAATATGGATACGAGCAAGTGGCGCGCG
GGGAACCCGCATAAGAAGCCTAAACACTCGCCGCCTCGGCCTCTCCCGTTTCGGTTCGATGTCGAATACAGCACC
TTTGACGATAAGATATATAGATTACGAGATCTGACAGTCAAAAGTTACCTACACTTGGCGTACCGCATGGGCAAA
AAGGAAAAGATGGGATTGGTCGACCATGTCAAGGACGACAATGATGAAGATTTGGCCGACAGCTTGGAGCAAGAG
CAAGAGCTTTCAGACGGAGTGGATGCAGACAAGAAGAAGAAGAAGAAGAAGGGAAAGAAGAGAAGAAAGAAGAAG
GAGCGGCAGCGCGATGCAAACAAGACGTGGCTCCATTTTCTCAGTCATGCGTTTGTCAAGACGGTGCCGAAAAAA
GACCTGAAAAAGATGTGA
Gene >OphauB2|7794
ATGGCTCGCGCAGGCGACGTCTGTCTCTGGCTTCAGCTGGCCCTCGCTCTAGCCGGCGGCGTCGCCTCTGCATCA
CCCTTGTTTGCACCACCCTCGGGCTCGTCCTCGCTCGCCTCGACAGAGCCCTTTGGAGCCCAGCGGCAGTCGGAT
GCACAGCTGCAGCCCAGGTTACATGGCCGCTTTCTGCATATTACCGGTAATGCCTCGTGCCGCAAGCTTTGGCTG
CTACCCCTTTTTGGCCCGTCCCGCTGCGCCAATTACACTGCCTGACTGACGCATGCCCTCCACACCAATGCAGAT
TTCCATCCCGATGATTACTACAAGGTGCATTCGTCGTCCGAGAGCGGAATGGCCTGCCATGGCGGCCGGGGCATG
GCCGGCACCTACGGGGCCGAAAAGACGGATTGCGACTCGCCCTTTTCGCTCGTCAACGCCACCTTTGACTGGATC
GCCGACAATTTGCGCGACAAGATTGACTTTGTCGTGTGGACCGGCGATTCCGCCCGCCACGATAGCGACGAAAAA
CATCCCCGTCACCAAGACGAGGTGCTCGACTCGAACCGCGCCATTGCCAACAAATTTGTCCATACTTTTTCTTCC
CCCAAGGGCAAGCTGTCCCTGCCAATTGTCCCCACCTTTGGAAACAATGATTTCCTCCCGCACAATATCATGCTC
CCGGGCCCCAACAAGTGGTTCCAGGCCTATGCTGACATTTGGAGACGCTTCATCCCCGAGGAGCAGCGTCACTCG
TTTGAATTTGGAGGATGGTTCTATGTCGAGGTGATTCCCAACAAGCTTGCCGTCTTTAGCCTCAACACAATGTTT
TTCTTCGACCGCAATGCTGCCGTTGACGGCTGTGCCGAGCCTTCGGAGCCCGGCTATAAGCACATGGAATGGCTT
CGCGTGCACCTGCAGCTTATTCGCCAACGCGGCATGAAGGCAATCCTCATGGGCCATGTCCCTCCGGCCCGCACA
GACAGCAAGCAAAACTGGGATGAAACGTGCTGGCAGCGCTACACGCTGTGGCTTCGCCAGTATCGCGACGTTGTT
TCCGCCTCGCTCTTTGGACACATGAACATTGATCACTTTTTACTCCAAGACACCAAAAAACTATACATTACCCAA
AATGCAGAGCAGCATCACGACGACCCGCCCTTGATGGTTCGTTCCAAAGAGAACTATTTACAAGAGCTGCGTGAT
GAATGGGCCGACTTGCCCGATCCAATCATCAGCATTCTCGACAGTGACCAGCCAGACGACTCTGATGTCCATGAT
GACGTCCAAGGCTCCAAAAAGAAGAAGAAGAACAAGGATAAATTTGCCAAGATTGGTGGAAAGTATGCCGAGCGC
TATCAACTGTCACTTGTTAGCCCCAGTATGGTTCCCAACTACTTTCCAACATTGCGCGTATTTGAATACAATATT
ACGGGTCTCGAGGGGGCAGCCGTTTGGAGGGACTCGTATGACTCCAGGGCGTTGCCGACATCATGGCTCCAACAA
GAGTCCCAACACGTGGAGCTTCGGCGGCATCTCCATGTCGACAAGAAGAAGAAGAAGAAGAAGAAGGACAAGCAC
AGACGGCCAGATGCTCCTGAGATTGTGCCTGAAGATCCGGCAGATGAGGCGCTTCCAGGACCGGCCTACAGCGCT
CAGCCTCTGACGTTGACAGGCTATGTTCAGTACTACGCCAACCTGACACATCTCAACAATGATATGCCTGAGCCA
AATATGGATACGAGCAAGTGGCGCGCGGGGAACCCGCATAAGAAGCCTAAACACTCGCCGCCTCGGCCTCTCCCG
TTTCGGTTCGATGTCGAATACAGCACCTTTGACGATAAGATATATAGATTACGAGATCTGACAGTCAAAAGTTAC
CTACACTTGGCGTACCGCATGGGCAAAAAGGAAAAGATGGGATTGGTCGACCATGTCAAGGACGACAATGATGAA
GATTTGGCCGACAGCTTGGAGCAAGAGCAAGAGCTTTCAGACGGAGTGGATGCAGACAAGAAGAAGAAGAAGAAG
AAGGGAAAGAAGAGAAGAAAGAAGAAGGAGCGGCAGCGCGATGCAAACAAGACGTGGCTCCATTTTCTCAGTCAT
GCGTTTGTCAAGACGGTGCCGAAAAAAGACCTGAAAAAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail