Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|7785
Gene name
LocationContig_89:19012..21481
Strand-
Gene length (bp)2469
Transcript length (bp)2409
Coding sequence length (bp)2409
Protein length (aa) 803

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.4E-46 449 737
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.1E-19 453 736

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94235|MPH1L_SCHPO Serine/threonine-protein kinase mph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mph1 PE=2 SV=1 373 745 6.0E-80
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 414 752 2.0E-74
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1 425 736 3.0E-70
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 441 742 2.0E-62
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 419 742 9.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94235|MPH1L_SCHPO Serine/threonine-protein kinase mph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mph1 PE=2 SV=1 373 745 6.0E-80
sp|P54199|MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPS1 PE=1 SV=2 414 752 2.0E-74
sp|Q54UL8|MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum GN=mps1 PE=3 SV=1 425 736 3.0E-70
sp|P35761|TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus GN=Ttk PE=1 SV=1 441 742 2.0E-62
sp|Q8AYG3|TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio GN=ttk PE=1 SV=2 419 742 9.0E-62
sp|Q4R945|TTK_MACFA Dual specificity protein kinase TTK OS=Macaca fascicularis GN=TTK PE=2 SV=1 417 735 2.0E-61
sp|P33981|TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens GN=TTK PE=1 SV=2 441 735 1.0E-60
sp|Q8SSH4|MPS1_ENCCU Probable serine/threonine-protein kinase MPS1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MPS1 PE=3 SV=1 455 736 7.0E-46
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 444 677 4.0E-21
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 445 677 9.0E-21
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 417 762 4.0E-20
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 445 677 8.0E-20
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 437 762 1.0E-19
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 445 681 3.0E-19
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 445 677 3.0E-19
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 445 677 3.0E-19
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 445 677 4.0E-19
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 445 677 4.0E-19
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 415 677 7.0E-19
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 449 718 8.0E-19
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 449 735 1.0E-18
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 394 677 1.0E-18
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 495 737 3.0E-18
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 416 677 4.0E-18
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 495 737 5.0E-18
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 449 735 5.0E-18
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 436 742 8.0E-18
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 436 742 9.0E-18
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 436 742 9.0E-18
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 436 742 1.0E-17
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 416 677 2.0E-17
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 455 714 2.0E-17
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 449 735 2.0E-17
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 455 701 3.0E-17
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 446 733 4.0E-17
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 455 691 4.0E-17
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 423 677 6.0E-17
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 455 677 6.0E-17
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 455 677 6.0E-17
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 519 700 7.0E-17
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 455 691 7.0E-17
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 455 677 7.0E-17
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 455 677 8.0E-17
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 455 735 9.0E-17
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 455 735 1.0E-16
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 440 677 1.0E-16
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 519 700 1.0E-16
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 438 735 1.0E-16
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 455 677 1.0E-16
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 448 799 2.0E-16
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 448 799 2.0E-16
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 439 700 2.0E-16
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 550 734 2.0E-16
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 449 735 2.0E-16
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 455 690 2.0E-16
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 449 735 2.0E-16
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 455 700 2.0E-16
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 495 737 3.0E-16
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 455 677 3.0E-16
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 455 690 3.0E-16
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 550 734 3.0E-16
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 416 753 3.0E-16
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 561 701 3.0E-16
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 405 677 4.0E-16
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 561 701 4.0E-16
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 455 690 4.0E-16
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 447 677 4.0E-16
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 561 701 4.0E-16
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 446 740 4.0E-16
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 447 677 4.0E-16
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 550 734 4.0E-16
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 448 735 4.0E-16
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 550 734 4.0E-16
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 447 753 5.0E-16
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 449 743 5.0E-16
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 455 677 6.0E-16
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 449 701 7.0E-16
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 495 677 7.0E-16
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 449 743 8.0E-16
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 495 677 9.0E-16
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 561 702 1.0E-15
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 437 679 1.0E-15
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 495 677 1.0E-15
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 561 702 1.0E-15
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 455 690 1.0E-15
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 455 677 1.0E-15
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 561 702 1.0E-15
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 455 677 1.0E-15
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 455 690 2.0E-15
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 455 690 2.0E-15
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 455 700 2.0E-15
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 455 690 2.0E-15
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 449 754 2.0E-15
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 449 757 3.0E-15
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 455 677 3.0E-15
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 449 745 3.0E-15
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 437 677 3.0E-15
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 455 749 4.0E-15
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 561 700 4.0E-15
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 455 751 5.0E-15
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 458 735 6.0E-15
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 449 677 8.0E-15
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 447 753 8.0E-15
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 456 743 8.0E-15
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 449 677 8.0E-15
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 449 679 8.0E-15
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 449 679 8.0E-15
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 561 677 1.0E-14
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 455 677 1.0E-14
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 561 700 1.0E-14
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 561 700 1.0E-14
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 561 700 1.0E-14
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 449 745 1.0E-14
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 561 700 1.0E-14
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 449 745 1.0E-14
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 453 693 1.0E-14
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 449 700 1.0E-14
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 443 735 2.0E-14
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 432 764 2.0E-14
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 449 697 2.0E-14
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 443 735 2.0E-14
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 449 677 2.0E-14
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 449 766 3.0E-14
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 449 677 3.0E-14
sp|P62205|PLK1_XENTR Serine/threonine-protein kinase PLK1 OS=Xenopus tropicalis GN=plk1 PE=2 SV=1 455 753 3.0E-14
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 449 735 3.0E-14
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 383 677 3.0E-14
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 449 700 3.0E-14
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 432 764 3.0E-14
sp|P52304|POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster GN=polo PE=1 SV=2 447 677 3.0E-14
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 455 721 4.0E-14
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 495 677 4.0E-14
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 495 758 4.0E-14
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 455 677 4.0E-14
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 449 735 4.0E-14
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 495 677 4.0E-14
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 446 677 4.0E-14
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 398 677 4.0E-14
sp|Q86UE8|TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens GN=TLK2 PE=1 SV=2 507 744 4.0E-14
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 449 742 5.0E-14
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 449 766 5.0E-14
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 443 677 5.0E-14
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 474 677 5.0E-14
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 425 749 5.0E-14
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 443 677 5.0E-14
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 455 694 6.0E-14
sp|F1SPM8|AAK1_PIG AP2-associated protein kinase 1 OS=Sus scrofa GN=AAK1 PE=2 SV=2 441 687 6.0E-14
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 455 737 6.0E-14
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 443 677 6.0E-14
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 443 677 6.0E-14
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 449 699 6.0E-14
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 449 677 6.0E-14
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 444 677 7.0E-14
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 443 677 7.0E-14
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 455 700 7.0E-14
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 449 677 7.0E-14
sp|Q08CW1|TLK2_XENTR Serine/threonine-protein kinase tousled-like 2 OS=Xenopus tropicalis GN=tlk2 PE=2 SV=1 507 744 8.0E-14
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 458 735 8.0E-14
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 435 727 9.0E-14
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 455 677 9.0E-14
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 449 677 9.0E-14
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 455 677 9.0E-14
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 495 677 9.0E-14
sp|Q8NU98|PKN1_CORGL Probable serine/threonine-protein kinase PknB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknB PE=3 SV=1 449 685 9.0E-14
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 449 748 9.0E-14
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 449 754 1.0E-13
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 455 754 1.0E-13
sp|O55047|TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus GN=Tlk2 PE=1 SV=2 507 744 1.0E-13
sp|Q20845|PLK3_CAEEL Serine/threonine-protein kinase plk-3 OS=Caenorhabditis elegans GN=plk-3 PE=2 SV=1 449 677 1.0E-13
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 449 745 1.0E-13
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 552 677 1.0E-13
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 455 677 1.0E-13
sp|Q2M2I8|AAK1_HUMAN AP2-associated protein kinase 1 OS=Homo sapiens GN=AAK1 PE=1 SV=3 441 687 1.0E-13
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 455 677 2.0E-13
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 449 677 2.0E-13
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 453 677 2.0E-13
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 449 677 2.0E-13
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 449 677 2.0E-13
sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus GN=AAK1 PE=1 SV=2 441 687 2.0E-13
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 449 677 2.0E-13
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 455 728 2.0E-13
sp|P54741|AFSK_STRCO Serine/threonine-protein kinase AfsK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsK PE=1 SV=2 455 749 2.0E-13
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 454 677 2.0E-13
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 438 691 2.0E-13
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 455 728 2.0E-13
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 455 742 2.0E-13
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 449 691 2.0E-13
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 449 700 2.0E-13
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 455 742 2.0E-13
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 449 678 2.0E-13
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 561 677 2.0E-13
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 455 742 2.0E-13
sp|P0C1X8|AAK1_RAT AP2-associated protein kinase 1 OS=Rattus norvegicus GN=Aak1 PE=1 SV=1 441 687 3.0E-13
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 449 677 3.0E-13
sp|P34331|PLK1_CAEEL Serine/threonine-protein kinase plk-1 OS=Caenorhabditis elegans GN=plk-1 PE=1 SV=3 446 677 3.0E-13
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 449 677 3.0E-13
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 455 677 3.0E-13
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 449 677 3.0E-13
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 446 701 3.0E-13
sp|Q3UHJ0|AAK1_MOUSE AP2-associated protein kinase 1 OS=Mus musculus GN=Aak1 PE=1 SV=2 441 687 3.0E-13
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 455 742 3.0E-13
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 449 677 3.0E-13
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 455 677 3.0E-13
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 446 678 4.0E-13
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 449 683 4.0E-13
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 449 700 4.0E-13
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 454 677 4.0E-13
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 563 744 4.0E-13
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 455 728 4.0E-13
sp|Q8SR90|Y8H9_ENCCU Probable cell division protein kinase ECU11_1290 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1790 PE=3 SV=1 455 677 4.0E-13
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 449 753 4.0E-13
sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 455 677 4.0E-13
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 455 735 4.0E-13
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 455 728 5.0E-13
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 449 683 5.0E-13
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 449 735 5.0E-13
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 495 673 5.0E-13
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 415 677 5.0E-13
sp|Q15831|STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens GN=STK11 PE=1 SV=1 438 677 5.0E-13
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 449 677 5.0E-13
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 449 677 5.0E-13
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 416 677 5.0E-13
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 455 677 5.0E-13
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 453 677 5.0E-13
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 455 677 6.0E-13
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 422 727 6.0E-13
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 449 742 6.0E-13
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 449 677 6.0E-13
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 563 677 6.0E-13
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 449 677 6.0E-13
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 419 762 6.0E-13
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 451 678 6.0E-13
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 446 735 6.0E-13
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 454 677 6.0E-13
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 449 677 6.0E-13
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 550 719 7.0E-13
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 561 701 7.0E-13
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 550 719 7.0E-13
sp|Q1ECX4|TLK2_DANRE Serine/threonine-protein kinase tousled-like 2 OS=Danio rerio GN=tlk2 PE=2 SV=2 579 744 7.0E-13
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 563 744 7.0E-13
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 455 694 7.0E-13
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 455 700 7.0E-13
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 455 700 7.0E-13
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 449 677 7.0E-13
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 449 677 7.0E-13
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 422 727 7.0E-13
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 455 700 7.0E-13
sp|Q9UU87|PPK34_SCHPO Serine/threonine-protein kinase ppk34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk34 PE=3 SV=2 564 742 7.0E-13
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 454 700 7.0E-13
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 560 700 8.0E-13
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 455 700 8.0E-13
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 449 677 8.0E-13
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 455 700 8.0E-13
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 449 677 8.0E-13
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 455 677 8.0E-13
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 457 742 8.0E-13
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 433 686 8.0E-13
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 419 762 8.0E-13
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 433 686 8.0E-13
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 453 677 8.0E-13
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 455 700 8.0E-13
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 563 744 9.0E-13
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 455 742 9.0E-13
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 495 678 9.0E-13
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 495 678 9.0E-13
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 455 677 1.0E-12
sp|Q95YH0|CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum GN=cdk8 PE=2 SV=1 449 677 1.0E-12
sp|Q8C0V0|TLK1_MOUSE Serine/threonine-protein kinase tousled-like 1 OS=Mus musculus GN=Tlk1 PE=1 SV=2 507 744 1.0E-12
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 449 677 1.0E-12
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 448 692 1.0E-12
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 495 677 1.0E-12
sp|Q8FUI5|PKN1_COREF Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0033 PE=3 SV=1 449 685 1.0E-12
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 555 677 1.0E-12
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 495 764 1.0E-12
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 453 677 1.0E-12
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 550 719 1.0E-12
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 455 677 1.0E-12
sp|Q9UKI8|TLK1_HUMAN Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens GN=TLK1 PE=1 SV=2 507 744 1.0E-12
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 455 677 1.0E-12
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 454 700 1.0E-12
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 455 745 1.0E-12
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 450 677 1.0E-12
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 449 677 1.0E-12
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 453 677 1.0E-12
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 455 677 1.0E-12
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 449 677 1.0E-12
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 449 677 2.0E-12
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 565 746 2.0E-12
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 550 724 2.0E-12
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 449 677 2.0E-12
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 449 774 2.0E-12
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 419 762 2.0E-12
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 403 677 2.0E-12
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 455 694 2.0E-12
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 449 677 2.0E-12
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 435 752 2.0E-12
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 449 774 2.0E-12
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 444 677 2.0E-12
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 449 677 2.0E-12
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 449 677 2.0E-12
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 560 702 2.0E-12
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 449 678 2.0E-12
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 560 700 2.0E-12
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 449 677 2.0E-12
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 508 794 2.0E-12
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 449 774 2.0E-12
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 455 677 2.0E-12
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 449 677 2.0E-12
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 560 702 2.0E-12
sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 455 677 2.0E-12
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 446 701 2.0E-12
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 563 677 2.0E-12
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 449 677 2.0E-12
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 455 677 2.0E-12
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 560 677 3.0E-12
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 449 677 3.0E-12
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 560 700 3.0E-12
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 449 677 3.0E-12
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 443 677 3.0E-12
sp|Q556J6|Y4007_DICDI Putative cyclin-dependent serine/threonine-protein kinase DDB_G0272797/DDB_G0274007 OS=Dictyostelium discoideum GN=DDB_G0272797 PE=3 SV=1 456 678 3.0E-12
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 455 677 3.0E-12
sp|Q8SRU0|CSK2A_ENCCU Probable casein kinase II subunit alpha homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CKA1 PE=3 SV=1 495 695 3.0E-12
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 454 677 3.0E-12
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 443 677 3.0E-12
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 455 677 3.0E-12
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 555 677 3.0E-12
sp|Q1DN93|ATG1_COCIM Serine/threonine-protein kinase ATG1 OS=Coccidioides immitis (strain RS) GN=ATG1 PE=3 SV=1 449 700 3.0E-12
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 555 697 3.0E-12
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 449 677 3.0E-12
sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 552 677 3.0E-12
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 454 677 3.0E-12
sp|Q54D75|Y2550_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 OS=Dictyostelium discoideum GN=DDB_G0292550 PE=3 SV=1 454 678 3.0E-12
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 563 786 3.0E-12
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 449 677 3.0E-12
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 495 677 4.0E-12
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 550 701 4.0E-12
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 449 671 4.0E-12
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 565 696 4.0E-12
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 455 766 4.0E-12
sp|Q91Z96|BMP2K_MOUSE BMP-2-inducible protein kinase OS=Mus musculus GN=Bmp2k PE=1 SV=1 441 687 4.0E-12
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 453 700 5.0E-12
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 449 677 5.0E-12
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 443 677 5.0E-12
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 449 744 5.0E-12
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 487 677 5.0E-12
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 442 749 5.0E-12
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 449 742 5.0E-12
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 448 675 5.0E-12
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 419 705 5.0E-12
sp|Q5Z9J0|MPK12_ORYSJ Mitogen-activated protein kinase 12 OS=Oryza sativa subsp. japonica GN=MPK12 PE=1 SV=2 415 677 5.0E-12
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 555 677 5.0E-12
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 455 677 5.0E-12
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 448 742 6.0E-12
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 449 677 6.0E-12
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 560 737 6.0E-12
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 477 728 6.0E-12
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 455 677 6.0E-12
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 455 722 6.0E-12
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 448 677 6.0E-12
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 449 677 6.0E-12
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 446 677 7.0E-12
sp|Q0KHT7|DAPKR_DROME Death-associated protein kinase related OS=Drosophila melanogaster GN=Drak PE=1 SV=2 455 678 7.0E-12
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 455 677 7.0E-12
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 436 677 7.0E-12
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 446 677 8.0E-12
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 447 697 8.0E-12
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 561 684 8.0E-12
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 449 744 8.0E-12
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 449 677 8.0E-12
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 448 735 8.0E-12
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 449 736 8.0E-12
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 449 677 8.0E-12
sp|Q9Y1J3|PDPK1_CAEEL 3-phosphoinositide-dependent protein kinase 1 OS=Caenorhabditis elegans GN=pdk-1 PE=1 SV=1 554 710 9.0E-12
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 560 684 9.0E-12
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 560 684 9.0E-12
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 556 744 9.0E-12
sp|Q9M8J5|M2K8_ARATH Mitogen-activated protein kinase kinase 8 OS=Arabidopsis thaliana GN=MKK8 PE=3 SV=2 415 742 1.0E-11
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 560 684 1.0E-11
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 449 714 1.0E-11
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 449 751 1.0E-11
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 552 677 1.0E-11
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 552 677 1.0E-11
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 552 677 1.0E-11
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 552 677 1.0E-11
sp|Q1RLU9|CDK15_DANRE Cyclin-dependent kinase 15 OS=Danio rerio GN=cdk15 PE=2 SV=1 445 691 1.0E-11
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 447 677 1.0E-11
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 565 677 1.0E-11
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 455 735 1.0E-11
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 449 742 1.0E-11
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 455 744 1.0E-11
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 455 677 1.0E-11
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 449 742 1.0E-11
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 444 677 1.0E-11
sp|P34314|TLK1_CAEEL Serine/threonine-protein kinase tousled-like 1 OS=Caenorhabditis elegans GN=tlk-1 PE=1 SV=3 447 734 1.0E-11
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 571 794 1.0E-11
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 432 677 1.0E-11
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 449 677 1.0E-11
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 447 677 1.0E-11
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 454 742 1.0E-11
sp|P49071|MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster GN=MAPk-Ak2 PE=2 SV=1 450 677 1.0E-11
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 455 677 1.0E-11
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 557 737 1.0E-11
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 432 721 1.0E-11
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 560 743 1.0E-11
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 550 702 1.0E-11
sp|P24923|CDC21_MEDSA Cell division control protein 2 homolog 1 (Fragment) OS=Medicago sativa GN=CDC2A PE=2 SV=1 455 670 1.0E-11
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 495 677 1.0E-11
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 453 754 1.0E-11
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 563 744 1.0E-11
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 550 702 1.0E-11
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 550 702 1.0E-11
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 550 702 1.0E-11
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 455 677 2.0E-11
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 495 677 2.0E-11
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 455 677 2.0E-11
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 555 677 2.0E-11
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 454 677 2.0E-11
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 453 677 2.0E-11
sp|Q86YV6|MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens GN=MYLK4 PE=1 SV=2 415 677 2.0E-11
sp|Q90ZY6|TLK1B_DANRE Serine/threonine-protein kinase tousled-like 1-B OS=Danio rerio GN=tlk1b PE=2 SV=1 507 744 2.0E-11
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 453 677 2.0E-11
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 455 721 2.0E-11
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 455 677 2.0E-11
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 495 677 2.0E-11
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 455 677 2.0E-11
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 487 677 2.0E-11
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 426 677 2.0E-11
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 475 677 2.0E-11
sp|Q54VV7|Y0111_DICDI Probable serine/threonine-protein kinase DDB_G0280111 OS=Dictyostelium discoideum GN=DDB_G0280111 PE=3 SV=1 455 677 2.0E-11
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 447 742 2.0E-11
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 487 687 2.0E-11
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 499 692 2.0E-11
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 455 704 2.0E-11
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 455 677 2.0E-11
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 455 677 2.0E-11
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 455 671 2.0E-11
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 455 678 2.0E-11
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 548 677 2.0E-11
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 455 677 2.0E-11
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 449 677 2.0E-11
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 449 677 2.0E-11
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 449 774 3.0E-11
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 453 677 3.0E-11
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 449 735 3.0E-11
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 571 794 3.0E-11
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 449 725 3.0E-11
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 455 728 3.0E-11
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 491 678 3.0E-11
sp|Q17QV9|STK40_BOVIN Serine/threonine-protein kinase 40 OS=Bos taurus GN=STK40 PE=2 SV=1 550 686 3.0E-11
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 455 677 3.0E-11
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 444 677 3.0E-11
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 455 677 3.0E-11
sp|Q9Y7T4|ATG1_SCHPO Serine/threonine-protein kinase atg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg1 PE=1 SV=1 449 704 3.0E-11
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 455 700 3.0E-11
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 447 677 3.0E-11
sp|Q9NSY1|BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens GN=BMP2K PE=1 SV=2 441 687 3.0E-11
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 575 677 3.0E-11
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 444 742 3.0E-11
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 449 677 3.0E-11
sp|Q6C7U0|ATG1_YARLI Serine/threonine-protein kinase ATG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG1 PE=3 SV=1 447 677 3.0E-11
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 449 677 3.0E-11
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 455 677 3.0E-11
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 449 735 3.0E-11
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 447 677 4.0E-11
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 454 723 4.0E-11
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 560 700 4.0E-11
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 447 677 4.0E-11
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 449 737 4.0E-11
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 560 677 4.0E-11
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 419 705 4.0E-11
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 449 677 4.0E-11
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 560 677 4.0E-11
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 449 735 4.0E-11
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 561 700 4.0E-11
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 470 742 4.0E-11
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 455 671 4.0E-11
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 575 677 4.0E-11
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 455 677 4.0E-11
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 455 704 4.0E-11
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 455 725 4.0E-11
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 447 677 4.0E-11
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 455 677 5.0E-11
sp|Q6ZAG3|CDKC3_ORYSJ Cyclin-dependent kinase C-3 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=3 SV=2 448 677 5.0E-11
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 455 677 5.0E-11
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 426 677 5.0E-11
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 447 677 5.0E-11
sp|Q20443|PRK2_CAEEL Serine/threonine-protein kinase prk-2 OS=Caenorhabditis elegans GN=prk-2 PE=3 SV=2 455 677 5.0E-11
sp|Q0D598|WNK1_ORYSJ Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. japonica GN=WNK1 PE=2 SV=1 449 742 5.0E-11
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 567 728 5.0E-11
sp|A2YMV6|WNK1_ORYSI Probable serine/threonine-protein kinase WNK1 OS=Oryza sativa subsp. indica GN=WNK1 PE=2 SV=2 449 742 5.0E-11
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 449 735 5.0E-11
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 447 677 5.0E-11
sp|Q8N2I9|STK40_HUMAN Serine/threonine-protein kinase 40 OS=Homo sapiens GN=STK40 PE=1 SV=2 550 686 5.0E-11
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 455 671 6.0E-11
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 455 677 6.0E-11
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 567 754 6.0E-11
sp|A2VDU3|M3K7_BOVIN Mitogen-activated protein kinase kinase kinase 7 OS=Bos taurus GN=MAP3K7 PE=2 SV=1 437 750 6.0E-11
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 447 677 6.0E-11
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 418 689 6.0E-11
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 454 677 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|7785
MGAIPIPRVSQRQTIRRPGTRPILNSSQSQVPAPSGEQRLRQQYRDDSSSEDEIPLPAKLSALKALLNDDAPDSS
AQPEPLPHTKRRTSQVVASSHNGKTYARPESAQSSDAGKRSPIAPTNEASPPRKRVVRLSGTPQSLNQIKPSRRR
STSVSRAPAGRPPSRTAARDREREVVTDQERSTVDAPSNPGLDNAQRCDVNTPAQKTRVVRIVLGSSGSKSRTRL
DSSGPSSAYSHMDRSAVDRSGLEIDPDASEAHDTGVRNLSNHGSAGHYSSGPSRNDENANLQSSMRVKRVGKIHG
SFLSGPARRGRRRQSEEDGEVNGEINGEGDIAMPAHESDDYRLADAKAADRRPEMPSCHDQENEIPINLKRAKVP
VDHVLDKRPRRASHVDINMRPTSPGRKPLAPMTNNTPLRPAPPPPSKKSIVEATASTTQAKQRRNVVKVNGKCYT
RHNCLGRGGSAKVYRVTDDNGAWFALKRVSLDNADELTIRGYKGEIDLLRKLSQVDRVIKLYDHEMNTEKQVLSL
IMEMGELDLNKMMTPSQDPTSNQYREKRSFDSADVRFWWKEMLECVQSVHQYDVVHSDLKPANFVLVQGRLKIID
FGIANAIQTDETVNVHRENQIGTPNYMSPESLTDSNNPRGTLGRQANQPKLMKLGKPSDVWSLGCILYQMVYGSP
PFGHIPNQMARCQAIIDWKHEIQFPSRGMGDVLVRPELLRTMQRCLNREQHMRPTCEELLHETDPFLYPVGFSDK
VLPMDEELLASIIQSVVAKCRERMPSESEVLSVWPQAYWARIQKTIAKQRGQ*
Coding >OphauB2|7785
ATGGGCGCTATTCCCATCCCAAGAGTCTCGCAGCGTCAGACTATTAGACGCCCAGGTACTCGACCAATTTTGAAT
AGCAGTCAAAGCCAAGTTCCAGCTCCCTCTGGGGAGCAGAGGCTGCGTCAGCAATACCGAGACGACAGCAGCTCA
GAAGACGAGATTCCTCTGCCTGCCAAGCTGAGCGCTCTCAAGGCCCTGCTCAATGATGATGCTCCCGACTCGTCT
GCCCAGCCAGAGCCTCTGCCACACACCAAACGACGGACTAGCCAAGTGGTGGCGTCTTCCCACAATGGCAAGACA
TATGCGAGGCCAGAAAGTGCACAGTCATCAGACGCCGGCAAACGCTCTCCAATAGCGCCGACAAATGAGGCCAGC
CCTCCTAGGAAACGCGTTGTGCGCCTCAGCGGCACCCCCCAGAGCCTAAACCAGATCAAGCCATCGAGGCGACGT
TCAACGTCGGTATCGAGAGCTCCAGCTGGACGGCCGCCGAGCAGAACGGCGGCTCGAGACCGGGAACGGGAAGTT
GTGACAGACCAGGAACGGTCAACTGTTGATGCGCCCTCCAATCCTGGTCTGGACAATGCCCAAAGATGCGATGTC
AATACGCCAGCTCAGAAAACACGTGTAGTGCGCATAGTACTAGGCTCTTCTGGGAGCAAAAGCCGCACCAGACTT
GATTCTTCGGGGCCTTCGTCGGCTTACTCGCACATGGACCGCTCTGCTGTCGACCGCTCTGGCCTGGAAATAGAC
CCTGATGCCTCGGAAGCGCACGATACTGGCGTGCGCAACTTGTCCAACCACGGCAGCGCTGGACACTATTCGTCA
GGGCCCAGTCGAAACGACGAGAATGCAAACCTGCAGAGCTCCATGCGCGTCAAGCGTGTGGGCAAAATTCACGGA
AGCTTCCTTAGCGGTCCTGCCAGACGAGGAAGGAGACGACAGAGCGAGGAAGATGGCGAAGTCAACGGCGAAATT
AATGGCGAAGGCGACATTGCCATGCCAGCTCACGAGTCAGATGACTATCGGCTGGCAGATGCCAAAGCTGCTGAC
AGGAGACCCGAGATGCCTTCATGTCACGATCAAGAGAACGAGATACCCATCAATCTCAAGCGTGCCAAAGTGCCG
GTAGATCACGTTTTGGACAAGAGGCCTCGGCGAGCCAGCCATGTGGACATTAACATGAGACCCACATCTCCAGGA
AGAAAACCTCTGGCTCCAATGACAAACAACACACCGCTAAGACCAGCTCCACCGCCGCCGTCAAAAAAATCAATA
GTGGAAGCGACTGCGTCAACGACACAGGCCAAGCAGCGGAGAAACGTGGTCAAGGTGAATGGAAAGTGCTATACG
AGACACAACTGCCTAGGACGAGGAGGGAGCGCAAAGGTTTATCGCGTCACAGACGACAATGGTGCCTGGTTTGCG
CTCAAGCGAGTGTCGCTTGACAATGCCGATGAGCTAACCATCAGGGGATACAAGGGAGAGATTGACTTGCTTAGA
AAACTGTCTCAAGTGGACCGAGTCATCAAGCTTTATGATCACGAGATGAATACAGAGAAGCAAGTGCTAAGCTTG
ATTATGGAGATGGGTGAGCTCGATCTGAATAAGATGATGACACCAAGCCAAGACCCGACCTCGAACCAATACCGC
GAGAAACGGAGTTTCGACTCGGCTGATGTGCGCTTTTGGTGGAAAGAAATGCTCGAATGCGTGCAATCGGTGCAT
CAATACGATGTTGTTCACTCGGACCTCAAACCAGCCAATTTTGTGCTGGTACAAGGCCGTCTCAAGATCATAGAC
TTTGGCATCGCAAATGCCATCCAGACGGACGAGACGGTCAATGTGCACCGCGAAAACCAGATTGGAACGCCCAAC
TACATGTCGCCCGAGTCTCTGACGGACTCGAACAATCCGCGCGGAACACTGGGGCGGCAAGCCAACCAGCCCAAG
CTTATGAAGCTTGGCAAACCAAGCGACGTATGGTCGTTGGGGTGCATTTTATACCAAATGGTATATGGGTCGCCG
CCATTTGGACACATTCCAAACCAGATGGCGCGCTGTCAGGCCATCATTGACTGGAAGCACGAAATCCAGTTTCCA
TCGCGAGGCATGGGAGATGTCCTAGTGCGCCCGGAACTATTGCGCACTATGCAGCGCTGTCTCAACCGAGAGCAG
CACATGCGGCCCACATGCGAGGAGCTGCTCCATGAGACGGACCCGTTCCTCTATCCCGTCGGGTTCAGCGACAAG
GTGCTGCCAATGGACGAGGAGCTGCTTGCCAGCATTATTCAGAGCGTCGTGGCAAAATGTCGAGAACGTATGCCC
AGCGAGAGCGAGGTTTTGAGCGTCTGGCCGCAAGCCTACTGGGCCAGGATCCAAAAGACAATTGCCAAGCAGAGG
GGGCAATGA
Transcript >OphauB2|7785
ATGGGCGCTATTCCCATCCCAAGAGTCTCGCAGCGTCAGACTATTAGACGCCCAGGTACTCGACCAATTTTGAAT
AGCAGTCAAAGCCAAGTTCCAGCTCCCTCTGGGGAGCAGAGGCTGCGTCAGCAATACCGAGACGACAGCAGCTCA
GAAGACGAGATTCCTCTGCCTGCCAAGCTGAGCGCTCTCAAGGCCCTGCTCAATGATGATGCTCCCGACTCGTCT
GCCCAGCCAGAGCCTCTGCCACACACCAAACGACGGACTAGCCAAGTGGTGGCGTCTTCCCACAATGGCAAGACA
TATGCGAGGCCAGAAAGTGCACAGTCATCAGACGCCGGCAAACGCTCTCCAATAGCGCCGACAAATGAGGCCAGC
CCTCCTAGGAAACGCGTTGTGCGCCTCAGCGGCACCCCCCAGAGCCTAAACCAGATCAAGCCATCGAGGCGACGT
TCAACGTCGGTATCGAGAGCTCCAGCTGGACGGCCGCCGAGCAGAACGGCGGCTCGAGACCGGGAACGGGAAGTT
GTGACAGACCAGGAACGGTCAACTGTTGATGCGCCCTCCAATCCTGGTCTGGACAATGCCCAAAGATGCGATGTC
AATACGCCAGCTCAGAAAACACGTGTAGTGCGCATAGTACTAGGCTCTTCTGGGAGCAAAAGCCGCACCAGACTT
GATTCTTCGGGGCCTTCGTCGGCTTACTCGCACATGGACCGCTCTGCTGTCGACCGCTCTGGCCTGGAAATAGAC
CCTGATGCCTCGGAAGCGCACGATACTGGCGTGCGCAACTTGTCCAACCACGGCAGCGCTGGACACTATTCGTCA
GGGCCCAGTCGAAACGACGAGAATGCAAACCTGCAGAGCTCCATGCGCGTCAAGCGTGTGGGCAAAATTCACGGA
AGCTTCCTTAGCGGTCCTGCCAGACGAGGAAGGAGACGACAGAGCGAGGAAGATGGCGAAGTCAACGGCGAAATT
AATGGCGAAGGCGACATTGCCATGCCAGCTCACGAGTCAGATGACTATCGGCTGGCAGATGCCAAAGCTGCTGAC
AGGAGACCCGAGATGCCTTCATGTCACGATCAAGAGAACGAGATACCCATCAATCTCAAGCGTGCCAAAGTGCCG
GTAGATCACGTTTTGGACAAGAGGCCTCGGCGAGCCAGCCATGTGGACATTAACATGAGACCCACATCTCCAGGA
AGAAAACCTCTGGCTCCAATGACAAACAACACACCGCTAAGACCAGCTCCACCGCCGCCGTCAAAAAAATCAATA
GTGGAAGCGACTGCGTCAACGACACAGGCCAAGCAGCGGAGAAACGTGGTCAAGGTGAATGGAAAGTGCTATACG
AGACACAACTGCCTAGGACGAGGAGGGAGCGCAAAGGTTTATCGCGTCACAGACGACAATGGTGCCTGGTTTGCG
CTCAAGCGAGTGTCGCTTGACAATGCCGATGAGCTAACCATCAGGGGATACAAGGGAGAGATTGACTTGCTTAGA
AAACTGTCTCAAGTGGACCGAGTCATCAAGCTTTATGATCACGAGATGAATACAGAGAAGCAAGTGCTAAGCTTG
ATTATGGAGATGGGTGAGCTCGATCTGAATAAGATGATGACACCAAGCCAAGACCCGACCTCGAACCAATACCGC
GAGAAACGGAGTTTCGACTCGGCTGATGTGCGCTTTTGGTGGAAAGAAATGCTCGAATGCGTGCAATCGGTGCAT
CAATACGATGTTGTTCACTCGGACCTCAAACCAGCCAATTTTGTGCTGGTACAAGGCCGTCTCAAGATCATAGAC
TTTGGCATCGCAAATGCCATCCAGACGGACGAGACGGTCAATGTGCACCGCGAAAACCAGATTGGAACGCCCAAC
TACATGTCGCCCGAGTCTCTGACGGACTCGAACAATCCGCGCGGAACACTGGGGCGGCAAGCCAACCAGCCCAAG
CTTATGAAGCTTGGCAAACCAAGCGACGTATGGTCGTTGGGGTGCATTTTATACCAAATGGTATATGGGTCGCCG
CCATTTGGACACATTCCAAACCAGATGGCGCGCTGTCAGGCCATCATTGACTGGAAGCACGAAATCCAGTTTCCA
TCGCGAGGCATGGGAGATGTCCTAGTGCGCCCGGAACTATTGCGCACTATGCAGCGCTGTCTCAACCGAGAGCAG
CACATGCGGCCCACATGCGAGGAGCTGCTCCATGAGACGGACCCGTTCCTCTATCCCGTCGGGTTCAGCGACAAG
GTGCTGCCAATGGACGAGGAGCTGCTTGCCAGCATTATTCAGAGCGTCGTGGCAAAATGTCGAGAACGTATGCCC
AGCGAGAGCGAGGTTTTGAGCGTCTGGCCGCAAGCCTACTGGGCCAGGATCCAAAAGACAATTGCCAAGCAGAGG
GGGCAATGA
Gene >OphauB2|7785
ATGGGCGCTATTCCCATCCCAAGAGTCTCGCAGCGTCAGACTATTAGACGCCCAGGTACTCGACCAATTTTGAAT
AGCAGTCAAAGCCAAGTTCCAGCTCCCTCTGGGGAGCAGAGGCTGCGTCAGCAATACCGAGACGACAGCAGCTCA
GAAGACGAGATTCCTCTGCCTGCCAAGCTGAGCGCTCTCAAGGCCCTGCTCAATGATGATGCTCCCGACTCGTCT
GCCCAGCCAGAGCCTCTGCCACACACCAAACGACGGACTAGCCAAGTGGTGGCGTCTTCCCACAATGGCAAGACA
TATGCGAGGCCAGAAAGTGCACAGTCATCAGACGCCGGCAAACGCTCTCCAATAGCGCCGACAAATGAGGCCAGC
CCTCCTAGGAAACGCGTTGTGCGCCTCAGCGGCACCCCCCAGAGCCTAAACCAGATCAAGCCATCGAGGCGACGT
TCAACGTCGGTATCGAGAGCTCCAGCTGGACGGCCGCCGAGCAGAACGGCGGCTCGAGACCGGGAACGGGAAGTT
GTGACAGACCAGGAACGGTCAACTGTTGATGCGCCCTCCAATCCTGGTCTGGACAATGCCCAAAGATGCGATGTC
AATACGCCAGCTCAGAAAACACGTGTAGTGCGCATAGTACTAGGCTCTTCTGGGAGCAAAAGCCGCACCAGACTT
GATTCTTCGGGGCCTTCGTCGGCTTACTCGCACATGGACCGCTCTGCTGTCGACCGCTCTGGCCTGGAAATAGAC
CCTGATGCCTCGGAAGCGCACGATACTGGCGTGCGCAACTTGTCCAACCACGGCAGCGCTGGACACTATTCGTCA
GGGCCCAGTCGAAACGACGAGAATGCAAACCTGCAGAGCTCCATGCGCGTCAAGCGTGTGGGCAAAATTCACGGA
AGCTTCCTTAGCGGTCCTGCCAGACGAGGAAGGAGACGACAGAGCGAGGAAGATGGCGAAGTCAACGGCGAAATT
AATGGCGAAGGCGACATTGCCATGCCAGCTCACGAGTCAGATGACTATCGGCTGGCAGATGCCAAAGCTGCTGAC
AGGAGACCCGAGATGCCTTCATGTCACGATCAAGAGAACGAGATACCCATCAATCTCAAGCGTGCCAAAGTGCCG
GTAGATCACGTTTTGGACAAGAGGCCTCGGCGAGCCAGCCATGTGGACATTAACATGAGACCCACATCTCCAGGA
AGAAAACCTCTGGCTCCAATGACAAACAACACACCGCTAAGACCAGCTCCACCGCCGCCGTCAAAAAAATCAATA
GTGGAAGCGACTGCGTCAACGACACAGGCCAAGCAGCGGAGAAACGTGGTCAAGGTGAATGGAAAGTGCTATACG
AGACACAACTGCCTAGGACGAGGAGGGAGCGCAAAGGTTTATCGCGTCACAGACGACAATGGTGCCTGGTTTGCG
CTCAAGCGAGTGTCGCTTGACAATGCCGATGAGCTAACCATCAGGGGATACAAGGGAGAGATTGACTTGCTTAGA
AAACTGTCTCAAGTGGACCGAGTCATCAAGCTTTATGATCACGAGATGAATACAGAGAAGCAAGTGCTAAGCTTG
GTAAGTCTTGCCATTCCCTGAGCTAGATGAAGTGGTATTGATGATGCCCCGGGCCCTTAGATTATGGAGATGGGT
GAGCTCGATCTGAATAAGATGATGACACCAAGCCAAGACCCGACCTCGAACCAATACCGCGAGAAACGGAGTTTC
GACTCGGCTGATGTGCGCTTTTGGTGGAAAGAAATGCTCGAATGCGTGCAATCGGTGCATCAATACGATGTTGTT
CACTCGGACCTCAAACCAGCCAATTTTGTGCTGGTACAAGGCCGTCTCAAGATCATAGACTTTGGCATCGCAAAT
GCCATCCAGACGGACGAGACGGTCAATGTGCACCGCGAAAACCAGATTGGAACGCCCAACTACATGTCGCCCGAG
TCTCTGACGGACTCGAACAATCCGCGCGGAACACTGGGGCGGCAAGCCAACCAGCCCAAGCTTATGAAGCTTGGC
AAACCAAGCGACGTATGGTCGTTGGGGTGCATTTTATACCAAATGGTATATGGGTCGCCGCCATTTGGACACATT
CCAAACCAGATGGCGCGCTGTCAGGCCATCATTGACTGGAAGCACGAAATCCAGTTTCCATCGCGAGGCATGGGA
GATGTCCTAGTGCGCCCGGAACTATTGCGCACTATGCAGCGCTGTCTCAACCGAGAGCAGCACATGCGGCCCACA
TGCGAGGAGCTGCTCCATGAGACGGACCCGTTCCTCTATCCCGTCGGGTTCAGCGACAAGGTGCTGCCAATGGAC
GAGGAGCTGCTTGCCAGCATTATTCAGAGCGTCGTGGCAAAATGTCGAGAACGTATGCCCAGCGAGAGCGAGGTT
TTGAGCGTCTGGCCGCAAGCCTACTGGGCCAGGATCCAAAAGACAATTGCCAAGCAGAGGGGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail